WO2017087580A1 - Bacteria engineered to reduce hyperphenylalaninemia - Google Patents

Bacteria engineered to reduce hyperphenylalaninemia Download PDF

Info

Publication number
WO2017087580A1
WO2017087580A1 PCT/US2016/062369 US2016062369W WO2017087580A1 WO 2017087580 A1 WO2017087580 A1 WO 2017087580A1 US 2016062369 W US2016062369 W US 2016062369W WO 2017087580 A1 WO2017087580 A1 WO 2017087580A1
Authority
WO
WIPO (PCT)
Prior art keywords
gene
promoter
encoding
pal
genetically engineered
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2016/062369
Other languages
English (en)
French (fr)
Inventor
Dean Falb
Vincent M. ISABELLA
Jonathan W. KOTULA
Paul F. Miller
Sarah ROWE
Yves Millet
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Synlogic Inc
Original Assignee
Synlogic Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority claimed from PCT/US2016/032562 external-priority patent/WO2016183531A1/en
Priority to CA3005451A priority Critical patent/CA3005451C/en
Priority to EP16810138.4A priority patent/EP3377518B1/en
Priority to EP22167588.7A priority patent/EP4095150A1/en
Priority to PL16810138.4T priority patent/PL3377518T3/pl
Priority to ES16810138T priority patent/ES2925049T3/es
Priority to AU2016356684A priority patent/AU2016356684C1/en
Application filed by Synlogic Inc filed Critical Synlogic Inc
Priority to US15/775,936 priority patent/US11618894B2/en
Priority to JP2018526505A priority patent/JP6993970B2/ja
Priority to US16/069,199 priority patent/US20190282628A1/en
Priority to PCT/US2017/013074 priority patent/WO2017123676A1/en
Publication of WO2017087580A1 publication Critical patent/WO2017087580A1/en
Anticipated expiration legal-status Critical
Priority to JP2021200761A priority patent/JP7245312B2/ja
Priority to AU2022201838A priority patent/AU2022201838B2/en
Priority to US18/068,004 priority patent/US20240076645A1/en
Priority to AU2025202726A priority patent/AU2025202726A1/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/88Lyases (4.)
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K35/00Medicinal preparations containing materials or reaction products thereof with undetermined constitution
    • A61K35/66Microorganisms or materials therefrom
    • A61K35/74Bacteria
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K35/00Medicinal preparations containing materials or reaction products thereof with undetermined constitution
    • A61K35/66Microorganisms or materials therefrom
    • A61K35/74Bacteria
    • A61K35/741Probiotics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P7/00Drugs for disorders of the blood or the extracellular fluid
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/195Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
    • C07K14/24Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Enterobacteriaceae (F), e.g. Citrobacter, Serratia, Proteus, Providencia, Morganella, Yersinia
    • C07K14/245Escherichia (G)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14Hydrolases (3)
    • C12N9/78Hydrolases (3) acting on carbon to nitrogen bonds other than peptide bonds (3.5)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12QMEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
    • C12Q1/00Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
    • C12Q1/527Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving lyase
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12YENZYMES
    • C12Y104/00Oxidoreductases acting on the CH-NH2 group of donors (1.4)
    • C12Y104/03Oxidoreductases acting on the CH-NH2 group of donors (1.4) with oxygen as acceptor (1.4.3)
    • C12Y104/03002L-Amino-acid oxidase (1.4.3.2)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12YENZYMES
    • C12Y403/00Carbon-nitrogen lyases (4.3)
    • C12Y403/01Ammonia-lyases (4.3.1)
    • C12Y403/01024Phenylalanine ammonia-lyase (4.3.1.24)
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2333/00Assays involving biological materials from specific organisms or of a specific nature
    • G01N2333/90Enzymes; Proenzymes
    • G01N2333/988Lyases (4.), e.g. aldolases, heparinase, enolases, fumarase
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2560/00Chemical aspects of mass spectrometric analysis of biological material
    • YGENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
    • Y02TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
    • Y02ATECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
    • Y02A50/00TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
    • Y02A50/30Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change

Definitions

  • compositions and therapeutic methods for reducing hyperphenylalaninemia relate to compositions and therapeutic methods for reducing hyperphenylalaninemia.
  • the disclosure relates to genetically engineered bacteria that are capable of reducing hyperphenylalaninemia in a mammal.
  • the compositions and methods disclosed herein may be used for treating diseases associated with hyperphenylalaninemia, e.g.,
  • Phenylalanine is an essential amino acid primarily found in dietary protein. Typically, a small amount is utilized for protein synthesis, and the remainder is hydroxylated to tyrosine in an enzymatic pathway that requires phenylalanine hydroxylase (PAH) and the cofactor tetrahydrobiopterin.
  • PAH phenylalanine hydroxylase
  • Hyperphenylalaninemia is a group of diseases associated with excess levels of phenylalanine, which can be toxic and cause brain damage.
  • Primary hyperphenylalaninemia is caused by deficiencies in PAH activity that result from mutations in the PAH gene and/or a block in cofactor metabolism.
  • Phenylketonuria is a severe form of hyperphenylalaninemia caused by mutations in the PAH gene.
  • PKU is an autosomal recessive genetic disease that ranks as the most common inborn error of metabolism worldwide (1 in 3,000 births), and affects approximately 13,000 patients in the United States. More than 400 different PAH gene mutations have been identified (Hoeks et al., 2009).
  • a buildup of phenylalanine (phe) in the blood can cause profound damage to the central nervous system in children and adults. If untreated in newborns, PKU can cause irreversible brain damage. Treatment for PKU currently involves complete exclusion of phenylalanine from the diet.
  • cofactor tetrahydrobiopterin also referred to as THB, BH4, Kuvan, or sapropterin
  • cofactor therapy is costly and only suitable for mild forms of
  • phenylketonuria The annual cost of Kuvan, for example, may be as much as $57,000 per patient. Additionally, the side effects of Kuvan can include gastritis and severe allergic reactions (e.g., wheezing, lightheadedness, nausea, flushing of the skin).
  • phenylalanine ammonia lyase is capable of metabolizing phenylalanine to non-toxic levels of ammonia and transcinnamic acid. Unlike PAH, PAL does not require THB cofactor activity in order to metabolize phenylalanine.
  • Studies of oral enzyme therapy using PAL have been conducted, but "human and even the animal studies were not continued because PAL was not available in sufficient amounts at reasonable cost" (Sarkissian et al., 1999).
  • a pegylated form of recombinant PAL (PEG-PAL) is also in development as an injectable form of treatment. However, most subjects dosed with PEG-PAL have suffered from injection site reactions and/or developed antibodies to this therapeutic enzyme (Longo et al., 2014). Thus, there is significant unmet need for effective, reliable, and/or long-term treatment for diseases associated with PEG-PAL.
  • hyperphenylalaninemia including PKU.
  • PKU hyperphenylalaninemia
  • the disclosure provides genetically engineered bacteria that encode and express a phenylalanine metabolizing enzyme (PME).
  • PME phenylalanine metabolizing enzyme
  • the disclosure provides genetically engineered bacteria that encode and express phenylalanine ammonia lyase and/or phenylalanine hydroxylase and/or L- aminoacid deaminase and are capable of reducing hyperphenylalaninemia.
  • phenylalanine ammonia lyase is capable of metabolizing phenylalanine to non-toxic levels of ammonia and transcinnamic acid. Unlike PAH, PAL does not require THB cofactor activity in order to metabolize phenylalanine.
  • L-amino acid deaminase LAAD catalyzes oxidative deamination of phenylalanine to generate phenylpyruvate, and trace amounts of ammonia and hydrogen peroxide.
  • Phenylpyruvic acid is widely used in the pharmaceutical, food, and chemical industries, and PPA is the starting material for the synthesis of D- phenylalanine, a raw intermediate in the production of many chiral drugs and food additives.
  • LAAD has therefore been studied in the context of industrial PPA production (Hou et al. 2015, Appl Microbiol Biotechnol. 2015 Oct;99(20):8391-402; "Production of phenylpyruvic acid from L-phenylalanine using an L-amino acid deaminase from Proteus mirabilis: comparison of enzymatic and whole-cell biotransformation approaches").
  • Phenylpyruvate is unable to cross the blood brain barrier (Steele, Fed Proc. 1986 Jun;45(7):2060-4; "Blood-brain barrier transport of the alpha-keto acid analogs of amino acids.,” indicating that this conversion is useful in controlling the neurological phenotypes of PKU.
  • the disclosure provides genetically engineered bacteria that encode and express a phenylalanine metabolizing enzyme (PME).
  • PME phenylalanine metabolizing enzyme
  • the disclosure provides genetically engineered bacteria that encode and express phenylalanine ammonia lyase (PAL) and/or phenylalanine hydroxylase (PAH) and/or L-aminoacid deaminase (L-AAD) and are capable of reducing hyperphenylalaninemia.
  • PAL phenylalanine ammonia lyase
  • PAH phenylalanine hydroxylase
  • L-AAD L-aminoacid deaminase
  • the genetically engineered bacteria comprise a gene encoding non-native phenylalanine ammonia lyase (PAL) and are capable of processing and reducing phenylalanine in a mammal.
  • the engineered bacteria further comprise a gene encoding a phenylalanine transporter, e.g., PheP.
  • the engineered bacteria may also comprise a gene encoding L-AAD.
  • the engineered bacteria may also contain one or more gene sequences relating to bio-safety and/or bio-containment, e.g., a kill-switch, gene guard system, and/or auxotrophy.
  • the engineered bacteria may contain an antibiotic resistance gene.
  • the expression of any these gene sequence(s) may be regulated using a variety of promoter systems, such as any of the promoter systems disclosed herein, which promoter system may involve use of the same promoter to regulate one or more different genes, may involve use of a different copy of the same promoter to regulate different genes, and/or may involve the use of different promoters used in combination to regulate the expression of different genes.
  • the use of different regulatory or promoter systems to control gene expression provides flexibility (e.g., the ability to differentially control gene expression under different environmental conditions and/or the ability to differentially control gene expression temporally) and also provides the ability to "fine-tune" gene expression, any or all of which regulation may serve to optimize gene expression and/or growth of the bacteria.
  • the genetically engineered bacteria are nonpathogenic and may be introduced into the gut in order to reduce toxic levels of phenylalanine.
  • the phenylalanine ammonia lyase and/or phenylalanine hydroxylase and/or L-aminoacid deaminase is stably produced by the genetically engineered bacteria, and/or the genetically engineered bacteria are stably maintained in vivo and/or in vitro.
  • the genetically engineered bacteria further comprise a phenylalanine transporter gene to increase their uptake of phenylalanine.
  • the invention also provides pharmaceutical compositions comprising the genetically engineered bacteria, and methods of modulating and treating disorders associated with hyperphenylalaninemia. [014]
  • the invention also provides methods of measuring and monitoring phenylalanine ammonia lyase activity, and methods of measuring and monitoring therapeutic activity of the genetically engineered bacteria expressing phenylalanine ammonia lyase.
  • Fig. 1 depicts a synthetic biotic for treating phenylketonuria (PKU) and disorders characterized by hyperphenylalaninemia.
  • Fig. 2A depicts a schematic of phenylalanine hydroxylase action in phenylketonuria (PKU).
  • Fig. 2B depicts a schematic of phenylalanine hydroxylase (PAH) action.
  • Fig. 2C depicts a schematic of phenylalanine ammonia lyase (PAL) action.
  • Fig. 2D depicts a schematic of L-amino acid deaminase (LAAD; e.g., from Proteus mirabilis) action.
  • LAAD L-amino acid deaminase
  • FIG. 3 depicts an exemplary synthetic biotic for treating
  • PKU phenylketonuria
  • FIG. 4 depicts an exemplary synthetic biotic for treating
  • PKU phenylketonuria
  • FIG. 5 depicts an exemplary synthetic biotic for treating
  • PKU phenylketonuria
  • Fig. 6 depicts the gene organization of an exemplary construct comprising a gene encoding PAL3 and a Tet promoter sequence on a high-copy plasmid e.g., as comprised in SYN-PKU202, SYN-PKU303.
  • Fig. 7 depicts the gene organization of an exemplary construct comprising a gene encoding PAL3 and an F R promoter sequence on a low-copy plasmid, e.g., as comprised in SYN-PKU304, SYN-PKU307, SYN-PKU305, SYN- PKU306.
  • Fig. 8 depicts the gene organization of an exemplary construct comprising a gene encoding PAL3 and a Tet promoter sequence on a low-copy plasmid, e.g., SYN-PKU302, SYN-PKU201.
  • Fig. 9 depicts the gene organization of an exemplary construct, e.g., comprised in SYN-PKU401, comprising a cloned LAAD gene under the control of a Tet promoter sequence and a Tet repressor gene.
  • Fig. 10 depicts a schematic representation of the construction of a pheP knock-in strain, wherein recombineering is used to insert a second copy of pheP into the Nissle lacZ gene.
  • Fig. 11 depicts the gene organization of an exemplary construct comprising a gene encoding PheP, a gene encoding TetR, and a Tet promoter sequence for chromosomal insertion e.g., as for example comprised in SYN-PKU203, SYN- PKU401, SYN-PKU402, SYN-PKU302, and SYN-PKU303.
  • Fig. 12A depicts the gene organization of an exemplary construct, comprising a cloned PAL3 gene under the control of an F R promoter sequence, on a low-copy, kanamycin-resistant plasmid (pSClOl origin of replication). Under anaerobic and/or low oxygen conditions, PAL3 degrades phenylalanine to non-toxic trans-cinnamate.
  • Fig. 12B depicts an additional copy of the endogenous E. coli high affinity phenylalanine transporter, pheP, driven by the PfnrS promoter and inserted into the lacZ locus on the Nissle chromosome.
  • Figs. 13A-C depict schematic diagrams of non-limiting embodiments of the disclosure.
  • Fig. 13A depicts phenylalanine degradation components integrated into the E. coli Nissle chromosome.
  • engineered plasmid-free bacterial strains are used to prevent plasmid conjugation in vivo.
  • PAL gene multiple insertions of the PAL gene result in increased copy number and/or increased phenylalanine degradation activity.
  • a copy of the endogenous E. coli high affinity phenylalanine transporter, pheP is driven by the PfnrS promoter and is inserted into the lacZ locus.
  • Fig. 13B depicts a schematic diagram of one non-limiting embodiment of the disclosure, wherein the E.
  • coli Nissle chromosome is engineered to contain four copies of PfnrS-PAL inserted at four different insertion sites across the genome (malE/K, yicS/nepI, agal/rsml, and cea), and one copy of a phenylalanine transporter gene inserted at a different insertion site (lacZ).
  • the PAL gene is PAL3 derived from P. luminescens
  • the phenylalanine transporter gene is pheP derived from E. coli.
  • the strain is SYN-PKU511.
  • Fig. 13C depicts a schematic diagram of one embodiment of the disclosure, wherein the E.
  • coli Nissle chromosome is engineered to contain five copies of PAL under the control of an oxygen level-dependent promoter (e.g., PfnrS- PAL3) inserted at different integration sites on the chromosome (malE/K, yicS/nepI, malP/T, agal/rsml, and cea), and one copy of a phenylalanine transporter gene under the control of an oxygen level-dependent promoter (e.g., PfnrS-pheP) inserted at a different integration site on the chromosome (lacZ).
  • the genome is further engineered to include a thyA auxotrophy, in which the thyA gene is deleted and/or replaced with an unrelated gene, as well as a kanamycin resistance gene.
  • Fig. 14 depicts the gene organization of a non-limiting exemplary construct comprising a gene encoding araC and a gene encoding LAAD from Proteus mirabilis and an arabinose inducible promoter (ParaBAD) sequence for chromosomal insertion into the endogenous arabinose operon for chromosomal integration, e.g., as comprised in SYN-PKU705.
  • aBAD arabinose inducible promoter
  • Fig. 15A depicts phenylalanine concentrations in samples comprising bacteria expressing PALI or on low-copy (LC; SYN-PKU101) or high-copy (HC; SYN-PKU102) plasmids or PAL3 on low-copy (LC; SYN-PKU201) or high-copy (HC; SYN-PKU202) plasmids, induced with anhydrous tetracycline (ATC), and then grown in culture medium supplemented with 4 mM (660,000 ng/mL) of phenylalanine.
  • ATC anhydrous tetracycline
  • PAL3 gene is derived from Photorhabdus luminescens, an enterobacterium in the same taxonomic subdivision as Escherichia coli.
  • Fig. 16A depicts phenylalanine concentrations in samples comprising bacteria expressing PALI or PAL3 on low-copy (LC) or high-copy (HC) plasmids, or further comprising a copy of pheP driven by the Tet promoter integrated into the chromosome.
  • Bacteria were induced with ATC, and then grown in culture medium supplemented with 4 mM (660,000 ng/mL) of phenylalanine to an OD 6 oo of 2.0.
  • Fig. 16B depicts cinnamate levels in samples at 2 hrs and 4 hrs post-induction.
  • cinnamate may be used as an alternative biomarker for strain activity.
  • Strains analyzed in this data set are SYN-PKU101, SYN-PKU102, SYN-PKU202, SYN- PKU201, SYN-PKU401, SYN-PKU402, SYN-PKU203, SYN-PKU302, SYN- PKU303.
  • FIGs. 17A and 17B depict the state of one non-limiting embodiment of the PAL construct under non-inducing (Fig. 17A) and inducing (Fig. 17B) conditions.
  • Fig. 17A depicts relatively low PAL and PheP production under aerobic conditions due to oxygen (0 2 ) preventing FNR from dimerizing and activating PAL and/or pheP gene expression.
  • Fig. 17B depicts up-regulated PAL and PheP production under anaerobic conditions due to FNR dimerizing and inducing FNR promoter-mediated expression of PAL and pheP (squiggle above "PAL" and "pheP").
  • Arrows adjacent to a single rectangle, or a cluster of rectangles depict the promoter responsible for driving transcription (in the direction of the arrow) of such gene(s). Arrows above each rectangle depict the expression product of each gene.
  • Fig. 18 depicts ⁇ -galactosidase levels in samples comprising bacteria harboring a low-copy plasmid expressing lacZ from an FNR-responsive promoter selected from the exemplary FNR promoters shown Table 3 (Pfnrl-5).
  • FNR-responsive promoters selected from the exemplary FNR promoters shown Table 3 (Pfnrl-5).
  • Different FNR- responsive promoters were used to create a library of anaerobic/low oxygen conditions inducible reporters with a variety of expression levels and dynamic ranges. These promoters included strong ribosome binding sites.
  • Bacterial cultures were grown in either aerobic (+0 2 ) or anaerobic conditions (-0 2 ). Samples were removed at 4 hrs and the promoter activity based on ⁇ -galactosidase levels was analyzed by performing standard ⁇ -galactosidase colorimetric assays.
  • Fig. 19A depicts a schematic representation of the lacZ gene under the control of an exemplary FNR promoter (Pfnrs)- LacZ encodes the ⁇ -galactosidase enzyme and is a common reporter gene in bacteria.
  • Fig. 19B depicts FNR promoter activity as a function of ⁇ -galactosidase activity in SYN-PKU904.
  • SYN-PKU904 an engineered bacterial strain harboring a low-copy fiirS-lacZ fusion gene, was grown in the presence or absence of oxygen. Values for standard ⁇ -galactosidase colorimetric assays are expressed in Miller units (Miller, 1972).
  • Fig. 19C depicts the growth of bacterial cell cultures expressing lacZ over time, both in the presence and absence of oxygen.
  • Figs. 20A and 20B depict phenylalanine levels produced under aerobic (Fig. 20A) or anaerobic and/or low oxygen conditions (Fig. 20B) in samples of wild- type Nissle, samples of bacteria comprising a low-copy plasmid expressing PAL3 from the Tet promoter or exemplary F R promoters, or further comprising a copy of pheP driven by the Tet promoter and integrated into the chromosome. Samples were incubated in culture medium supplemented with ATC and 4 mM (660,000 ng/mL) of phenylalanine. Samples were removed at 0 hrs, 2 hrs, 4 hrs, and 24 hrs.
  • Phenylalanine concentration was determined by mass spectrometry.
  • Fig. 21 depicts phenylalanine concentrations in cultures of synthetic probiotic strains, with and without an additional copy of pheP inserted on the chromosome. After 1.5 hrs of growth, cultures were placed in Coy anaerobic chamber supplying 90% N 2 , 5% C0 2 , and 5% H 2 . After 4 hrs of induction, bacteria were resuspended in assay buffer containing 4 mM phenylalanine. Aliquots were removed from cell assays every 30 min for 3 hrs for phenylalanine quantification by mass spectrometry.
  • Phenylalanine degradation rates in strains comprising an additional copy of pheP were higher than strains lacking an additional copy of pheP (SYN-PKU308 and SYN-PKU307; right).
  • Fig 22 depicts trans-cinnamate concentrations (PAL activity) for strains comprising single PAL3 insertions at various locations on the chromosome.
  • Fig. 23 depicts trans-cinnamate concentrations (PAL activity) for strains comprising multiple PAL3 insertions at various locations on the chromosome.
  • Fig. 24 depicts phenylalanine concentrations in cultures of synthetic probiotic strain SYN-PKU511 over time. After 2.5 hrs of growth, cultures were placed in Coy anaerobic chamber supplying 90% N2, 5% C02, and 5% H2. After 3.5 hrs of induction in phenylalanine containing medium, whole cell extracts were prepared every 30 min for 3 hrs and phenylalanine was quantified by mass spectrometry.
  • SYN-PKU511 comprises 5 integrated copies of an anaerobically (FNR) controlled gene encoding phenylalanine ammonia lyase (PAL) at 5 chromosomal locations and an anaerobically controlled gene encoding a high affinity Phe transporter (pheP) integrated in the lacZ locus.
  • FNR anaerobically
  • PAL phenylalanine ammonia lyase
  • pheP high affinity Phe transporter
  • Figs. 25A and 25B depict phenylalanine concentrations in cultures of a synthetic probiotic strain, SYN-PKU401, which comprises a high copy pUC57-plasmid with LAAD driven by a Tet inducible promoter, cells were grown in flasks shaking at 37 C, and induced with TCA at early log phase for a duration of 2 hours. Cells were spun down and re-suspended in assay buffer containing phenylalanine. Cells were measured at various cell concentrations and at varying oxygen levels.
  • SYN-PKU401 which comprises a high copy pUC57-plasmid with LAAD driven by a Tet inducible promoter
  • Fig. 25A depicts phenylalanine concentrations under aerobic conditions using two cell densities.
  • a and B are duplicates under the same experimental conditions.
  • the activity in aerobic conditions is
  • Fig. 25B depicts phenylalanine concentrations of aerobically, microaerobically, or anaerobically grown cells.
  • Fig. 26A shows phenylalanine concentrations before and after feeding in an in vivo mouse model of PKU.
  • homozygous BTBR- Pah enu2 mice were given water supplemented with 100 micrograms/mL ATC and 5% sucrose. Mice were fasted by removing chow overnight (10 hrs), and blood samples were collected by mandibular bleeding the next morning in order to determine baseline phenylalanine levels. Mice were given chow again, gavaged with 100 microliters (5xl0 9 CFU) of bacteria (SYN-PKU302 or control Nissle) after 1 hr., and allowed to feed for another 2 hrs. Serum phenylalanine concentrations were determined 2 hrs post- gavage.
  • Fig. 26B shows the percent (%) change in blood phenylalanine concentrations before and after feeding as a male or female group average (p ⁇ 0.01).
  • SYN-PKU303 is capable of intercepting enterorecirculating phenylalanine.
  • SYN-PKU304 low copy plasmid containing fnrS-PAL
  • SYN-PKU303 high copy plasmid containing Tet-PAL
  • Figs. 29A-D depict blood phenylalanine concentrations relative to baseline following subcutaneous phenylalanine challenge in an in vivo mouse model of PKU. Mice were orally gavaged with H20, SYN-PKU901, SYN-PKU303, or SYN- PKU304 at 30 and 90 minutes post-phenylalanine injection (0.1 mg/gram of average group body weight).
  • Figs. 29A and 29B show blood phenylalanine concentrations at 2 hrs and 4 hrs post-phenylalanine injection, respectively.
  • Figs. 30A and 30B depict blood phenylalanine concentrations relative to baseline following subcutaneous phenylalanine challenge in an in vivo mouse model of PKU.
  • Figs. 30A and 30B depict blood phenylalanine concentrations relative to baseline following subcutaneous phenylalanine challenge in an in vivo mouse model of PKU.
  • 30A and 30B show a dose-dependent decrease in blood phenylalanine levels in SYN-PKU304-treated mice compared to mice administered mock treatment (H20) or the parental strain (SYN-PKU901) (* 30% decrease; p ⁇ 0.05).
  • This experiment represents one of eight studies of this same design, and each one shows that SYN-PKU304 is capable of intercepting enterorecirculating phenylalanine.
  • Figs. 31 A and 31B depicts a schematic of PKU specific and PAL specific phenylalanine metabolites.
  • Fig. 31A depicts a schematic of the conversion of phenylalanine to phenylpyruvic acid and phenyllactic acid in the absence of functional PAH.
  • Fig. 31B depicts a schematic of the conversion of phenylalanine to trans-cinnamic acid by PAL3, which is further metabolized to hippuric acid by liver enzymes. These metabolites can be detected by mass spectrometry as described in Examples 24-26 or by other means.
  • Figs. 32A, 32B, 32C, 32D, 32E, and 32F depict blood phenylalanine concentrations relative to baseline and concentrations of phenylalanine (Fig. 32A), and absolute values of phenylalanine and PKU specific and PAL specific metabolites (Figs. 32B, 32C, 32D, 32E, and 32F) following subcutaneous phenylalanine challenge in an in vivo mouse model of PKU.
  • Fig. 32A depicts blood phenylalanine concentrations relative to baseline; total metabolic activity for SYN- PKU304 was calculated as 81.2umol/hr. and the total reduction in Aphe was 45% relative to SYN-PKU901 (P ⁇ 0.05).
  • Fig. 32B depicts the blood phenylalanine concentration at 0 and 4 hours post phenylalanine injection.
  • FIG. 32C depicts the blood phenylpyruvate concentration at 0 and 4 hours post phenylalanine injection.
  • Fig. 32D depicts the blood phenyllactate concentration at 0 and 4 hours post phenylalanine injection.
  • Fig. 32E depicts the blood t-cinnamic acid concentration at 0 and 4 hours post phenylalanine injection.
  • Fig. 32F depicts the blood hippuric acid concentration at 0 and 4 hours post phenylalanine injection.
  • Figs. 33A, 33B, 33C, 33D, 33E, and 33F depict blood phenylalanine concentrations relative to baseline and concentrations of phenylalanine (Fig. 33A), and absolute values of phenylalanine and PKU specific and PAL specific metabolites (Figs. 33B, 33C, 33D, 33E, and 33F) following subcutaneous phenylalanine challenge in an in vivo mouse model of PKU. Mice were orally gavaged with a total of 800 ⁇ .
  • FIG. 33A depicts blood
  • Fig. 33B depicts the blood phenylalanine concentration at 0 and 4 hours post phenylalanine injection.
  • Fig. 33C depicts the blood phenylpyruvate concentration at 0 and 4 hours post phenylalanine injection.
  • Fig. 33D depicts the blood phenyllactate concentration at 0 and 4 hours post phenylalanine injection.
  • Fig. 33E depicts the blood t-cinnamic acid concentration at 0 and 4 hours post phenylalanine injection.
  • Fig. 33F depicts the blood hippuric acid concentration at 0 and 4 hours post phenylalanine injection.
  • Fig. 34A depicts blood phenylalanine concentrations relative to baseline and concentrations of phenylalanine (Fig. 34A), and absolute values of phenylalanine and PKU specific and PAL specific
  • Fig. 34B depicts the blood phenylalanine concentration at 0 and 4 hours post phenylalanine injection.
  • Fig. 34C depicts the blood phenylpyruvate concentration at 0 and 4 hours post phenylalanine injection.
  • Fig. 34D depicts the blood phenyllactate concentration at 0 and 4 hours post phenylalanine injection.
  • Fig. 34E depicts the blood t-cinnamic acid concentration at 0 and 4 hours post phenylalanine injection.
  • Fig. 34F depicts the blood hippuric acid concentration at 0 and 4 hours post phenylalanine injection.
  • Fig. 35 depicts phenylalanine and 2 toxic analogs, p-fluoro-DL- phenylalanine, and o-fluoro-DL-phenyl alanine, which are useful for an untargeted approach to select PAL enzymes with increased activity.
  • P-fluoro-DL-phenylalanine, and o-fluoro-DL-phenylalanine are incorporated into cellular protein in the place of phenylalanine, resulting in cell death. Since these compounds are readily taken up by PheP, and can act as a substrate for PAL as shown below, they can be employed in genetic selection and screening for the identification of strains with improved Phe consumption activity. Mutations allowing more efficient PAL metabolism may prevent the incorporation of the phenylalanine analog into cellular protein, therefore allowing growth under higher concentrations of the analog.
  • Fig. 36 depicts a bar graph showing the rate of transcinnamic acid produced using phenylalanine or various phenylalanine-containing peptides as substrate. The results indicate that PKU strains were capable of degrading Phe rapidly even in the form of di- and tri-peptides and that the genetically engineered bacteria could be administered with food, as dietary protein will be broken down into di- and tri-peptides and would be available as a bacterial substrate.
  • Fig. 37 depicts a bar graph showing the effect of pheP, various copy numbers of PAL, and the further addition of LAAD on the rate of phenylalanine degradation in vitro. Results demonstrate that increasing the copy number of PAL increases the rate of phenylalanine degradation. Addition of the high affinity transporter pheP abrogates the transport limitation, allowing greater PAL activity. The transporter copy number does not increase rate (PAL, and not transport (pheP), is limiting). In the presence of oxygen, LAAD can degrade Phe at an extremely high rate.
  • Fig. 38A, Fig. 38B, and Fig. 38C depict bar graphs showing
  • Fig. 38A and Fig. 38B show distribution of mouse blood Phe levels, both overall Phe levels (Fig. 38A) and change in Phe levels from TO (Fig. 38B). As seen in Fig. 38C, Phe levels are stably elevated over at least a 6 hour period.
  • Fig. 39 depicts a graph showing the total labeled phenylalanine concentrations upon subcutaneous 13C-Phe challenge measured to determine extent of recirculation in the PKU (enu2) mouse model. All mice were kept on Phe-free chow with low Phe water until injection at TO with O. lmg/kg 13C6-Phe. Blood and intestinal effluents were taken at 0, 20 min, and 2 hours and phenylalanine concentrations were determined by LC-MS. Enterorecirculation of labeled 13C-Phe was confirmed to occur. Additionally, the concentration of unlabeled Phe was also determined, and a high level of pre-existing (unlabeled) phenylalanine was detected in the small intestine (data not shown).
  • Fig. 40A, Fig. 40B, and Fig. 40C depict graphs showing amino acid content in various compartments in in wild type and enu2-/- mice.
  • Fig. 40A depicts graphs showing measurements of amino acid content in the blood.
  • Fig. 40B depicts graphs showing measurements of amino acid content in the small intestine.
  • Fig. 40C depicts graphs showing measurements of amino acid content in the large intestine. Phe levels were high in enu2-/- blood, as expected. No other major differences were observed between WT and enu2-/- mice.
  • Fig. 41A and Fig. 41B depict graphs showing the absolute value
  • phenylalanine concentrations (Fig. 41A) and the change in phenylalanine relative to baseline (Fig. 41B) upon gavage with a strain comprising low copy PfnrS-PAL, chromosomal PfnrS-pheP (SYN-PKU305) in a fast dietary model of PKU.
  • Enu2 mice kept on regular chow until time of dosing. Chow is taken away at TO. Mice dosed every hour for 3 hrs (4 doses total; 0,1,2, 3hr) and bled on the 4th hour to determine serum Phe concentration.
  • Probiotic (SYN-PKU305)-treated mice show more rapid decrease in serum Phe.
  • Fig. 42A and Fig. 42B depict graphs showing the effect of
  • SYN-PKU305 (comprising Low Copy pSC101-PfnrS-PAL3, and a chromosomal lacZ: :PfnrS-pheP) with gelatin as a carrier in drinking water (5e9cells/ml) post Phe challenge.
  • Enu2 mice were kept on regular chow throughout the experiment.
  • Fig. 43A and Fig. 43B depict a table (Fig.43A) and a line graph (Fig. 43B) showing that in vitro and in vitro activity correlate, but then hit a maximum of in vivo activity at approximately 50% decrease in deltaPhe.
  • Fig. 44A, Fig. 44B, Fig. 44C, and Fig. 44D depict bar graphs of transcinnamic acid (TCA) and hippuric acid concentrations in blood (Fig. 44A and Fig. 44B) and in urine (Fig. 44C and Fig. 44D) following subcutaneous phenylalanine challenge in an in vivo mouse model of PKU.
  • TCA transcinnamic acid
  • Fig. 44A and Fig. 44B depict bar graphs of transcinnamic acid (TCA) and hippuric acid concentrations in blood (Fig. 44A and Fig. 44B) and in urine (Fig. 44C and Fig. 44D) following subcutaneous phenylalanine challenge in an in vivo mouse model of PKU.
  • Fig. 44A depicts serum TCA concentrations at 0 and 4 hours post phenylalanine injection.
  • Fig. 44B depicts the serum hippuric acid concentration at 0 and 4 hours post phenylalanine injection.
  • Fig. 44C depicts the urine TCA concentration at 4 hours post phenylalanine injection.
  • Fig. 32D depicts the urine hippuric acid concentration at 4 hours post phenylalanine injection.
  • Low levels of TCA were present in both urine and serum. Lower levels of hippuric acid were detected in serum. Highest levels were detected for hippuric acid in urine, indicating that the majority of TCA generated by the bacteria is converted to hippuric acid in the liver and is excreted in the urine. Similar levels of metabolites measured in urine when administering other efficacious PKU strains.
  • Fig. 45A and Fig. 45B depict the amount of TCA (Fig. 45A) and hippuric acid (Fig. 45B) recovered upon oral gavage of 0.0125, 0.025, 0.05, or 0.1 mg/g TCA at 4 hours after gavage.
  • PKU mice were orally gavaged with gavaged with 0.0125, 0.025, 0.05, or 0.1 mg/g TCA (3 mice per cage, 2 cages per group).
  • Urine, feces, and blood were collected at 4 hours post gavage and analyzed for TCA and its major breakdown product, hippuric acid. Insignificant amounts of TCA and hippurate were detected detected in blood and feces (data not shown). A nearly full recovery of TCA in the form of hippurate was observed.
  • Fig. 46 depicts a graph showing the kinetics of conversion of TCA to hippuric acid over a time course of 6 hours in PKU mice (enu2-/-) post Phe challenge. Animals were transferred to metabolic cages (3 mice per cage, 2 cages per group) and urine samples were collected at 1, 2, 3, 4, 5, 6 hours post TCA dose. TCA is converted to hippurate and excreted in the urine by 4 hours.
  • FIG. 47A, Fig. 47B, Fig. 47C, Fig. 47D, Fig. 47E, and Fig. 47F depict schematic diagrams of non-limiting embodiments of genetically engineered bacterial chromosomes of the disclosure.
  • Fig. 47A depicts a schematic diagram of the gene organization of an exemplary bacterial chromosome comprising phenylalanine degradation components integrated into the E. coli Nissle chromosome.
  • SYN-PKU707 comprises three chromosomal insertions of PAL3 (3X fnrS-PAL (malP/T, yicS/nepI, malE/K)) and two copies of pheP (2XfnrS-pheP (lacZ, agal/rsml)). SYN-PKU707 further comprises one copy of the mutated F R transcription factor F RS24Y
  • Fig. 47B depicts a schematic diagram of the gene organization of an exemplary bacterial chromosome, e.g., as seen in strain SYN-PKU708.
  • the bacterial chromosome comprises three chromosomal insertions of PAL3 (3X fnrS-PAL (malP/T, yicS/nepI, malE/K)) and two copies of pheP (2XfnrS-pheP (lacZ, agal/rsml)).
  • the bacterial chromosome further comprises one copy of the mutated FNR transcription factor FNRS24Y (Para: :FNRS24Y) and one copy of LAAD inserted at the same insertion site (the arabinose operon), which is transcribed as a bicistronic message from the endogenous arabinose promoter.
  • the bacterial chromosome further comprises a dapA auxotrophy (deltaDapA).
  • Fig. 47C depicts a schematic diagram of the gene organization of an exemplary bacterial chromosome, e.g., as seen in SYN-PKU709.
  • the bacterial chromosome comprises three insertions of PAL3 (3X fnrS-PAL (malP/T, yicS/nepI, malE/K)) and two copies of pheP (2XfnrS-pheP (lacZ, agal/rsml)).
  • the bacterial chromosome further comprises one copy of the LAAD inserted into the arabinose operon with expression driven by the native Para promoter (Para: :LAAD).
  • the genome is further engineered to include a dapA auxotrophy, in which the dapA gene is deleted.
  • Fig. 47D depicts a schematic diagram of the gene organization of an exemplary bacterial chromosome, e.g., as seen in SYN-PKU710.
  • the bacterial chromosome comprises three insertions of PAL3 (3X fnrS-PAL (malP/T, yicS/nepI, malE/K)) and two copies of pheP (2XfnrS-pheP (lacZ, agal/rsml)).
  • the bacterial chromosome further comprises one copy of the LAAD inserted into the arabinose operon with expression driven by the native Para promoter (Para: :LAAD).
  • the bacterial chromosome further comprises two copies of IPTG inducible PAL3 (2XLacIPAL, exo/cea and rhtC/rhtB), a dapA auxotrophy and is cured of all antibiotic resistances.
  • Fig. 47E depicts a schematic diagram of the gene organization of an exemplary bacterial chromosome, e.g., as seen in SYN-PKU712.
  • SYN-PKU712 essentially corresponds to SYN-PKU707 with a dapA auxotrophy.
  • the bacterial chromosome comprises three copies of fnrSPAL3, two copies of fnrSpheP integrated into the chromosome and with knocked in Para-F RS24Y and deltadapA (DAP auxotrophy).
  • SYN-PKU712 essentially corresponds to SYN-PKU707 with a dap A auxotrophy.
  • 47F depicts a schematic diagram of the gene organization of an exemplary bacterial chromosome, e.g., as seen in SYN-PKU711.
  • SYN-PKU711 essentially corresponds to SYN-PKU708 without a dapA auxotrophy.
  • the bacterial chromosome comprises 3 copies of -fnrSPAL3, two copies of fnrSpheP integrated into the chromosome and knocked in Para- F RS24Y-LAAD.
  • Fig. 48A and Fig. 48B depict the gene organization of exemplary constructs.
  • Fig. 48A depicts a construct comprising F RS24Y driven by the arabinose inducible promoter and araC in reverse direction.
  • SYN-PKU707 and SYN-PKU712 are examples of strains which include such a construct (integrated at the arabinose operon).
  • Exemplary sequences include SEQ ID NO: 64.
  • Fig. 48B depicts a construct in which FNRS24Y and LAAD are expressed as a bicistronic message from an arabinose inducible promoter.
  • AraC is transcribed in the reverse orientation.
  • SYN-PKU708 is an example of a strain which includes such a construct (integrated at the arabinose operon).
  • Exemplary sequences include SEQ ID NO: 73.
  • FNRS24Y expression (from a construct shown in Fig. 48A or Fig. 48B) is induced as part of an oxygen bypass switch as shown in Fig. 50.
  • the constructs of Fig. 48A and/or Fig. 48B are used in combination with low oxygen-inducible PAL3, pheP, and/or LAAD constructs.
  • the constructs are located on a plasmid, e.g., a low copy or a high copy plasmid.
  • the constructs are located on a plasmid component of a biosafety system. In some embodiments, the constructs are integrated into the bacterial chromosome at one or more locations. In a non-limiting example, the constructs of Fig. 48A or Fig. 48B are knocked into the E coli arabinose operon and are driven by the endogenous arabinose promoter.
  • Fig. 49 depicts the gene organization of an exemplary construct comprising Lacl in reverse orientation, and a IPTG inducible promoter driving the expression of PAL3.
  • SYN-PKU710 is non-limiting example of a strain comprising such a construct.
  • /acPAL is inserted at the exo/cea locus.
  • Exemplary sequence includes SEQ ID NO: 74.
  • this construct is useful for pre-induction and pre-loading of a therapeutic strain prior to in vivo administration under aerobic conditions and in the presence of inducer, e.g., IPTG. In some embodiments, this construct is used alone.
  • the construct is used in combination with other constitutive or inducible PAL3 constructs, e.g., low oxygen, arabinose or IPTG inducible constructs.
  • the construct is used in combination with a low-oxygen inducible construct which is active in an in vivo setting.
  • the construct is located on a plasmid, e.g., a low copy or a high copy plasmid. In some embodiments, the construct is located on a plasmid component of a biosafety system. In some embodiments, the construct is integrated into the bacterial chromosome at one or more locations. In some
  • the construct is used in combination with a PheP construct, which can either be provided on a plasmid or is integrated into the bacterial chromosome at one or more locations.
  • PheP expression may be constitutive or driven by an inducible promoter, e.g., low-oxygen, arabinose, or IPTG.
  • the construct is used in combination with a LAAD expression construct.
  • the construct s PAL3 sequences which are the original sequence from Photorhabdus chemiluminescens.
  • the PAL3 sequences are codon optimized for expression in E coli.
  • the construct is located on a plasmid, e.g., a low or high copy plasmid.
  • the construct is employed in a biosafety system, such as the system shown in Fig. 61A, Fig. 61B, Fig. 61C, and Fig. 61D.
  • the construct is integrated into the genome at one or more locations described herein.
  • Fig. 50 depicts a "Oxygen bypass switch" useful for aerobic pre- induction of a strain comprising one or more PME(s) and/or Phe transporters under the control of a low oxygen F R promoter in vitro in a culture vessel (e.g., flask, fermenter or other vessel, e.g., used during with cell growth, cell expansion, fermentation, recovery, purification, formulation, and/or manufacture).
  • a culture vessel e.g., flask, fermenter or other vessel, e.g., used during with cell growth, cell expansion, fermentation, recovery, purification, formulation, and/or manufacture.
  • active PME e.g., PAL3 and/or LAAD prior to administration.
  • strains are induced under anaerobic and/or low oxygen conditions, e.g. to induce FNR promoter activity and drive expression of one or more PME(s) and /or Phe transporters.
  • F RS24Y is a mutated form of FNR which is more resistant to inactivation by oxygen, and therefore can activate FNR promoters under aerobic conditions (see e.g., Jervis AJ,
  • the 02 sensitivity of the transcription factor FNR is controlled by Ser24 modulating the kinetics of [4Fe-4S] to [2Fe-2S] conversion, Proc Natl Acad Sci U S A. 2009 Mar 24; 106(12):4659-64, the contents of which is herein incorporated by reference in its entirety).
  • the 02 sensitivity of the transcription factor FNR is controlled by Ser24 modulating the kinetics of [4Fe-4S] to [2Fe-2S] conversion, Proc Natl Acad Sci U S A. 2009 Mar 24; 106(12):4659-64, the contents of which is herein incorporated by reference in its entirety).
  • This oxygen bypass system
  • FNRS24Y is induced by addition of arabinose and then drives the expression PAL3, pheP by binding and activating the FNR promoter under aerobic conditions.
  • strains can be grown, produced or manufactured efficiently under aerobic conditions, while being effectively pre-induced and pre-loaded, as the system takes advantage of the strong FNR promoter resulting in of high levels of expression of PAL and PheP.
  • This system does not interfere with or compromise in vivo activation, since the mutated FNRS24Y is no longer expressed in the absence of arabinose, and wild type FNR then binds to the FNR promoter and drives expression of PAL3 and PheP in vivo.
  • LAAD expression can also be induced aerobically, e.g., by arabinose.
  • LAAD and FNRS24Y can in some embodiments be induced simultaneously.
  • FNRS24Y and LAAD are transcribed as a bicistronic message whose expression is driven by an arabinose promoter.
  • FNRS24Y is knocked into the arabinose operon, allowing expression to be driven from the endogenous Para promoter.
  • FNRS24Y-LAAD is knocked into the arabinose operon, allowing expression to be driven from the endogenous Para promoter.
  • a Lacl promoter and IPTG induction are used in this system (in lieu of Para and arabinose induction).
  • a rhamnose inducible promoter is used in this system.
  • a temperature sensitive promoter is used to drive expression of FNRS24Y.
  • Fig. 51 depicts a bar graph showing in vitro PAL activity of SYN- PKU707 (3XP /nr s-PAL3; 2XP fnrS pheP P ara - r S24Y ) as measured by the rate of transcinnamic acid (TCA) produced.
  • Cells were induced aerobically or anaerobically in the presence or absence of arabinose. Cultures were grown in 10 ml, 20 ml, or 30 ml flasks. Arabinose-induced expression of fnrS24Y results in high level activity under aerobic conditions in 10 ml, 20 ml, or 30 ml flasks.
  • Fig. 53 depicts the urine hippurate concentration at 4 hours post phenylalanine injection. These results indicate that approximately 15-20%) of injected phenylalanine is converted to hippurate. Phenylalanine is converted to TCA in the small intestine, which is then converted into hippurate in the liver.
  • Fig. 54A and Fig. 54B depict graphs showing recovery of absolute amounts non-labeled (Fig. 54A) and labeled (Fig. 54B) hippurate in the urine post SC injection with radio-labeled phenylalanine in mice gavaged 3 times with SYN-PKU707.
  • Fig. 55 depicts a graph showing hippuric acid recovered in urine following single dose PKU strain SYN-PKU707 at TO, 2, 4, 6, and 8 hours post Phe challenge. Different cell numbers were gavaged (in a single gavage) to mice as indicated. A dose-dependent increase in hippurate recovered in the urine of mice was observed.
  • Fig. 56 depicts a graph showing hippurate recovery in urine, and comparing kinetics of the generation of hippuric acid from phenylalanine through the gavage of live cells to the generation of hippuric acid derived from pure TCA gavage.
  • pure TCA a rapid decrease in hippurate recovery is observed in the urine within the first 15 minutes post collection start.
  • hippurate recovery is sustained for at least the first 30 min after collection starts and has a decreasing downward slope.
  • Fig. 57A and Fig. 57B depict bar graphs showing the change in phenylalanine over baseline in blood (Fig. 57A) and the absolute levels of hippuric acid in urine (Fig. 57B) at 4 hours post phenylalanine challenge in PKU mice gavaged with SYN-PKU708 at the indicated doses.
  • SYN-PKU708 was efficacious in reducing blood phenylalanine and hippurate was excreted in a dose dependent manner in the cages of mice treated with SYN-PKU708, indicating that the cells were active in vivo.
  • Fig. 59A and Fig. 59B depict blood phenylalanine concentrations relative to baseline at 4 hours post SC phenylalanine injection (Fig. 59A) and absolute values of hippuric acid up to 4 hours post SC phenylalanine injection (Fig. 59B), comparing strains SYN-PKU710 and SYN-PKU708.
  • Mice were administered single dose of phenylalanine by subcutaneous injection at 0.1 mg per gram body weight.
  • the bacteria or water
  • mice were administered to mice by oral gavage (300 ul/dose, total of 3Xel0 cfu/mouse).
  • the percentage decrease in deltaPhe SYN-PKU710 and SYN-PKU708 were calculated to be 29% and 40%, respectively.
  • Fig. 60 depicts a bar graph showing in vitro PAL activity in strains in which PAL expression is under the control of various inducible promoters (arabinose, IPTG(LacI), rhamnose, Tet, temperature (CI857) as measured by the rate of TCA accumulation. SYN-PKU707 is shown as a benchmark control.
  • Figs. 61A-61D depict schematics of non-limiting examples of the gene organization of plasmids, which function as a component of a biosafety system (Fig. 61A and Fig. 61B), which also contains a chromosomal component (shown in Fig. 61C and Fig. 61D).
  • the Biosafety Plasmid System Vector comprises Kid Toxin and R6K minimal ori, dapA (Fig. 61A) and thyA (Fig. 61B) and promoter elements driving expression of these components.
  • the plasmid comprises SEQ ID NO: 81.
  • the plasmid comprises SEQ ID NO: 82.
  • bla is knocked out and replaced with one or more constructs described herein, in which PAL3 and/or PheP and/or LAAD are expressed from an inducible or constitutive promoter.
  • Fig. 61C and Fig. 61D depict schematics of the gene
  • Fig. 61C depicts a construct comprising low copy Rep (Pi) and Kis antitoxin, in which transcription of Pi (Rep), which is required for the replication of the plasmid component of the system, is driven by a low copy RBS containing promoter.
  • the construct comprises SEQ ID NO: 89.
  • Fig. 61D depicts a construct comprising a medium-copy Rep (Pi) and Kis antitoxin, in which transcription of Pi (Rep), which is required for the replication of the plasmid component of the system, is driven by a medium copy RBS containing promoter.
  • the construct comprises SEQ ID NO: 90.
  • the chromosomal constructs shown in Fig. 61C and Fig. 61D are knocked into the DapA locus. If the plasmid containing the functional ThyA is used (as shown in Fig. 61B), then the chromosomal constructs shown in Fig. 61C and Fig. 61D are knocked into the ThyA locus.
  • the bacteria comprising the chromosomal construct and a knocked out dapA or thyA gene can grow in the absence of dap or thymidine only in the presence of the plasmid.
  • Figs. 62A-C depict schematics of non-limiting examples of PAL constructs.
  • Fig 62A depicts a schematic of a non-;imiting example of the organization of a construct for PAL expression under the control a lambda CI inducible promoter.
  • the construct also provides the coding sequence of a mutant of CI, CI857, which is a temperature sensitive mutant of CI.
  • the temperature sensitive CI repressor mutant, CI857 binds tightly at 30 degrees C but is unable to bind (repress) at temperatures of 37 C and above.
  • the construct comprises SEQ ID NO: 101. In some embodiments, this construct is used alone.
  • the temperature sensitive construct is used in combination with other constitutive or inducible PAL3 constructs, e.g., low oxygen, arabinose, rhamnose, or IPTG inducible constructs.
  • the construct allows pre-induction and pre-loading of PAL3 and/or PheP and/or LAAD prior to in vivo administration.
  • the construct provides in vivo activity.
  • the construct is located on a plasmid, e.g., a low copy or a high copy plasmid.
  • the construct is located on a plasmid component of a biosafety system.
  • the construct is integrated into the bacterial chromosome at one or more locations.
  • the construct is used in combination with a PheP construct, which can either be provided on a plasmid or is integrated into the bacterial chromosome at one or more locations.
  • PheP expression may be constitutive or driven by an inducible promoter, e.g., low-oxygen, arabinose, rhamnose, or temperature sensitive.
  • the construct is used in combination with a LAAD expression construct.
  • a temperature sensitive system can be used to set up a conditional auxotrophy.
  • a dapA or thyA gene can be introduced into the strain under the control of a thermoregulated promoter system. The strain can grow in the absence of Thy and Dap only at the permissive temperature, e.g., 37 C (and not lower).
  • Fig. 62B depicts a schematic of a non-limiting example of the organization of a construct for PAL expression under the control of a rhamnose inducible promoter.
  • a rhamnose inducible promoter For the application of the rhamnose expression system it is not necessary to express the regulatory proteins in larger quantities, because the amounts expressed from the chromosome are sufficient to activate transcription even on multicopy plasmids. Therefore, only the rhaP BAD promoter is cloned upstream of the gene that is to be expressed. In some embodiments, this construct is used alone.
  • the rhamnose inducible construct is used in combination with other constitutive or inducible PAL3 constructs, e.g., low oxygen, arabinose, temperature sensitive, or IPTG inducible constructs.
  • the construct allows pre- induction and pre-loading of PAL3 and/or PheP and/or LAAD prior to in vivo administration.
  • the construct is useful for pre-induction and is combined with low-oxygen inducible constructs.
  • the construct is located on a plasmid, e.g., a low copy or a high copy plasmid.
  • the construct is located on a plasmid component of a biosafety system.
  • the construct is integrated into the bacterial chromosome at one or more locations.
  • the construct is used in combination with a PheP construct, which can either be provided on a plasmid or is integrated into the bacterial chromosome at one or more locations.
  • PheP expression may be constitutive or driven by an inducible promoter, e.g., low-oxygen, arabinose, rhamnose, or temperature sensitive.
  • the construct is used in combination with a LAAD expression construct.
  • Fig. 62C depicts a schematic of a non-limiting example of the organization of a construct for PAL expression under the control of an arabinose inducible promoter.
  • the arabinose inducible PAL3 construct comprises AraC (in reverse orientation), a region comprising an Arabinose inducible promoter, and PAL3. In some embodiments, this construct is used alone. In some embodiments, the rhamnose inducible construct is used in combination with other constitutive or inducible PAL3 constructs, e.g., low oxygen, arabinose, temperature sensitive, or IPTG inducible constructs.
  • the construct allows pre-induction and pre-loading of PAL3 and/or PheP and/or LAAD prior to in vivo administration.
  • the construct is useful for pre-induction and is combined with low-oxygen inducible constructs.
  • the construct is located on a plasmid, e.g., a low copy or a high copy plasmid.
  • the construct is located on a plasmid component of a biosafety system.
  • the construct is integrated into the bacterial chromosome at one or more locations.
  • the construct is used in combination with a PheP construct, which can either be provided on a plasmid or is integrated into the bacterial chromosome at one or more locations.
  • PheP expression may be constitutive or driven by an inducible promoter, e.g., low-oxygen, arabinose, rhamnose, or temperature sensitive.
  • the construct is used in combination with a LAAD expression construct.
  • Fig. 63A depicts a schematic of the gene organization of a PssB promoter.
  • the ssB gene product protects ssDNA from degradation; SSB interacts directly with numerous enzymes of DNA metabolism and is believed to have a central role in organizing the nucleoprotein complexes and processes involved in DNA replication (and replication restart), recombination and repair.
  • the PssB promoter was cloned in front of a LacZ reporter and beta-galactosidase activity was measured.
  • Fig. 63B depicts a bar graph showing the reporter gene activity for the PssB promoter under aerobic and anaerobic conditions. Briefly, cells were grown aerobically overnight then diluted 1 : 100 and split into two different tubes.
  • the Pssb promoter is active under aerobic conditions, and shuts off under anaerobic conditions.
  • This promoter can be used to express a gene of interest under aerobic conditions.
  • This promoter can also be used to tightly control the expression of a gene product such that it is only expressed under anaerobic and/or low oxygen conditions.
  • the oxygen induced PssB promoter induces the expression of a repressor, which represses the expression of a gene of interest.
  • the gene of interest is only expressed in the absence of the repressor, i.e., under anaerobic and/or low oxygen conditions.
  • This strategy has the advantage of an additional level of control for improved fine-tuning and tighter control.
  • this strategy can be used to control expression of thyA and/or dapA, e.g., to make a conditional auxotroph.
  • chromosomal copy of dapA or ThyA is knocked out.
  • dapA or thyA -as the case may be- are expressed, and the strain can grow in the absence of dap or thymidine.
  • dapA or thyA expression is shut off, and the strain cannot grow in the absence of dap or thymidine.
  • Such a strategy can, for example be employed to allow survival of bacteria under anaerobic and/or low oxygen conditions, e.g., the gut, but prevent survival under aerobic conditions (biosafety switch).
  • 64A depicts a strategy to fine-tune the expression of a Para-PAL construct by using a ribosome binding site optimization strategy.
  • Bioinformatics tools for optimization of RBS are known in the art.
  • arabinose controlled PAL and pheP can be integrated into the chromosome to provide for efficient aerobic growth and pre-induction of the strain (e.g., in flasks, fermenters or other appropriate vesicles), while integrated versions of Pfnrs-PAL and PheP are maintained to allow for strong in vivo induction.
  • Fig. 64B depicts a strategy allow the expression of a PAL and PheP under aerobic conditions through the arabinose inducible expression of F RS24Y.
  • the levels of Fnr S24Y expression can be fine-tuned, e.g., under optimal inducing conditions (adequate amounts of arabinose for full induction). Fine-tuning is accomplished by selection of an appropriate RBS with the appropriate translation initiation rate. Bioinformatics tools for optimization of RBS are known in the art.
  • Fig. 65A, Fig. 65B, Fig. 65C and Fig. 65D B depict schematics the exemplary gene organization of various expression constructs described herein. These constructs can be used alone or in combination with other PAL3 and/or PheP and/or LAAD expressing constructs.
  • Fig. 65A. depicts a schematic of a non-limiting example of the organization of an IPTG and low oxygen inducible construct comprising Lacl in reverse orientation, a region comprising a promoter, which contains a LacO site and a FNR binding site.
  • the promoter drives the expression of two open reading frames encoding PAL3 and third open reading frame encoding of PheP; this construct can be transcribed as a tricistronic message.
  • the construct comprises SEQ ID NO: 95.
  • this construct is useful for pre-induction under anaerobic and/or low oxygen conditions through the activation of the FNR promoter.
  • this construct is useful in vivo activation under anaerobic and/or low oxygen conditions, as they are found in certain areas of the gut, through the activation of the FNR promoter.
  • Fig. 65B depicts a schematic of a non-limiting example of the organization of an IPTG and low oxygen inducible construct, comprising Lacl in reverse orientation, a region comprising a promoter, which contains LacO, and a FNR binding site.
  • the construct also comprises two open reading frames encoding PAL3. This construct is transcribed as a bicistronic message.
  • the construct is combined with another construct expressing PheP from another plasmid.
  • the construct is combined with a construct expressing PheP, which is integrated into the bacterial chromosome at one or more locations.
  • the construct comprises SEQ ID NO: 97.
  • this construct is useful for pre-induction under anaerobic and/or low oxygen conditions through the activation of the FNR promoter. In some embodiments, this construct is useful in vivo activation under anaerobic and/or low oxygen conditions, as they are found in certain areas of the gut, through the activation of the FNR promoter.
  • Fig. 65C depicts a schematic of a non-limiting example of the organization of an IPTG inducible construct, comprising Lacl in reverse orientation, a region comprising a promoter, which comprises LacO.
  • the construct also comprises a region containing two open reading frames encoding PAL3 and third open reading frame encoding of PheP.
  • This construct can be transcribed as a tricistronic message.
  • the construct comprises SEQ ID NO: 96.
  • Fig. 65D depicts a schematic of a non-limiting example of the organization of an IPTG inducible construct, comprising Lacl in reverse orientation, a region comprising a LacO containing promoter.
  • the construct also contains a region containing two open reading frames encoding PAL3.
  • This construct can be transcribed as a bicistronic message.
  • the construct comprises SEQ ID NO: 98.
  • the construct is combined with another construct expressing PheP from another plasmid.
  • the construct is combined with a construct expressing PheP, which is integrated into the bacterial chromosome at one or more locations.
  • PAL3 sequences which are the original sequence from Photorhabdus chemiluminescens.
  • the PAL3 sequences are codon optimized for expression in E coli.
  • codon optimization is used as an additional control to fine tune, i.e., to up- or downregulate, PAL3 levels expressed from the construct.
  • the construct is located on a plasmid, e.g., a low or high copy plasmid.
  • the construct is employed in a biosafety system, such as the system shown in Fig. 61.
  • the construct is integrated into the genome at one or more locations described herein.
  • Fig. 66 depicts a map of exemplary integration sites within the E. coli 1917 Nissle chromosome. These sites indicate regions where circuit components may be inserted into the chromosome without interfering with essential gene expression. Backslashes (/) are used to show that the insertion will occur between divergently or convergently expressed genes. Insertions within biosynthetic genes, such as thyA, can be useful for creating nutrient auxotrophies. In some embodiments, an individual circuit component is inserted into more than one of the indicated sites.
  • Fig. 67 depicts three bacterial strains which constitutively express red fluorescent protein (RFP).
  • RFP red fluorescent protein
  • strains 1-3 the rfp gene has been inserted into different sites within the bacterial chromosome, and results in varying degrees of brightness under fluorescent light.
  • Unmodified E. coli Nissle strain 4 is non-fluorescent.
  • Fig. 68 depicts a graph of Nissle residence in vivo. Streptomycin- resistant Nissle was administered to mice via oral gavage without antibiotic pre- treatment. Fecal pellets from 6 total mice were monitored post-administration to determine the amount of administered Nissle still residing within the mouse
  • the bars represent the number of bacteria administered to the mice.
  • the line represents the number of Nissle recovered from the fecal samples each day for 10 consecutive days.
  • Figs. 70A and 70B depict phenylalanine concentrations in SYN- PKU302 cultures over time. After 1.5 hrs of growth, ATC was added to cultures of SYN-PKU302, and SYN-PKU304 cultures were placed in Coy anaerobic chamber supplying 90% N 2 , 5% C0 2 , and 5% H 2 . After 4 hrs of induction, bacteria were resuspended in assay buffer containing 4 mM phenylalanine and at different pH (pH range 7.25-2.25). Aliquots were removed from cell assays every 30 min for 2 hrs for phenylalanine quantification by mass spectrometry. Phenylalanine degradation rates decreased as pH of the assay buffer decreased in both strains, SYN-PKU302 (Fig. 70A) and SYN-PKU304 (Fig. 70B).
  • Fig. 71 depicts an exemplary schematic of the E. coli 1917 Nissle chromosome comprising multiple mechanisms of action (MoAs).
  • Fig. 72 depicts the gene organization of an exemplary construct in which the PAL3 and pheP genes are co-transcribed under the control of an exemplary F R promoter (P fm -s).
  • Figs. 73A and 73B depict the gene organization of an exemplary construct in which the Int5 recombinase gene is operably linked to an exemplary FNR promoter (Pa r s), and the PAL3 gene is operably linked to a strong constitutive promoter.
  • Fig. 73A depicts a schematic diagram of the PAL3 gene, flanked by Int5 sites, in the OFF orientation (3' to 5').
  • Int5 gene expression is activated under anaerobic and/or low oxygen conditions, recombinatorial flipping of PAL3 to the ON orientation (5' to 3'; Fig. 73B) leads to the production of PAL3 and to phenylalanine metabolism. Any strong constitutive promoter sequence may be used.
  • Figs. 74A, 74B, and 74C depict the gene organization of an exemplary construct in which the Int5 recombinase gene is operably linked to an FNR promoter (P fnr s), and the gene encoding T7 RNA polymerase is flanked by recombinase sites and operably linked to a strong constitutive promoter.
  • Fig. 74A depicts a schematic diagram of the T7 RNA polymerase gene, flanked by Int5 sites, in the OFF
  • T7 RNA polymerase gene is flipped to the ON orientation (Fig. 74B).
  • T7 RNA polymerase expression leads to the production of PAL3 and to phenylalanine metabolism.
  • Figs. 75A and 75B depict the gene organization of an exemplary construct in which the Int5 recombinase gene is operably linked to an ParaBAD promoter (ParaBAo), and the gene encoding T7 RNA polymerase is flanked by
  • ParaBAo ParaBAD promoter
  • Fig. 75A shows an exemplary construct in which the Int5 recombinase gene is operably linked to an ParaBAD promoter (ParaBAo)-
  • Fig. 75B depicts a schematic diagram of the T7 RNA polymerase gene, flanked by Int5 sites, in the OFF orientation.
  • Int5 gene expression is activated under anaerobic and/or low oxygen conditions, the T7 RNA polymerase gene is flipped to the ON orientation.
  • T7 RNA polymerase expression leads to the production of PAL3 and to phenylalanine metabolism.
  • Fig. 76A depicts a schematic of a recombinase-based switch to activate PAL3 expression using different inducible promoters and ribosome binding sites.
  • Recombinase expression causes recombinatorial flipping of the PAL3 gene to the ON orientation, leading to the production of PAL3 and to the degradation of phenylalanine.
  • recombinase-based switches are tuned to respond to specific levels of an inducer.
  • Fig. 76B depicts the relationship between the concentration of an inducer and the percentage of i J3-containing constructs in the ON orientation. The shaded area shows the predicted efficacy range of the inducer in vivo.
  • Figs. 77A-77C depict other non-limiting embodiments of the disclosure, wherein the expression of a heterologous gene is activated by an exogenous environmental signal.
  • Fig. 77A depicts an embodiment of heterologous gene expression in which, in the absence of arabinose, the AraC transcription factor adopts a conformation that represses transcription. In the presence of arabinose, the AraC transcription factor undergoes a conformational change that allows it to bind to and activate the ParaBAD promoter (ParaBAo), which induces expression of the Tet repressor (TetR) and an anti-toxin.
  • ParaBAD promoter ParaBAD promoter
  • TetR Tet repressor
  • Fig. 77A also depicts another non- limiting embodiment of the disclosure, wherein the expression of an essential gene not found in the recombinant bacteria is activated by an exogenous environmental signal.
  • the AraC transcription factor adopts a conformation that represses transcription of the essential gene under the control of the araBAD promoter and the bacterial cell cannot survive.
  • transcription factor undergoes a conformational change that allows it to bind to and activate the araBAD promoter, which induces expression of the essential gene and maintains viability of the bacterial cell.
  • Fig. 77B depicts a non-limiting embodiment of the disclosure, where an anti-toxin is expressed from a constitutive promoter, and expression of a heterologous gene is activated by an exogenous environmental signal.
  • the AraC transcription factor adopts a conformation that represses transcription.
  • the AraC transcription factor undergoes a conformational change that allows it to bind to and activate the araBAD promoter, which induces expression of TetR, thus preventing expression of a toxin.
  • TetR is not expressed, and the toxin is expressed, eventually overcoming the anti-toxin and killing the cell.
  • the constitutive promoter regulating expression of the anti-toxin should be a weaker promoter than the promoter driving expression of the toxin.
  • the araC gene is under the control of a constitutive promoter in this circuit.
  • Fig. 77C depicts another non-limiting embodiment of the disclosure, wherein the expression of a heterologous gene is activated by an exogenous
  • the AraC transcription factor adopts a conformation that represses transcription.
  • the AraC transcription factor undergoes a conformational change that allows it to bind to and activate the araBAD promoter, which induces expression of the Tet repressor (TetR) and an anti-toxin.
  • TetR Tet repressor
  • the anti-toxin builds up in the recombinant bacterial cell, while TetR prevents expression of a toxin (which is under the control of a promoter having a TetR binding site).
  • both the anti-toxin and TetR are not expressed.
  • the araC gene is either under the control of a constitutive promoter or an inducible promoter (e.g., AraC promoter) in this circuit.
  • Fig. 78 depicts one non-limiting embodiment of the disclosure, where an exogenous environmental condition or one or more environmental signals activates expression of a heterologous gene and at least one recombinase from an inducible promoter or inducible promoters.
  • the recombinase then flips a toxin gene into an activated conformation, and the natural kinetics of the recombinase create a time delay in expression of the toxin, allowing the heterologous gene to be fully expressed. Once the toxin is expressed, it kills the cell.
  • Fig. 78 depicts one non-limiting embodiment of the disclosure, where an exogenous environmental condition or one or more environmental signals activates expression of a heterologous gene and at least one recombinase from an inducible promoter or inducible promoters.
  • the recombinase flips a toxin gene into an activated conformation, and the natural kinetics of the recombinase create
  • an exogenous environmental condition or one or more environmental signals activates expression of a heterologous gene, an anti-toxin, and at least one recombinase from an inducible promoter or inducible promoters.
  • the recombinase then flips a toxin gene into an activated conformation, but the presence of the accumulated anti-toxin suppresses the activity of the toxin.
  • expression of the anti-toxin is turned off.
  • the toxin is constitutively expressed, continues to accumulate, and kills the bacterial cell.
  • Fig. 80 depicts another non-limiting embodiment of the disclosure, where an exogenous environmental condition or one or more environmental signals activates expression of a heterologous gene and at least one recombinase from an inducible promoter or inducible promoters.
  • the recombinase then flips at least one excision enzyme into an activated conformation.
  • the at least one excision enzyme then excises one or more essential genes, leading to senescence, and eventual cell death.
  • the natural kinetics of the recombinase and excision genes cause a time delay, the kinetics of which can be altered and optimized depending on the number and choice of essential genes to be excised, allowing cell death to occur within a matter of hours or days.
  • the presence of multiple nested recombinases can be used to further control the timing of cell death.
  • Fig. 81 depicts one non-limiting embodiment of the disclosure, where an exogenous environmental condition or one or more environmental signals activates expression of a heterologous gene and a first recombinase from an inducible promoter or inducible promoters.
  • the recombinase then flips a second recombinase from an inverted orientation to an active conformation.
  • the activated second recombinase flips the toxin gene into an activated conformation, and the natural kinetics of the
  • the recombinase create a time delay in expression of the toxin, allowing the heterologous gene to be fully expressed. Once the toxin is expressed, it kills the cell.
  • Fig. 82 depicts a one non-limiting embodiment of the disclosure, which comprises a plasmid stability system with a plasmid that produces both a short-lived anti-toxin and a long-lived toxin.
  • the genetically engineered bacteria produce an equal amount of a Hok toxin and a short-lived Sok antitoxin.
  • the cell produces equal amounts of toxin and anti-toxin and is stable.
  • the cell loses the plasmid and anti-toxin begins to decay.
  • the anti-toxin decays completely, and the cell dies.
  • Fig. 83 depicts the use of GeneGuards as an engineered safety component. All engineered DNA is present on a plasmid which can be conditionally destroyed. See, e.g., Wright et al., 2015.
  • Fig. 84A depicts a schematic diagram of a wild-type clbA construct.
  • Fig. 84B depicts a schematic diagram of a clbA knockout construct.
  • Fig. 85 depicts a schematic of a secretion system based on the flagellar type III secretion in which an incomplete flagellum is used to secrete a therapeutic peptide of interest (star) by recombinantly fusing the peptide to an N-terminal flagellar secretion signal of a native flagellar component so that the intracellularly expressed chimeric peptide can be mobilized across the inner and outer membranes into the surrounding host environment.
  • Fig. 86 depicts a schematic of a type V secretion system for the extracellular production of recombinant proteins in which a therapeutic peptide (star) can be fused to an N-terminal secretion signal, a linker and the beta-domain of an autotransporter.
  • the N-terminal signal sequence directs the protein to the SecA-YEG machinery which moves the protein across the inner membrane into the periplasm, followed by subsequent cleavage of the signal sequence.
  • the beta-domain is recruited to the Bam complex where the beta-domain is folded and inserted into the outer membrane as a beta-barrel structure.
  • the therapeutic peptide is then thread through the hollow pore of the beta-barrel structure ahead of the linker sequence.
  • the therapeutic peptide is freed from the linker system by an autocatalytic cleavage or by targeting of a membrane-associated peptidase (scissors) to a complementary protease cut site in the linker.
  • Fig. 87 depicts a schematic of a type I secretion system, which translocates a passenger peptide directly from the cytoplasm to the extracellular space using HlyB (an ATP-binding cassette transporter); HlyD (a membrane fusion protein); and TolC (an outer membrane protein) which form a channel through both the inner and outer membranes.
  • HlyB an ATP-binding cassette transporter
  • HlyD a membrane fusion protein
  • TolC an outer membrane protein
  • Fig. 88 depicts a schematic of the outer and inner membranes of a gram-negative bacterium, and several deletion targets for generating a leaky or destabilized outer membrane, thereby facilitating the translocation of a therapeutic polypeptides to the extracellular space, e.g., therapeutic polypeptides of eukaryotic origin containing disulphide bonds.
  • Fig. 89 depicts a modified type 3 secretion system (T3 SS) to allow the bacteria to inject secreted therapeutic proteins into the gut lumen.
  • An inducible promoter (small arrow, top), e.g. a F R-inducible promoter, drives expression of the T3 secretion system gene cassette (3 large arrows, top) that produces the apparatus that secretes tagged peptides out of the cell.
  • An inducible promoter small arrow, bottom
  • a FNR-inducible promoter drives expression of a regulatory factor, e.g. T7 polymerase, that then activates the expression of the tagged therapeutic peptide
  • Fig. 90A, Fig. 90B, and Fig. 90C depict schematics of the gene organization of exemplary circuits of the disclosure for the expression of therapeutic polypeptides, which are secreted using components of the flagellar type III secretion system.
  • a therapeutic polypeptide of interest such as, PAL and/or LAAD, is assembled behind a fliC-5'UTR, and is driven by the native fliC and/or fliD promoter (Fig. 90A and Fig. 90B) or a Tet-inducible promoter (Fig. 90C).
  • an inducible promoter such as oxygen level-dependent promoters (e.g., FNR-inducible promoter), and promoters induced by a metabolite that may or may not be naturally present (e.g., can be exogenously added) in the gut, e.g., arabinose can be used.
  • the therapeutic polypeptide of interest is either expressed from a plasmid (e.g., a medium copy plasmid) or integrated into fliC loci (thereby deleting all or a portion of fliC and/or fliD).
  • an N terminal part of FliC is included in the construct, as shown in Fig. 90B and Fig. 90C [0118] Fig.
  • Fig. 91B depict schematics of the gene organization of exemplary circuits of the disclosure for the expression of therapeutic polypeptides, which are secreted via a diffusible outer membrane (DOM) system.
  • the therapeutic polypeptide of interest is fused to a prototypical N-terminal Sec-dependent secretion signal or Tat-dependent secretion signal, which is cleaved upon secretion into the periplasmic space.
  • Exemplary secretion tags include sec-dependent PhoA, OmpF, OmpA, cvaC, and Tat-dependent tags (TorA, FdnG, DmsA).
  • the genetically engineered bacteria comprise deletions in one or more of lpp, pal, tolA, and/or nlpl.
  • periplasmic proteases are also deleted, including, but not limited to, degP and ompT, e.g., to increase stability of the polypeptide in the periplasm.
  • a FRT-KanR-FRT cassette is used for downstream integration. Expression is driven by a Tet promoter (Fig. 91A) or an inducible promoter, such as oxygen level-dependent promoters (e.g., F R-inducible promoter, Fig. 91B), and promoters induced by a metabolite that may or may not be naturally present (e.g., can be exogenously added) in the gut, e.g., arabinose.
  • Fig. 92 depicts a schematic of a design -build-test cycle. Steps are as follows: 1 : Define the disease pathway; 2. Identify target metabolites; 3. Design genetic circuits; 4. Build synthetic biotic; 5. Activate circuit in vivo; 6. Characterize circuit activation kinetics; 7. Optimize in vitro productivity to disease threshold; 8. Test optimize circuit in animal disease model; 9. Assimilate into the microbiome; 10.
  • Figs. 93 A, B, C, D, and E depict a schematic of non-limiting manufacturing processes for upstream and downstream production of the genetically engineered bacteria of the present disclosure.
  • Fig. 93A depicts the parameters for starter culture 1 (SCI): loop full - glycerol stock, duration overnight, temperature 37° C, shaking at 250 rpm.
  • Fig. 93B depicts the parameters for starter culture 2 (SC2): 1/100 dilution from SCI, duration 1.5 hours, temperature 37° C, shaking at 250 rpm.
  • SCI starter culture 1
  • SC2 starter culture 2
  • 93C depicts the parameters for the production bioreactor: inoculum - SC2, temperature 37° C, pH set point 7.00, pH dead band 0.05, dissolved oxygen set point 50%, dissolved oxygen cascade agitation/gas FLO, agitation limits 300-1200 rpm, gas FLO limits 0.5-20 standard liters per minute, duration 24 hours.
  • Fig. 93D depicts the parameters for harvest: centrifugation at speed 4000 rpm and duration 30 minutes, wash IX 10% glycerol/PBS, centrifugation, re-suspension 10% glycerol/PBS.
  • Fig. 93E depicts the parameters for vial fill/storage: 1-2 mL aliquots, -80° C.
  • the present disclosure includes, inter alia, genetically engineered bacteria, pharmaceutical compositions thereof, and methods of modulating and treating disorders associated with hyperphenylalaninemia.
  • the genetically engineered bacteria comprise a gene encoding non-native phenylalanine ammonia lyase (PAL) and are capable of processing and reducing phenylalanine in a mammal.
  • the engineered bacteria further comprise a gene encoding a phenylalanine transporter.
  • the engineered bacteria may also comprise a gene encoding L-AAD.
  • the engineered bacteria may also contain one or more gene sequences relating to bio-safety and/or bio-containment, e.g., a kil- switch, gene guard system, and/or auxotrophy.
  • the expression of these gene sequence(s) may be regulated using a variety of promoter systems, such as any of the promoter systems disclosed herein, which promoter may be the same promoter to regulate one or more different genes, may be a different copy of the same promoter to regulate different genes, or may involve the use of different promoters used in combination to regulate the expression of different genes.
  • the use of different regulatory or promoter systems to control gene expression provides flexibility (e.g., the ability to differentially control gene expression under different environmental conditions and/or the ability to differentially control gene expression temporally) and also provides the ability to "fine-tune" gene expression, any or all of which regulation may serve to optimize gene expression and/or growth of the bacteria.
  • the genetically engineered bacteria and pharmaceutical compositions comprising those bacteria may be used to metabolize phenylalanine in the body into non-toxic molecules in order to treat and/or prevent conditions associated with hyperphenylalaninemia, including PKU.
  • the compositions comprising the genetically engineered bacteria may be used in the methods of the disclosure to treat and/or prevent disorders associated with hy perpheny 1 al aninemi a.
  • a diagnostic signal of hyperphenylalaninemia is a blood phenylalanine level of at least 2 mg/dL, at least 4 mg/dL, at least 6 mg/dL, at least 8 mg/dL, at least 10 mg/dL, at least 12 mg/dL, at least 14 mg/dL, at least 16 mg/dL, at least 18 mg/dL, at least 20 mg/dL, or at least 25 mg/dL.
  • diseases associated with hyperphenylalaninemia include, but are not limited to, phenylketonuria, classical or typical phenylketonuria, atypical
  • phenylketonuria permanent mild hyperphenylalaninemia, nonphenylketonuric hyperphenylalaninemia, phenylalanine hydroxylase deficiency, cofactor deficiency, dihydropteridine reductase deficiency, tetrahydropterin synthase deficiency, and Segawa's disease.
  • Affected individuals can suffer progressive and irreversible neurological deficits, mental retardation, encephalopathy, epilepsy, eczema, reduced growth, microcephaly, tremor, limb spasticity, and/or hypopigmentation (Leonard 2006).
  • Hyperphenylalaninemia can also be secondary to other conditions, e.g., liver diseases.
  • PME phenylalanine metabolizing enzyme
  • Trans-cinnamic acid has low toxicity and is converted by liver enzymes in mammals to hippuric acid, which is secreted in the urine.
  • PAL may be substituted for the enzyme PAH to metabolize excess phenylalanine.
  • PAL enzyme activity does not require THB cofactor activity.
  • PAL is encoded by a PAL gene derived from a prokaryotic species.
  • PAL is encoded by a PAL gene derived from a eukaryotic species.
  • PAL is encoded by a PAL gene derived from a bacterial species, including but not limited to, Achromobacter xylosoxidans, Pseudomonas aeruginosa, Photorhabdus luminescens, Anabaena variabilis, and Agrobacterium tumefaciens .
  • PAL is encoded by a PAL gene derived from Anabaena variabilis and referred to as "PALI” herein (Moffitt et al., 2007).
  • PAL is encoded by a PAL gene derived from Photorhabdus luminescens and referred to as "PAL3" herein (Williams et al., 2005).
  • PAL is encoded by a PAL gene derived from a yeast species, e.g., Rhodosporidium toruloides (Gilbert et al., 1985). In some embodiments, PAL is encoded by a PAL gene derived from a plant species, e.g., Arabidopsis thaliana (Wanner et al., 1995). Any suitable nucleotide and amino acid sequences of PAL, or functional fragments thereof, may be used.
  • Phenylalanine hydroxylase and “PAH” are used to refer to an enzyme that catalyzes the hydroxylation of the aromatic side chain of phenylalanine to create tyrosine in the human body in conjunction with the cofactor tetrahydrobiopterin.
  • the human gene encoding PAH is located on the long (q) arm of chromosome 12 between positions 22 and 24.2.
  • the amino acid sequence of PAH is highly conserved among mammals. Nucleic acid sequences for human and mammalian PAH are well known and widely available. The full-length human cDNA sequence for PAH was reported in 1985 (Kwok et al. 1985). Active fragments of PAH are also well known (e.g., Kobe et al. 1997).
  • L-Aminoacid Deaminase and “LAAD” are used to refer to an enzyme that catalyzes the stereospecific oxidative deamination of L-amino acids to generate their respective keto acids, ammonia, and hydrogen peroxide.
  • LAAD catalyzes the conversion of phenylalanine to phenylpyruvate.
  • Multiple LAAD enzymes are known in the art, many of which are derived from bacteria, such as Proteus, Providencia, and Morganella, or venom. LAAD is characterized by fast reaction rate of phenylalanine degradation (Hou et al., Appl Microbiol Technol.
  • the genetically engineered bacteria comprise a LAAD gene derived from a bacterial species, including but not limited to, Proteus, Providencia, and Morganella bacteria.
  • the bacterial species is Proteus mirabilis.
  • the bacterial species is Proteus vulgaris.
  • the LAAD encoded by the genetically engineered bacteria is localized to the plasma membrane, facing into the periplasmic space and with the catalytic activity occurring in the periplasmic space.
  • PME Phenylalanine metabolizing enzyme
  • PME phenylalanine hydroxylase
  • PAL phenylalanine ammonia lyase
  • aminotransferase L-amino acid deaminase
  • L-AAD L-amino acid deaminase
  • the PME encoded by the genetically engineered bacteria requires a cofactor. In some embodiments, this cofactor is provided concurrently or sequentially with the administration of the genetically engineered bacteria. In other embodiments, the genetically engineered bacteria can produce the cofactor. In some embodiments, the genetically engineered bacteria encode a phenylalanine hydroxylase. In some embodiments, the genetically engineered bacteria encode a phenylalanine dehydrogenase. In some embodiments, the genetically engineered bacteria encode an aminotransferase.
  • the PME encoded by the genetically engineered bacteria does not require a cofactor.
  • the lack of need for a cofactor means that the rate of phenylalanine degradation by the enzyme is dependent on the availability of the substrate and is not limited by the availability of the cofactor.
  • the PME produced by the genetically engineered bacteria is PAL.
  • the PME produced by the genetically engineered bacteria is LAAD. In some embodiments,
  • the genetically engineered bacteria encode combinations of PMEs.
  • the catalytic activity of the PME is dependent on oxygen levels.
  • the PME is catalytically active under microaerobic conditions.
  • LAAD catalytic activity is dependent on oxygen.
  • LAAD is active under low oxygen conditions, such as microaerobic conditions.
  • the PME functions at very low levels of oxygen or in the absence of oxygen, e.g. as found in the colon.
  • PAL activity is not dependent on the presence of oxygen.
  • new or improved PMEs can be identified according to methods known in the art or described herein, and are encoded by the genetically engineered bacteria.
  • the enzyme encoded by the genetically engineered bacteria is a wild type enzyme isolated from a viral, prokaryotic or eukaryotic organism.
  • the enzyme sequence has been further modified or mutated to increase one or more specific properties of the enzyme, such as stability or catalytic activity.
  • Phenylalanine metabolite refers to a metabolite that is generated as a result of the degradation of phenylalanine.
  • the metabolite may be generated directly from phenylalanine, by the enzyme using phenylalanine as a substrate, or indirectly by a different enzyme downstream in the metabolic pathway, which acts on a phenylalanine metabolite substrate.
  • phenylalanine metabolites are produced by the genetically engineered bacteria encoding a PME.
  • the phenylalanine metabolite results directly or indirectly from PAH activity, e.g., from PAH produced by the genetically engineered bacteria.
  • the metabolite is tyrosine.
  • the phenylalanine metabolite accumulates in the blood or the urine of a PKU patient, due to defective PAH activity.
  • PKU metabolites are phenylpyruvic acid and phenyl-lactic acid.
  • Other examples include phenylacetate, phenylethylamine, and phenylacetyl glutamine.
  • the phenylalanine metabolite results directly or indirectly from PAL action, e.g., from PAL produced by the genetically engineered bacteria.
  • PAL action e.g., from PAL produced by the genetically engineered bacteria.
  • PAL metabolites are trans-cinnamic acid and hippuric acid.
  • the phenylalanine metabolite results directly or indirectly from LAAD action, e.g., from LAAD produced by the genetically engineered bacteria.
  • LAAD metabolites are phenylpyruvate and phenyllactic acid.
  • Phenylalanine transporter is used to refer to a membrane transport protein that is capable of transporting phenylalanine into bacterial cells (see, e.g., Pi et al., 1991).
  • the pheP gene encodes a high affinity phenylalanine- specific permease responsible for phenylalanine transport (Pi et al., 1998).
  • the phenylalanine transporter is encoded by a pheP gene derived from a bacterial species, including but not limited to, Acinetobacter calcoaceticus, Salmonella enterica, and Escherichia coli.
  • phenylalanine transporters include Aageneral amino acid permease, encoded by the aroP gene, transports three aromatic amino acids, including phenylalanine, with high affinity, and is thought, together with PheP, responsible for the lion share of phenylalanine import. Additionally, a low level of phenylalanine transport activity has been traced to the activity of the LIV-I/LS system, which is a branched-chain amino acid transporter consisting of two periplasmic binding proteins, the LIV-binding protein (LIV-I system) and LS-binding protein (LS system), and membrane components, LivHMGF.
  • LIV-I/LS system is a branched-chain amino acid transporter consisting of two periplasmic binding proteins, the LIV-binding protein (LIV-I system) and LS-binding protein (LS system), and membrane components, LivHMGF.
  • the phenylalanine transporter is encoded by a aroP gene derived from a bacterial species. In some embodiments, the phenylalanine transporter is encoded by LIV-binding protein and LS- binding protein and LivHMGF genes derived from a bacterial species. In some embodiments, the genetically engineered bacteria comprise more than one type of phenylalanine transporter, selected from pheP, aroP, and the LIV-I/LS system.
  • Phenylalanine and “Phe” are used to refer to an amino acid with the formula C 6 H 5 CH 2 CH( l 2 )CC)OH. Phenylalanine is a precursor for tyrosine, dopamine, norepinephrine, and epinephrine. L-phenylalanine is an essential amino acid and the form of phenylalanine primarily found in dietary protein; the stereoisomer D- phenylalanine is found is lower amounts in dietary protein; DL-phenylalanine is a combination of both forms. Phenylalanine may refer to one or more of L- phenylalanine, D-phenylalanine, and DL-phenylalanine.
  • operably linked refers a nucleic acid sequence, e.g., a gene encoding PAL, that is joined to a regulatory region sequence in a manner which allows expression of the nucleic acid sequence, e.g., acts in cis.
  • a regulatory region is a nucleic acid that can direct transcription of a gene of interest and may comprise promoter sequences, enhancer sequences, response elements, protein recognition sites, inducible elements, promoter control elements, protein binding sequences, 5' and 3' untranslated regions, transcriptional start sites, termination sequences, polyadenylation sequences, and introns.
  • an "inducible promoter” refers to a regulatory region that is operably linked to one or more genes, wherein expression of the gene(s) is increased in the presence of an inducer of said regulatory region.
  • a "directly inducible promoter” refers to a regulatory region, wherein the regulatory region is operably linked to a gene encoding a phenylalanine- metabolizing enzyme, e.g., PAL; in the presence of an inducer of said regulatory region, the phenylalanine-metabolizing enzyme is expressed.
  • An "indirectly inducible promoter” refers to a regulatory system comprising two or more regulatory regions, for example, a first regulatory region that is operably linked to a gene encoding a first molecule, e.g., a transcriptional regulator, which is capable of regulating a second regulatory region that is operably linked to a gene encoding a phenylalanine- metabolizing enzyme.
  • the second regulatory region may be activated or repressed, thereby activating or repressing expression of the phenylalanine-metabolizing enzyme.
  • inducer of the first regulatory region
  • the second regulatory region may be activated or repressed, thereby activating or repressing expression of the phenylalanine-metabolizing enzyme.
  • Exogenous environmental condition(s) or “environmental conditions” refer to settings or circumstances under which the promoter described herein is directly or indirectly induced. The phrase is meant to refer to the environmental conditions external to the engineered microorganism, but endogenous or native to the host subject environment. Thus, “exogenous” and “endogenous” may be used interchangeably to refer to environmental conditions in which the environmental conditions are
  • the exogenous environmental conditions are specific to the gut of a mammal. In some embodiments, the exogenous environmental conditions are specific to the upper gastrointestinal tract of a mammal. In some embodiments, the exogenous environmental conditions are specific to the lower gastrointestinal tract of a mammal. In some embodiments, the exogenous environmental conditions are specific to the small intestine of a mammal. In some embodiments, the exogenous environmental conditions are low-oxygen, microaerobic, or anaerobic conditions, such as the environment of the mammalian gut.
  • exogenous environmental conditions refer to the presence of molecules or metabolites that are specific to the mammalian gut in a healthy or disease-state, e.g., propionate.
  • the exogenous environmental condition is a tissue- specific or disease-specific metabolite or molecule(s).
  • the exogenous environmental condition is a low-pH environment.
  • the genetically engineered microorganism of the disclosure comprises a pH-dependent promoter.
  • the genetically engineered microorganism of the disclosure comprises an oxygen level-dependent promoter.
  • bacteria have evolved transcription factors that are capable of sensing oxygen levels. Different signaling pathways may be triggered by different oxygen levels and occur with different kinetics.
  • “environmental conditions” also refers to settings or circumstances or environmental conditions external to the engineered microorganism, which relate to in vitro culture conditions of the microorganism.
  • “Exogenous environmental conditions” may also refer to the conditions during growth, production, and manufacture of the organism. Such conditions include aerobic culture conditions, anaerobic culture conditions, low oxygen culture conditions and other conditions under set oxygen concentrations. Such conditions also include the presence of a chemical and/or nutritional inducer, such as tetracycline, arabinose, IPTG, rhamnose, and the like in the culture medium. Such conditions also include the temperatures at which the microorganisms are grown prior to in vivo administration. For example, using certain promoter systems, certain
  • temperatures are permissive to expression of a payload, while other temperatures are non-permissive.
  • Oxygen levels, temperature and media composition influence such exogenous environmental conditions. Such conditions affect proliferation rate, rate of induction of the PME (e.g., PAL or LAAD), rate of induction of the transporter (e.g., PheP) and/or other regulators (e.g., F RS24Y), and overall viability and metabolic activity of the strain during strain production.
  • PME e.g., PAL or LAAD
  • rate of induction of the transporter e.g., PheP
  • other regulators e.g., F RS24Y
  • oxygen level-dependent transcription factors include, but are not limited to, F R, A R, and DNR.
  • F R-responsive promoters, ANR-responsive promoters, and D R-responsive promoters are known in the art (see, e.g., Castiglione et al., 2009; Eiglmeier et al., 1989; Galimand et al., 1991; Hasegawa et al., 1998; Hoeren et al., 1993; Salmon et al., 2003).
  • Non-limiting examples are shown in Table 1.
  • a promoter was derived from the E. coli Nissle fumarate and nitrate reductase gene S (fnrS) that is known to be highly expressed under conditions of low or no environmental oxygen (Durand and Storz, 2010; Boysen et al, 2010).
  • the PfnrS promoter is activated under anaerobic and/or low oxygen conditions by the global transcriptional regulator FNR that is naturally found in Nissle. Under anaerobic and/or low oxygen conditions, FNR forms a dimer and binds to specific sequences in the promoters of specific genes under its control, thereby activating their expression.
  • PfnrS inducible promoter is adopted to modulate the expression of proteins or RNA.
  • PfnrS is used interchangeably in this application as FNRS, fnrS, FNR, P-FNRS promoter and other such related designations to indicate the promoter PfnrS.
  • a "non-native" nucleic acid sequence refers to a nucleic acid sequence not normally present in a bacterium, e.g., an extra copy of an endogenous sequence, or a heterologous sequence such as a sequence from a different species, strain, or substrain of bacteria, or a sequence that is modified and/or mutated as compared to the unmodified sequence from bacteria of the same subtype.
  • the non-native nucleic acid sequence is a synthetic, non-naturally occurring sequence (see, e.g., Purcell et al., 2013).
  • the non-native nucleic acid sequence may be a regulatory region, a promoter, a gene, and/or one or more genes in a gene cassette.
  • “non-native” refers to two or more nucleic acid sequences that are not found in the same relationship to each other in nature.
  • the non- native nucleic acid sequence may be present on a plasmid or chromosome.
  • multiple copies of any regulatory region, promoter, gene, and/or gene cassette may be present in the bacterium, wherein one or more copies of the regulatory region, promoter, gene, and/or gene cassette may be mutated or otherwise altered as described herein.
  • the genetically engineered bacteria are engineered to comprise multiple copies of the same regulatory region, promoter, gene, and/or gene cassette in order to enhance copy number or to comprise multiple different components of a gene cassette performing multiple different functions.
  • the genetically engineered bacteria of the invention comprise a gene encoding a phenylalanine- metabolizing enzyme that is operably linked to a directly or indirectly inducible promoter that is not associated with said gene in nature, e.g., an FNR promoter operably linked to a gene encoding PAL or a ParaBAD promoter operably linked to LAAD.
  • Constant promoter refers to a promoter that is capable of facilitating continuous transcription of a coding sequence or gene under its control and/or to which it is operably linked.
  • Constitutive promoters and variants are well known in the art and include, but are not limited to, BBa_J23100, a constitutive
  • Escherichia coli ⁇ promoter ⁇ e.g., an osmY promoter (International Genetically Engineered Machine (iGEM) Registry of Standard Biological Parts Name BBa_J45992; BBa_J45993)), a constitutive Escherichia coli ⁇ 32 promoter ⁇ e.g., htpG heat shock promoter (BBa_J45504)), a constitutive Escherichia coli ⁇ 70 promoter (e.g., lacq promoter (BBa_J54200; BBa_J56015), E.
  • osmY promoter International Genetically Engineered Machine (iGEM) Registry of Standard Biological Parts Name BBa_J45992; BBa_J45993
  • a constitutive Escherichia coli ⁇ 32 promoter ⁇ e.g., htpG heat shock promoter (BBa_J45504)
  • coli CreABCD phosphate sensing operon promoter (BBa_J64951), GlnRS promoter (BBa_K088007), lacZ promoter (BBa Kl 19000; BBa Kl 19001); M13K07 gene I promoter (BBa_M13101); M13K07 gene II promoter (BBa_M13102), M13K07 gene III promoter (BBa_M13103), M13K07 gene IV promoter (BBa_M13104), M13K07 gene V promoter (BBa_M13105),
  • M13K07 gene VI promoter (BBa_M13106), M13K07 gene VIII promoter
  • BBa_M13108 M13110 (BBa_M13110)
  • BBa_M13110 M13110
  • a constitutive Bacillus subtilis ⁇ ⁇ promoter e.g., promoter veg (BBa_K143013), promoter 43 (BBa_K143013), Pi iaG
  • BBa_K823000 Pi epA (BBa_K823002), P veg (BBa_K823003)), a constitutive Bacillus subtilis ⁇ ⁇ promoter ⁇ e.g., promoter etc (BBa_K143010), promoter gsiB
  • BBa_K143011 a Salmonella promoter (e.g., Pspv2 from Salmonella
  • T7 promoter e.g., T7 promoter (BBa_I712074; BBa_I719005; BBa_J34814; BBa_J64997;
  • BBa Kl 13010 BBa Kl 13011; BBa Kl 13012; BBa_R0085; BBa_R0180;
  • SP6 promoter e.g., SP6 promoter (BBa_J64998)
  • Geck refers to the organs, glands, tracts, and systems that are responsible for the transfer and digestion of food, absorption of nutrients, and excretion of waste.
  • the gut comprises the gastrointestinal (GI) tract, which starts at the mouth and ends at the anus, and additionally comprises the esophagus, stomach, small intestine, and large intestine.
  • the gut also comprises accessory organs and glands, such as the spleen, liver, gallbladder, and pancreas.
  • the upper gastrointestinal tract comprises the esophagus, stomach, and duodenum of the small intestine.
  • the lower gastrointestinal tract comprises the remainder of the small intestine, i.e., the jejunum and ileum, and all of the large intestine, i.e., the cecum, colon, rectum, and anal canal.
  • Bacteria can be found throughout the gut, e.g., in the gastrointestinal tract, and particularly in the intestines.
  • the genetically engineered bacteria are active (e.g., express one or more PMEs) in the gut. In some embodiments, the genetically engineered bacteria are active (e.g., express one or more PMEs) in the large intestine. In some embodiments, the genetically engineered bacteria are active (e.g., express one or more PMEs) in the small intestine. In some embodiments, the genetically engineered bacteria are active in the small intestine and in the large intestine. Without wishing to be bound by theory, phenylalanine degradation may be every effective in the small intestine, because amino acid absorption, e.g., phenylalanine absorption, occurs in the small intestine.
  • enterorecirculation of amino acids between the intestine and the body may allow the removal of systemic phenylalanine in PKU (e.g., described by Chang et al., in a rat model of PKU (Chang et al., A new theory of enterorecirculation of amino acids and its use for depleting unwanted amino acids using oral enzyme-artificial cells, as in removing phenylalanine in phenylketonuria; Artif Cells Blood Substit Immobil
  • Phenylalanine from the blood circulates into the small intestine (see, e.g., Fig. 39) and can be cleared by bacteria which are active at this location.
  • the genetically engineered bacteria transit through the small intestine.
  • the genetically engineered bacteria have increased residence time in the small intestine.
  • the genetically engineered bacteria colonize the small intestine.
  • the genetically engineered bacteria do not colonize the small intestine.
  • the genetically engineered bacteria have increased residence time in the gut.
  • the genetically engineered bacteria colonize the small intestigutne.
  • the genetically engineered bacteria do not colonize the gut.
  • the term “low oxygen” is meant to refer to a level, amount, or concentration of oxygen (0 2 ) that is lower than the level, amount, or concentration of oxygen that is present in the atmosphere (e.g., ⁇ 21% 0 2; ⁇ 160 torr 03 ⁇ 4).
  • the term “low oxygen condition or conditions” or “low oxygen environment” refers to conditions or environments containing lower levels of oxygen than are present in the atmosphere.
  • the term "low oxygen” is meant to refer to the level, amount, or concentration of oxygen (0 2 ) found in a mammalian gut, e.g., lumen, stomach, small intestine, duodenum, jejunum, ileum, large intestine, cecum, colon, distal sigmoid colon, rectum, and anal canal.
  • the term "low oxygen” is meant to refer to a level, amount, or concentration of 0 2 that is 0-60 mmHg 0 2 (0-60 torr 0 2) (e.g., 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45,46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, and 60 mmHg 0 2 ), including any and all incremental fraction(s) thereof (e.g., 0.2 mmHg, 0.5 mmHg 0 2 , 0.75 mmHg 0 2 , 1.25 mmHg 0 2 , 2.175 mmHg 0 2 , 3.45 mmHg 0 2 , 3.75 mmHg 0 2 , 4.5 mmHg 0 2
  • low oxygen refers to about 60 mmHg 0 2 or less (e.g., 0 to about 60 mmHg 0 2 >.
  • the term “low oxygen” may also refer to a range of 0 2 levels, amounts, or concentrations between 0-60 mmHg 0 2 (inclusive), e.g., 0-5 mmHg 0 2 , ⁇ 1.5 mmHg 0 2 , 6-10 mmHg, ⁇ 8 mmHg, 47-60 mmHg, etc. which listed exemplary ranges are listed here for illustrative purposes and not meant to be limiting in any way.
  • the term "low oxygen” is meant to refer to the level, amount, or concentration of oxygen (0 2 ) found in a mammalian organ or tissue other than the gut, e.g., urogenital tract, tumor tissue, etc. in which oxygen is present at a reduced level, e.g., at a hypoxic or anoxic level.
  • low oxygen is meant to refer to the level, amount, or concentration of oxygen (0 2 ) present in partially aerobic, semi aerobic, microaerobic, nanoaerobic, microoxic, hypoxic, anoxic, and/or anaerobic conditions.
  • Table A summarizes the amount of oxygen present in various organs and tissues.
  • DO amount of dissolved oxygen
  • the term "low oxygen” is meant to refer to a level, amount, or concentration of oxygen (0 2 ) that is about 6.0 mg/L DO or less, e.g., 6.0 mg/L, 5.0 mg/L, 4.0 mg/L, 3.0 mg/L, 2.0 mg/L, 1.0 mg/L, or 0 mg/L, and any fraction therein, e.g., 3.25 mg/L, 2.5 mg/L, 1.75 mg/L, 1.5 mg/L, 1.25 mg/L, 0.9 mg/L, 0.8 mg/L, 0.7 mg/L, 0.6 mg/L, 0.5 mg/L, 0.4 mg/L, 0.3 mg/L, 0.2 mg/L and 0.1 mg/L DO, which exemplary fractions are listed here for illustrative purposes and not meant to be limiting in any way.
  • the level of oxygen in a liquid or solution may also he reported as a percentage of air saturation or as a percentage of oxygen saturation (the ratio of the concentration of dissolved oxygen (0 2 ) in the solution to the maximum amount of oxygen that will dissolve in the solution at a certain temperature, pressure, and salinity under stable equilibrium).
  • Well-aerated solutions e.g., solutions subjected to mixing and/or stirring
  • oxygen producers or consumers are 100% air saturated.
  • the term "low oxygen” is meant to refer to 40% air saturation or less, e.g., 40%, 39%, 38%, 37%, 36%, 35%, 34%, 33%, 32%, 31%, 30%, 29%, 28%, 27%, 26%, 25%, 24%, 23%, 22%, 21%, 20%, 19%, 18%, 17%, 16%, 15%, 14%, 13%, 12%, 11%, 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, and 0% air saturation, including any and all incremental fraction(s) thereof (e.g., 30.25%), 22.70%), 15.5%, 7.7%, 5.0%, 2.8%, 2.0%, 1.65%, 1.0%, 0.9%, 0.8%, 0.75%, 0.68%, 0.5%.
  • any range of air saturation levels between 0-40%, inclusive e.g., 0-5%, 0.05 - 0.1%, 0.1-0.2%, 0.1-0.5%, 0.5 - 2.0%, 0-10%, 5-10%, 10-15%, 15-20%, 20-25%, 25-30%, etc.
  • the exemplary fractions and ranges listed here are for illustrative purposes and not meant to be limiting in any way.
  • the term "low oxygen” is meant to refer to 9% 0 2 saturation or less, e.g., 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, 0%), 0 2 saturation, including any and all incremental fraction(s) thereof (e.g., 6.5%, 5.0%, 2.2%, 1.7%, 1.4%, 0.9%, 0.8%, 0.75%, 0.68%, 0.5%. 0.44%, 0.3%, 0.25%, 0.2%, 0.1%, 0.08%, 0.075%, 0.058%, 0.04%.
  • tumor ⁇ 32 torr (most tumors are ⁇ 15 torr)
  • the term "gene” or “gene sequence” is meant to refer to a genetic sequence, e.g., a nucleic acid sequence.
  • the gene, gene sequence or genetic sequence is meant to include a complete gene sequence or a partial gene sequence.
  • the gene, gene sequence or genetic sequence is meant to include sequence that encodes a protein or polypeptide and is also menat to include genetic sequence that does not encode a protein or polypeptide, e.g., a regulatory sequence, leader sequence, signal sequence, or other non-protein coding sequence.
  • Microorganism refers to an organism or microbe of microscopic, submicroscopic, or ultramicroscopic size that typically consists of a single cell.
  • microorganisms include bacteria, yeast, viruses, parasites, fungi, certain algae, and protozoa.
  • the microorganism is engineered ("engineered microorganism") to produce one or more therapeutic molecules or proteins of interest.
  • the microorganism is engineered to take up and catabolize certain metabolites or other compounds from its environment, e.g., the gut.
  • the microorganism is engineered to synthesize certain beneficial metabolites or other compounds (synthetic or naturally occurring) and release them into its environment.
  • the engineered microorganism is an engineered bacterium.
  • the engineered microorganism is an engineered virus.
  • Non-pathogenic bacteria refer to bacteria that are not capable of causing disease or harmful responses in a host.
  • non-pathogenic bacteria are Gram-negative bacteria.
  • non-pathogenic bacteria are Gram-positive bacteria.
  • non-pathogenic bacteria are commensal bacteria, which are present in the indigenous microbiota of the gut.
  • non-pathogenic bacteria examples include, but are not limited to, Bacillus,
  • Bacteroides, Bifidobacterium, Brevibacteria, Clostridium, Enterococcus, Escherichia, Lactobacillus, Lactococcus, Saccharomyces, and Staphylococcus e.g., Bacillus coagulans, Bacillus subtilis, Bacteroides fragilis, Bacteroides subtilis, Bacteroides thetaiotaomicron, Bifidobacterium bifidum, Bifidobacterium infantis, Bifidobacterium lactis, Bifidobacterium longum, Clostridium butyricum, Enterococcus faecium, Escherichia coli, Lactobacillus acidophilus, Lactobacillus bulgaricus, Lactobacillus casei, Lactobacillus johnsonii, Lactobacillus paracasei n Lactobacillus plantarum, Lactobacillus reuteri, Lactobacill
  • Naturally pathogenic bacteria may be genetically engineered to provide reduce or eliminate pathogenicity.
  • Probiotic is used to refer to live, non-pathogenic microorganisms, e.g., bacteria, which can confer health benefits to a host organism that contains an appropriate amount of the microorganism.
  • the host organism is a mammal.
  • the host organism is a human.
  • Some species, strains, and/or subtypes of non-pathogenic bacteria are currently recognized as probiotic.
  • Examples of probiotic bacteria include, but are not limited to, Bifidobacteria, Escherichia, Lactobacillus, and Saccharomyces, e.g. , Bifidobacterium bifidum,
  • the probiotic may be a variant or a mutant strain of bacterium (Arthur et al., 2012; Cuevas-Ramos et al., 2010; Olier et al., 2012; Nougayrede et al., 2006).
  • Non-pathogenic bacteria may be genetically engineered to enhance or improve desired biological properties, e.g., survivability.
  • Non-pathogenic bacteria may be genetically engineered to provide probiotic properties.
  • Probiotic bacteria may be genetically engineered to enhance or improve probiotic properties.
  • stable bacterium is used to refer to a bacterial host cell carrying non-native genetic material, e.g., a PAL gene, which is incorporated into the host genome or propagated on a self-replicating extra- chromosomal plasmid, such that the non-native genetic material is retained, expressed, and/or propagated.
  • non-native genetic material e.g., a PAL gene
  • the stable bacterium is capable of survival and/or growth in vitro, e.g., in medium, and/or in vivo, e.g., in the gut.
  • the stable bacterium may be a genetically modified bacterium comprising a PAL gene, in which the plasmid or chromosome carrying the PAL gene is stably maintained in the host cell, such that PAL can be expressed in the host cell, and the host cell is capable of survival and/or growth in vitro and/or in vivo.
  • copy number affects the stability of expression of the non-native genetic material, e.g., a PAL gene or a PAH gene.
  • copy number affects the level of expression of the non-native genetic material, e.g., a PAL gene or a PAH gene.
  • module and “treat” and their cognates refer to an amelioration of a disease, disorder, and/or condition, or at least one discernible symptom thereof.
  • modulate and “treat” refer to an amelioration of at least one measurable physical parameter, not necessarily discernible by the patient.
  • modulate” and “treat” refer to inhibiting the progression of a disease, disorder, and/or condition, either physically (e.g., stabilization of a discernible symptom), physiologically (e.g., stabilization of a physical parameter), or both.
  • modulate” and “treat” refer to slowing the progression or reversing the progression of a disease, disorder, and/or condition.
  • prevent and its cognates refer to delaying the onset or reducing the risk of acquiring a given disease, disorder and/or condition or a symptom associated with such disease, disorder, and/or condition.
  • Those in need of treatment may include individuals already having a particular medical disease, as well as those at risk of having, or who may ultimately acquire the disease.
  • the need for treatment is assessed, for example, by the presence of one or more risk factors associated with the development of a disease, the presence or progression of a disease, or likely receptiveness to treatment of a subject having the disease.
  • Primary hyperphenylalaninemia e.g., PKU
  • Hyperphenylalaninemia can also be secondary to other conditions, e.g., liver diseases. Treating hyperphenylalaninemia may encompass reducing or eliminating excess phenylalanine and/or associated symptoms, and does not necessarily encompass the elimination of the underlying disease.
  • a "pharmaceutical composition” refers to a preparation of genetically engineered bacteria of the invention with other components such as a physiologically suitable carrier and/or excipient.
  • physiologically acceptable carrier and “pharmaceutically acceptable carrier” which may be used interchangeably refer to a carrier or a diluent that does not cause significant irritation to an organism and does not abrogate the biological activity and properties of the administered bacterial compound.
  • An adjuvant is included under these phrases.
  • excipient refers to an inert substance added to a
  • compositions to further facilitate administration of an active ingredient.
  • examples include, but are not limited to, calcium bicarbonate, calcium phosphate, various sugars and types of starch, cellulose derivatives, gelatin, vegetable oils, polyethylene glycols, and surfactants, including, for example, polysorbate 20.
  • therapeutically effective dose and “therapeutically effective amount” are used to refer to an amount of a compound that results in prevention, delay of onset of symptoms, or amelioration of symptoms of a condition, e.g., hyperphenylalaninemia.
  • a therapeutically effective amount may, for example, be sufficient to treat, prevent, reduce the severity, delay the onset, and/or reduce the risk of occurrence of one or more symptoms of a disease or condition associated with excess phenylalanine levels.
  • a therapeutically effective amount, as well as a therapeutically effective frequency of administration can be determined by methods known in the art and discussed below.
  • polypeptide includes “polypeptide” as well as “polypeptides,” and refers to a molecule composed of amino acid monomers linearly linked by amide bonds (i.e., peptide bonds).
  • polypeptide refers to any chain or chains of two or more amino acids, and does not refer to a specific length of the product.
  • peptides include “peptides,” “dipeptides,” “tripeptides, “oligopeptides,” “protein,” “amino acid chain,” or any other term used to refer to a chain or chains of two or more amino acids, and the term “polypeptide” may be used instead of, or interchangeably with any of these terms.
  • dipeptide refers to a peptide of two linked amino acids.
  • tripeptide refers to a peptide of three linked amino acids.
  • polypeptide is also intended to refer to the products of post-expression modifications of the polypeptide, including but not limited to giycosylation, acetyl ati on, phosphorylation, amidation, derivatization, proteolytic cleavage, or modification by non-naturally occurring amino acids.
  • a polypeptide may be derived from a natural biological source or produced by
  • polypeptide is produced by the genetically engineered bacteria or virus of the current invention
  • a polypeptide of the invention may be of a size of about 3 or more, 5 or more, 10 or more, 20 or more, 25 or more, 50 or more, 75 or more, 100 or more, 200 or more, 500 or more, 1,000 or more, or 2,000 or more amino acids.
  • Polypeptides may have a defined three-dimensional structure, although they do not necessarily have such structure. Polypeptides with a defined three-dimensional structure are referred to as folded, and polypeptides, which do not possess a defined three-dimensional structure, but rather can adopt a large number of different conformations, are referred to as unfolded.
  • peptide or “polypeptide” may refer to an amino acid sequence that corresponds to a protein or a portion of a protein or may refer to an amino acid sequence that corresponds with nonprotein sequence, e.g., a sequence selected from a regulatory peptide sequence, leader peptide sequence, signal peptide sequence, linker peptide sequence, and other peptide sequence.
  • polypeptide or a fragment, variant, or derivative thereof refers to a polypeptide that is not in its natural milieu. No particular level of purification is required.
  • Recombinantly produced polypeptides and proteins expressed in host cells including but not limited to bacterial or mammalian cells, are considered isolated for purposed of the invention, as are native or recombinant polypeptides which have been separated, fractionated, or partially or substantially purified by any suitable technique.
  • Recombinant peptides, polypeptides or proteins refer to peptides, polypeptides or proteins produced by recombinant DNA techniques, i.e.
  • fragment produced from cells, microbial or mammalian, transformed by an exogenous recombinant DNA expression construct encoding the polypeptide. Proteins or peptides expressed in most bacterial cultures will typically be free of glycan. Fragments, derivatives, analogs or variants of the foregoing polypeptides, and any combination thereof are also included as polypeptides.
  • fragment include polypeptides having an amino acid sequence sufficiently similar to the amino acid sequence of the original peptide and include any polypeptides, which retain at least one or more properties of the
  • Fragments of polypeptides of the present invention include proteolytic fragments, as well as deletion fragments. Fragments also include specific antibody or bioactive fragments or immunologically active fragments derived from any polypeptides described herein. Variants may occur naturally or be non- naturally occurring. Non-naturally occurring variants may be produced using mutagenesis methods known in the art. Variant polypeptides may comprise conservative or non-conservative amino acid substitutions, deletions or additions.
  • Polypeptides also include fusion proteins.
  • the term “variant” includes a fusion protein, which comprises a sequence of the original peptide or sufficiently similar to the original peptide.
  • the term “fusion protein” refers to a chimeric protein comprising amino acid sequences of two or more different proteins. Typically, fusion proteins result from well known in vitro recombination techniques. Fusion proteins may have a similar structural function (but not necessarily to the same extent), and/or similar regulatory function (but not necessarily to the same extent), and/or similar biochemical function (but not necessarily to the same extent) and/or immunological activity (but not necessarily to the same extent) as the individual original proteins which are the components of the fusion proteins.
  • “Derivatives” include but are not limited to peptides, which contain one or more naturally occurring amino acid derivatives of the twenty standard amino acids. "Similarity" between two peptides is determined by comparing the amino acid sequence of one peptide to the sequence of a second peptide. An amino acid of one peptide is similar to the corresponding amino acid of a second peptide if it is identical or a conservative amino acid substitution.
  • amino acids belonging to one of the following groups represent conservative changes or substitutions: -Ala, Pro, Gly, Gin, Asn, Ser, Thr; -Cys, Ser, Tyr, Thr; -Val, He, Leu, Met, Ala, Phe; -Lys, Arg, His; -Phe, Tyr, Tip, His; and -Asp, Glu.
  • the term "sufficiently similar” means a first amino acid sequence that contains a sufficient or minimum number of identical or equivalent amino acid residues relative to a second amino acid sequence such that the first and second amino acid sequences have a common structural domain and/or common functional activity.
  • amino acid sequences that comprise a common structural domain that is at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%>, at least about 95%>, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or at least about 100%, identical are defined herein as sufficiently similar.
  • variants will be sufficiently similar to the amino acid sequence of the peptides of the invention. Such variants generally retain the functional activity of the peptides of the present invention.
  • Variants include peptides that differ in amino acid sequence from the native and wt peptide, respectively, by way of one or more amino acid deletion(s), addition(s), and/or substitution(s). These may be naturally occurring variants as well as artificially designed ones.
  • linker refers to synthetic or non-native or non-naturally-occurring amino acid sequences that connect or link two polypeptide sequences, e.g., that link two
  • polypeptide domains As used herein the term “synthetic” refers to amino acid sequences that are not naturally occurring. Exemplar ⁇ ' linkers are described herein. Additional exemplary linkers are provided in US 20140079701, the contents of which are herein incorporated by reference in its entirety.
  • cognidized sequence refers to a sequence, which was modified from an existing coding sequence, or designed, for example, to improve translation in an expression host cell or organism of a transcript RNA molecule transcribed from the coding sequence, or to improve transcription of a coding sequence. Codon optimization includes, but is not limited to, processes including selecting codons for the coding sequence to suit the codon preference of the expression host organism.
  • codon-optimized refers to the modification of codons in the gene or coding regions of a nucleic acid molecule to reflect the typical codon usage of the host organism without altering the polypeptide encoded by the nucleic acid molecule.
  • Such optimization includes replacing at least one, or more than one, or a significant number, of codons with one or more codons that are more frequently used in the genes of the host organism.
  • a "codon-optimized sequence” refers to a sequence, which was modified from an existing coding sequence, or designed, for example, to improve translation in an expression host cell or organism of a transcript RNA molecule transcribed from the coding sequence, or to improve transcription of a coding sequence.
  • the improvement of transcription and/or translation involves increasing the level of transcription and/or translation.
  • the improvement of transcription and/or translation involves decreasing the level of transcription and/or translation.
  • codon optimization is used to fine-tune the levels of expression from a construct of interest, e.g., PAL3 levels and/or PheP levels.
  • Codon optimization includes, but is not limited to, processes including selecting codons for the coding sequence to suit the codon preference of the expression host organism.
  • Many organisms display a bias or preference for use of particular codons to code for insertion of a particular amino acid in a growing polypeptide chain. Codon preference or codon bias, differences in codon usage between organisms, is allowed by the degeneracy of the genetic code, and is well documented among many organisms.
  • Codon bias often correlates with the efficiency of translation of messenger RNA (mRNA), which is in turn believed to be dependent, inter alia, on the properties of the codons being translated and the availability of particular transfer RNA (tRNA) molecules.
  • mRNA messenger RNA
  • tRNA transfer RNA
  • the predominance of selected tRNAs in a cell is generally a reflection of the codons used most frequently in peptide synthesis. Accordingly, genes can be tailored for optimal gene expression in a given organism based on codon optimization.
  • secretion system or “secretion protein” refers to a native or non-native secretion mechanism capable of secreting or exporting the protein(s) of interest or therapeutic protein(s) from the microbial, e.g., bacterial cytoplasm.
  • the secretion system may comprise a single protein or may comprise two or more proteins assembled in a complex e.g., HlyBD.
  • Non-limiting examples of secretion systems for gram negative bacteria include the modified type III flagellar, type I (e.g., hemolysin secretion system), type II, type IV, type V, type VI, and type VII secretion systems, resistance-nodulation-division (RND) multi-drug efflux pumps, various single membrane secretion systems.
  • Non-liming examples of secretion systems for gram positive bacteria include Sec and TAT secretion systems.
  • the proteins of interest include a "secretion tag" of either RNA or peptide origin to direct the protein(s) of interest or therapeutic protein(s) to specific secretion systems.
  • the secretion system is able to remove this tag before secreting the protein(s) of interest from the engineered bacteria.
  • the N-terminal peptide secretion tag is removed upon translocation of the "passenger" peptide from the cytoplasm into the periplasmic compartment by the native Sec system.
  • the C-terminal secretion tag can be removed by either an autocatalytic or protease-catalyzed e.g., OmpT cleavage thereby releasing the protein(s) of interest into the extracellular milieu.
  • the term "transporter” is meant to refer to a mechanism, e.g., protein or proteins, for importing a molecule, e.g., amino acid, toxin, metabolite, substrate, etc. into the microorganism from the extracellular milieu.
  • a phenylalanine transporter such as PheP imports phenylalanine into the microorganism.
  • the phrase "and/or,” when used between elements in a list, is intended to mean either (1) that only a single listed element is present, or (2) that more than one element of the list is present.
  • “A, B, and/or C” indicates that the selection may be A alone; B alone; C alone; A and B; A and C; B and C; or A, B, and C.
  • the phrase “and/or” may be used interchangeably with "at least one of or "one or more of the elements in a list.
  • the genetically engineered bacteria of the invention are capable of reducing excess phenylalanine.
  • the genetically engineered bacteria are non-pathogenic bacteria.
  • the genetically engineered bacteria are commensal bacteria.
  • the genetically engineered bacteria are probiotic bacteria.
  • the genetically engineered bacteria are naturally pathogenic bacteria that are modified or mutated to reduce or eliminate pathogenicity.
  • non-pathogenic bacteria are Gram- negative bacteria.
  • non-pathogenic bacteria are Gram-positive bacteria.
  • Exemplary bacteria include, but are not limited to, Bacillus, Bacteroides, Bifidobacterium, Brevibacteria, Clostridium, Enter ococcus, Escherichia coli,
  • Lactobacillus Lactococcus, Saccharomyces, and Staphylococcus, e.g., Bacillus coagulans, Bacillus subtilis, Bacteroides fragilis, Bacteroides subtilis, Bacteroides thetaiotaomicron, Bifidobacterium bifidum, Bifidobacterium infantis, Bifidobacterium lactis, Bifidobacterium longum, Clostridium butyricum, Enterococcus faecium,
  • the genetically engineered bacteria are selected from the group consisting of Bacteroides fragilis, Bacteroides thetaiotaomicron, Bacteroides subtilis,
  • the genetically engineered bacteria are any suitable organisms.
  • Escherichia coli strain Nissle 1917 (E. coli Nissle), a Gram-negative bacterium of the Enterobacteriaceae family that has evolved into one of the best characterized probiotics (Ukena et al., 2007).
  • the strain is characterized by its complete harmlessness (Schultz, 2008), and has GRAS (generally recognized as safe) status (Reister et al., 2014, emphasis added).
  • Genomic sequencing confirmed that E. coli Nissle lacks prominent virulence factors (e.g., E. coli a-hemolysin, P-fimbrial adhesins) (Schultz, 2008). In addition, it has been shown that E.
  • E. coli Nissle does not carry pathogenic adhesion factors, does not produce any enterotoxins or cytotoxins, is not invasive, and is not uropathogenic (Sonnenborn et al., 2009). As early as in 1917, E. coli Nissle was packaged into medicinal capsules, called Mutaflor, for therapeutic use. It is commonly accepted that E. coli Nissle' s therapeutic efficacy and safety have convincingly been proven (Ukena et al., 2007).
  • genes from one or more different species can be introduced into one another, e.g., the PAL gene from Rhodosporidium toruloides can be expressed in Escherichia coli (Sarkissian et al., 1999), and it is known that prokaryotic and eukaryotic phenylalanine ammonia lyases share sequence homology (Xiang and Moore, 2005).
  • Unmodified E. coli Nissle and the genetically engineered bacteria of the invention may be destroyed, e.g., by defense factors in the gut or blood serum
  • the genetically engineered bacteria may require continued administration.
  • the residence time is calculated for a human subject. Residence time in vivo may be calculated for the genetically engineered bacteria of the invention ⁇ see, e.g. , Fig. 68).
  • the genetically engineered bacteria of the invention comprise a gene encoding PAL, wherein the PAL gene is operably linked to a directly or indirectly inducible promoter.
  • the bacteria comprise a non-native PAL gene.
  • the bacteria comprise additional copies of a native PAL gene.
  • the promoter is not associated with the PAL gene in nature. In some embodiments, the promoter is any one or more of the promoters disclosed herein.
  • the genetically engineered bacteria of the invention comprise a gene encoding PAH, wherein the PAH gene is operably linked to a directly or indirectly inducible promoter.
  • the bacteria comprise a non-native PAH gene.
  • the bacteria comprise additional copies of a native PAH gene.
  • the promoter is not associated with the PAH gene in nature. In some embodiments, the promoter is any one or more of the promoters disclosed herein.
  • the genetically engineered bacteria of the invention comprise a gene encoding LAAD, wherein the LAAD gene is operably linked to a directly or indirectly inducible promoter.
  • the bacteria comprise a non-native LAAD gene.
  • the bacteria comprise additional copies of a native LAAD gene.
  • the promoter is not associated with the LAAD gene in nature. In some embodiments, the promoter is any one or more of the promoters disclosed herein.
  • the genetically engineered bacteria further comprise a gene encoding a phenylalanine transporter (PheP).
  • the bacteria comprise additional copies of a native gene encoding a phenylalanine transporter, wherein the phenylalanine transporter gene is operably linked to a directly or indirectly inducible promoter.
  • the bacteria comprise a gene encoding a non-native phenylalanine transporter, wherein the phenylalanine transporter gene is operably linked to a directly or indirectly inducible promoter. Both embodiments are encompassed by the term "non-native" phenylalanine transporter.
  • the promoter is not associated with the pheP gene in nature. In some embodiments, the same promoter controls expression of PheP and PAL and/or PAH and/or L-AAD. In some embodiments, the promoter that controls expression of PheP differs from the promoter that controls expression of PAL and/or PAH and/or L- AAD. In some embodiments, the promoter that controls the expression of PheP is any one or more of the promoters disclosed herein.
  • the promoter that is operably linked to PAL, PAH, LAAD, and/or pheP is directly or indirectly induced by exogenous environmental conditions. In some embodiments, the promoter is directly or indirectly induced by exogenous environmental conditions specific to the gut of a mammal. In some embodiments, the promoter is directly or indirectly induced by exogenous
  • the promoter is directly or indirectly induced by exogenous
  • the promoter is directly or indirectly induced by low-oxygen or anaerobic and/or low oxygen conditions such as the environment of the mammalian gut. In some embodiments, the promoter is directly or indirectly induced by the presence of molecules or metabolites that are specific to the gut of a mammal, e.g., propionate. In some embodiments, the promoter is directly or indirectly induced by exposure to tetracycline. In some embodiments, the promoter is directly or indirectly induced by exposure to arabinose. In some embodiments, the promoter is directly or indirectly induced by exposure to IPTG.
  • the promoter is directly or indirectly induced by exposure to rhamnose or other chemical and/or nutritional inducer known in the art. In some embodiments, the promoter is directly or indirectly regulated by the exogenous environmental temperature. In some embodiments, the promoter is directly or indirectly induced by exposure to IPTG or other lacl binding compound. In some embodiments, the promoter is directly or indirectly induced by exposure to rhamnose. In some embodiments, the promoter is directly or indirectly induced by increase in temperature. In some embodiments, the promoter is directly or indirectly induced by decrease in temperature. In some embodiments, the promoter is directly or indirectly induced by a molecule that is co-administered with the genetically engineered bacteria of the invention.
  • Such a molecule may be tetracycline or IPTG or arabinose or other chemical and/or nutritional inducer known in the art.
  • the promoter is directly or indirectly induced by conditions in a culture vessel (e.g., a flask or a fermenter or other appropriate culture vessel), in which the strain is grown or maintained prior to in vivo administration.
  • a culture vessel e.g., a flask or a fermenter or other appropriate culture vessel
  • Non- limiting examples of such conditions which are provided during culture of the strain prior to in vivo administration include low oxygen, anaerobic, microaerobic, or aerobic conditions, other defined oxygen levels (such as those exemplified below), presence of arabinose, presence of IPTG, rhamnose or other chemical and/or nutritional inducers described herein or known in the art.
  • the conditions in a culture vessel are set at certain oxygen levels, e.g, between 1% and 10% oxygen, between 10%> and 20%) oxygen, between 20% and 30%> oxygen, between 30%> and 40% oxygen, between 40% and 50% oxygen, between 60% and 70% oxygen, between 70% and 80% oxygen, between 80% and 90% oxygen, between 90% andl00%> oxygen, and other levels of oxygen as described herein, at which point the promoter is directly or indirectly induced.
  • certain oxygen levels e.g, between 1% and 10% oxygen, between 10%> and 20%) oxygen, between 20% and 30%> oxygen, between 30%> and 40% oxygen, between 40% and 50% oxygen, between 60% and 70% oxygen, between 70% and 80% oxygen, between 80% and 90% oxygen, between 90% andl00%> oxygen, and other levels of oxygen as described herein, at which point the promoter is directly or indirectly induced.
  • the genetically engineered bacteria of the invention comprise a gene encoding a phenylalanine-metabolizing enzyme (PME).
  • the genetically engineered bacteria comprise a gene encoding a phenylalanine-metabolizing enzyme (PME) and are capable of reducing hyperphenylalaninemia.
  • phenylalanine metabolizing enzymes include, but are not limited to, phenylalanine hydroxylase (PAH), phenylalanine ammonia lyase (PAL), aminotransferases, L-amino acid deaminase (L-AAD), and phenylalanine
  • dehydrogenases or aminotransferases require cofactors, while L-AAD and PAL do not require any extra cofactor.
  • the lack of need for a cofactor means that phenylalanine degradation by the enzyme encoded by the genetically engineered bacteria is dependent on the availability of the substrate and is not limited by the availability of the cofactor.
  • the engineered bacteria comprise gene sequence encoding one or more phenylalanine hydroxylase (PAH) polypeptides. In some embodiments, the engineered bacteria comprise gene sequence encoding one or more phenylalanine ammonia lyase (PAL) polypeptides.
  • PAH phenylalanine hydroxylase
  • PAL phenylalanine ammonia lyase
  • Phenylalanine ammonia lyase (PAL; EC 4.3.1.24) is an enzyme that catalyzes a reaction converting L-phenylalanine to ammonia and trans-cinnamic acid. Phenylalanine ammonia lyase is specific for L- Phe, and to a lesser extent, L-Tyrosine.
  • PAL The reaction catalyzed by PAL is the spontaneous, non-oxidative deamination of L-phenylalanine to yield trans-cinnamic acid and ammonia.
  • PAH mammalian enzyme
  • PAL is a monomer and requires no cofactors (MacDonald et al., Biochem Cell Biol 2007;85:273-82.
  • L-Phe L-phenylalanine
  • the genetically engineered bacteria of the invention comprise a PAL gene.
  • PAL is capable of converting phenylalanine to non-toxic levels of transcinnamic acid and ammonia.
  • Trans-cinnamic acid (TCA) can further be converted to TCA metabolites benzoic and hippuric acids (Sarkissian et al., J Mass Spectrom. 2007 Jun;42(6):811-7; Quantitation of phenylalanine and its trans-cinnamic, benzoic and hippuric acid metabolites in biological fluids in a single GC-MS analysis).
  • PAL enzyme activity does not require THB cof actor activity.
  • PAL is encoded by a PAL gene derived from a bacterial species, including but not limited to, Achromobacter xylosoxidans,
  • the bacterial species is Pseudomonas aeruginosa, Photorhabdus luminescens, Anabaena variabilis, and Agrobacterium tumefaciens.
  • the bacterial species is
  • the bacterial species is Anabaena variabilis.
  • PAL is encoded by a PAL gene derived from a eukaryotic species, e.g., a yeast species, a plant species. Multiple distinct PAL proteins are known in the art.
  • the genetically engineered bacteria convert more phenylalanine when the PAL gene is expressed than unmodified bacteria of the same bacterial subtype under the same conditions.
  • the genetically engineered bacteria comprising PAL may be used to metabolize phenylalanine in the body into non-toxic molecules in order to treat conditions associated with hyperphenylalaninemia, including PKU.
  • the genetically engineered bacteria express Anabaena variabilis PAL ("PALI").
  • the genetically engineered bacteria express
  • the engineered bacteria comprise gene sequence encoding one or more LAAD polypeptides.
  • the engineered bacteria comprise gene sequence encoding one or more PAL polypeptides and one or more LAAD polypeptides.
  • LAAD catalyzes the stereospecific oxidative, i.e., oxygen consuming, deamination of L-amino acids to a-keto acids along with the production of ammonia and hydrogen peroxide via an imino acid intermediate.
  • L-AADs are found in snake venoms, and in many bacteria (Bifulco et al. 2013), specifically in the
  • L-AADs cytomembranes of the Proteus, Providencia, and Morganella bacteria.
  • L-AADs EC 1.4.3.2 are flavoenzymes with a dimeric structure. Each subunit contains a non- covalently-bound flavin adenine dinucleotide (FAD) cofactor) and do not require any external cofactors.
  • FAD flavin adenine dinucleotide
  • Proteus mirabilis contains two types of L-AADs (Duerre and Chakrabarty 1975). One has broad substrate specificity and catalyzes the oxidation of aliphatic and aromatic L-amino acids to keto acids, typically L-phenyl alanine
  • L-amino acid deaminases are extracellularly secreted, with the exception of from Proteus species LAADs, which are membrane-bound.
  • LAADs Proteus species
  • L-AADs have been reported to be located in the plasma membrane, facing outward into the periplasmic space, in which the enzymatic activity resides (Pelmont J et al., (1972) "L-amino acid oxidases of Proteus mirabilis: general properties" Biochimie 54: 1359-1374).
  • the genetically engineered bacteria of the invention comprise a LAAD gene.
  • LAAD is capable of converting phenylalanine to non-toxic levels of phenylpyruvate, which can also further be degraded, e.g., by liver enzymes, to phenyllactate. Phenylpyruvate cannot cross the blood brain barrier, which allows LAAD to reduce the levels of phenylalanine in the brain without allowing the accumulation of another potentially toxic metabolite.
  • LAAD is encoded by a LAAD gene derived from a bacterial species, including but not limited to, Proteus, Providencia, and Morganella bacteria. In some embodiments, the bacterial species is Proteus mirabilis.
  • the bacterial species is Proteus vulgaris.
  • the genetically engineered bacteria express Proteus mirabilis LAAD enzyme GenBank: U35383.1. Non-limiting examples of LAAD sequences of interest are shown in Table 2.
  • the LAAD enzyme is derived from snake venom. According to the invention, genetically engineered bacteria convert more phenylalanine when the LAAD gene is expressed than unmodified bacteria of the same bacterial subtype under the same conditions. Thus, the genetically engineered bacteria comprising LAAD may be used to metabolize phenylalanine in the body into non-toxic molecules in order to treat conditions associated with
  • hyperphenylalaninemia including PKU.
  • the genetically engineered bacteria encode a wild type enzyme as it occurs in nature.
  • the genetically engineered bacteria encode an enzyme which comprises mutations relative to the wild type sequence.
  • the mutations increase stability of the enzyme.
  • the mutations increase the catalytic activity of the enzyme.
  • the genetically engineered bacteria comprise a gene encoding one or more of the proteins listed in Table 2.
  • the genetically engineered bacteria comprise gene sequence(s) encoding one or more of the polypeptides comprising sequence of any of SEQ ID Nos: 1-8.
  • the genetically engineered bacteria comprise gene sequence(s) encoding a polypeptide having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%,96%, 97%, 98%, or 99% identity with any of the sequences of SEQ ID Nos: 1-8.
  • the genetically engineered bacteria encode one or more enzymes from Table 2, which comprise a mutation.
  • the genetically engineered bacteria comprise a gene encoding wild type PAH.
  • the genetically engineered bacteria encode a mutated PAH with increased stability and/or activity.
  • the genetically engineered bacteria comprise a gene encoding wild type PAL. In some embodiments, the genetically engineered bacteria encode a mutated PAL with increased stability and/or activity. In some embodiments, the genetically engineered bacteria comprise a gene encoding wild type LAAD. In some embodiments, the genetically engineered bacteria encode a mutated LAAD with increased stability and/or activity. Methods for screening for enzymes with desirable properties are known in the art and described herein. Table 2. Sequences of Phenylalanine Metabolizing Enzymes
  • Phenylalanin M S T A VLENPGL GRKL SDF GQET S YIEDNCNQNG AI S SEQ ID e LIF SLKEE VGAL AK VLRLFEEND VNLTHIE SRP SRLK NO: 8 hydroxylase KDEYEFFTHLDKRSLPALTNIIKILRHDIGATVHELS
  • the PME e.g., PAL, LAAD, or PAH, gene(s) may be present on a plasmid or chromosome in the genetically engineered bacteria.
  • the PME gene sequence(s) are expressed under the control of one or more constitutive promoter(s).
  • the PME gene is expressed under the control of a promoter that is directly or indirectly induced by exogenous environmental conditions, as described herein.
  • the PME gene is expressed under the control of a promoter that is directly or indirectly induced by exogenous environmental conditions, such as in the presence of molecules or metabolites specific to the gut of a mammal.
  • the PME gene is expressed under the control of a promoter that is directly or indirectly induced by low-oxygen, microaerobic, or
  • anaerobic conditions wherein expression of the PME gene, e.g., the PAL gene, is activated under low-oxygen or anaerobic environments, such as the environment of the mammalian gut.
  • the genetically engineered bacteria comprise gene sequence encoding one or more PAL polypeptide sequence(s). In some embodiments, the engineered bacteria comprise gene sequence encoding one or more PAL polypeptide sequence(s) in which the gene sequene(s) is directly or indirectly induced by low-oxygen or anaerobic conditions, such as the mammalian gut. In some embodiments, the engineered bacteria comprise gene sequence encoding one or more LAAD polypeptides.
  • the engineered bacteria comprise gene sequence encoding one or more LAAD polypeptides, in which the gene sequence(s) is directly or indirectly induced by oxygenated, low oxygen, or microaerobic conditions, such as conditions found in the proximal intestine, including but not limited to the stomach, duodenum, and ileum.
  • the engineered bacteria comprise gene sequence(s) encoding one or more PME polypeptide sequences(s) in which the gene sequene(s) is directly or indirectly induced by an environmental factor that is naturally present in a mammalian gut.
  • the genetically engineered bacteria encode one or more PME gene sequences(s) which are directly or indirectly induced by an environmental factor that is not naturally present in a mammalian gut, e.g., arabinose or IPTG. In other embodiments, the genetically engineered bacteria encode one or more PME gene sequences(s) which are directly or indirectly induced by an environmental factor that is naturally present in a mammalian gut under inflammatory conditions.
  • the engineered bacteria comprise gene sequence(s) encoding one or more PAL polypeptides and gene sequence(s) encoding one or more L-AAD polypeptides in which the gene sequences are under the control of the same promoter or a different copy of the same promoter, which is directly or indirectly induced by exogenous environmental conditions, such as any of the environmental conditions discussed herein and such as any of the promoters discussed herein.
  • the engineered bacteria comprise gene sequence(s) encoding one or more PAL polypeptides and gene sequence(s) encoding one or more L-AAD polypeptides in which the gene sequences are under the control of a different promoter, which is directly or indirectly induced by exogenous
  • the engineered bacteria comprise gene sequence(s) encoding one or more PAL polypeptides and gene sequence(s) encoding one or more L-AAD polypeptides in which the gene sequences are under the control of a constitutive promoter. In some embodiments, the engineered bacteria comprise gene sequence(s) encoding one or more PAL polypeptides and gene sequence(s) encoding one or more L-AAD polypeptides in which the PAL gene sequences are under the control of a constitutive promoter and the LAAD gene sequence(s) are under the control of an inducible promoter.
  • the engineered bacteria comprise gene sequence(s) encoding one or more PAL polypeptides and gene sequence(s) encoding one or more L-AAD polypeptides in which the LAAD gene sequences are under the control of a constitutive promoter and the PAL gene sequence(s) are under the control of an inducible promoter.
  • the bacteria may further comprise gene sequence encoding one or more Phe transporter polypeptides, which gene sequence(s) may be under the control of a constitutive or inducible promoter and may be the same or differnet promoter from the promoter controlling the Pal and/or LAAD gene sequence(s).
  • the engineered bacteria encode one or more PME gene sequence(s) which are directly or indirectly induced prior to in vivo administration during bacterial cell culture; i.e., one or more PME gene sequence(s) are expressed under the control of an inducible promoter that is responsive to specific molecules or metabolites, temperature, oxygen levels or other parameters provided in the culture of the bacterium as it is grown in a flask, fermenter, or other culture vessel.
  • the engineered bacteria encode one or more PME gene sequence(s) which are directly or indirectly induced prior to in vivo administration during bacterial cell culture; wherein the one or more PME gene sequence(s) are expressed under low oxygen or anaerobic conditions.
  • the engineered bacteria encode one or more PME gene sequence(s) which are directly or indirectly induced prior to in vivo administration during bacterial cell culture; wherein the one or more PME gene sequence(s) are expressed under aerobic conditions. In some embodiments, the engineered bacteria encode one or more PME gene sequence(s) which are directly or indirectly induced prior to in vivo administration during bacterial cell culture; wherein the one or more PME gene sequence(s) are expressed under microaerobic conditions. In some embodiments, the engineered bacteria encode one or more PME gene sequence(s) which are directly or indirectly induced prior to in vivo administration during bacterial cell culture; wherein the one or more PME gene sequence(s) are expressed in the presence of arabinose. In some embodiments, the engineered bacteria encode one or more PME gene sequence(s) which are directly or indirectly induced prior to in vivo administration during bacterial cell culture; wherein the one or more PME gene sequence(s) are expressed in the presence of IPTG.
  • An oxygen level-dependent promoter is a nucleic acid sequence to which one or more oxygen level-sensing transcription factors is capable of binding, wherein the binding and/or activation of the corresponding transcription factor activates downstream gene expression.
  • the PME gene is expressed under the control of an oxygen level-dependent promoter.
  • the PAL gene is under the control of an oxygen level-dependent promoter that is activated under low-oxygen or anaerobic environments, such as the environment of the mammalian gut.
  • the genetically engineered bacteria comprise one or more gene PME gene sequence(s), e.g., PAL, expressed under the control of the fumarate and nitrate reductase regulator (FNR) promoter.
  • FNR fumarate and nitrate reductase regulator
  • E. coli FNR is a major transcriptional activator that controls the switch from aerobic to anaerobic metabolism (Unden et al., 1997). In the anaerobic and/or low oxygen state, FNR dimerizes into an active DNA binding protein that activates hundreds of genes responsible for adapting to anaerobic growth. In the aerobic state, FNR is prevented from dimerizing by oxygen and is inactive.
  • multiple distinct FNR nucleic acid sequences are inserted in the genetically engineered bacteria.
  • the genetically engineered bacteria comprise a PME, e.g., PAL, expressed under the control of an alternate oxygen level-dependent promoter, e.g., an ANR promoter (Ray et al., 1997), a DNR promoter (Trunk et al., 2010).
  • an alternate oxygen level-dependent promoter e.g., an ANR promoter (Ray et al., 1997), a DNR promoter (Trunk et al., 2010.
  • phenylalanine metabolism is particularly activated in a low-oxygen or anaerobic environment, such as in the gut.
  • P. aeruginosa the anaerobic regulation of arginine deiminase and nitrate reduction (ANR) transcriptional regulator is "required for the expression of physiological functions which are inducible under oxygen-limiting or anaerobic conditions" (Winteler et al., 1996; Sawers 1991).
  • P. aeruginosa ANR is homologous with E. coli FNR, and "the consensus FNR site (TTGAT— ATCAA) was recognized efficiently by ANR and FNR" (Winteler et al., 1996).
  • TGAT— ATCAA consensus FNR site
  • Pseudomonas fluorescens, Pseudomonas putida, Pseudomonas syringae, and Pseudomonas mendocina all have functional analogs of ANR (Zimmermann et al., 1991). Promoters that are regulated by ANR are known in the art, e.g., the promoter of the arcDABC operon (see, e.g., Hasegawa et al., 1998).
  • the FNR family also includes the dissimilatory nitrate respiration regulator (DNR) (Arai et al., 1995), a transcriptional regulator which is required in conjunction with ANR for "anaerobic nitrate respiration of Pseudomonas aeruginosa" (Hasegawa et al., 1998).
  • DNR dissimilatory nitrate respiration regulator
  • the FNR-binding motifs "are probably recognized only by DNR” (Hasegawa et al., 1998).
  • Any suitable transcriptional regulator that is controlled by exogenous environmental conditions and corresponding regulatory region may be used. Non-limiting examples include ArcA/B, ResD/E, NreA/B/C, and AirSR, and others are known in the art.
  • FNR promoter sequences are known in the art, and any suitable FNR promoter sequence(s) may be used in the genetically engineered bacteria of the invention. Any suitable FNR promoter(s) may be combined with any suitable PAL. Non-limiting FNR promoter sequences are provided in Table 3, and non-limiting PAL sequences are also provided herein.
  • the genetically engineered bacteria of the invention comprise one or more of: SEQ ID NO: 9, SEQ ID NO: 10, nirBl promoter (SEQ ID NO: 11), nirB2 promoter (SEQ ID NO: 12), nirB 3 promoter (SEQ ID NO: 13), ydfZ promoter (SEQ ID NO: 14), nirB promoter fused to a strong ribosome binding site (SEQ ID NO: 15), ydfZ promoter fused to a strong ribosome binding site (SEQ ID NO: 16), for S, an anaerobically induced small RNA gene (fiirSl promoter SEQ ID NO: 9 or fiirS2 promoter SEQ ID NO: 17), nirB promoter fused to a crp binding site (SEQ ID NO: 18), and frirS fused to a crp binding site (SEQ ID NO: 19).
  • genetically engineered bacteria comprise one or more nucleic acid sequence(s) which are is at least about 80%, at least about 85%, at least about 90%, at least about 95%, or at least about 99% homologous to the DNA sequence of SEQ ID NO: 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 or a functional fragment thereof.
  • Table 3 FNR Sequences
  • one or more PME(s), e.g., PAL are expressed under the control of an oxygen level-dependent promoter fused to a binding site for a transcriptional activator, e.g., CRP.
  • CRP cyclic AMP receptor protein or catabolite activator protein or CAP
  • CRP plays a major regulatory role in bacteria by repressing genes responsible for the uptake, metabolism, and assimilation of less favorable carbon sources when rapidly metabolizable carbohydrates, such as glucose, are present (Wu et al., 2015). This preference for glucose has been termed glucose repression, as well as carbon catabolite repression (Deutscher, 2008; Gorke and Stiilke, 2008).
  • PME e.g., PAL
  • expression is controlled by an oxygen level-dependent promoter fused to a CRP binding site.
  • PAL expression is controlled by an FNR promoter fused to a CRP binding site.
  • cyclic AMP binds to CRP when no glucose is present in the environment. This binding causes a conformational change in CRP, and allows CRP to bind tightly to its binding site. CRP binding then activates transcription of the PME gene, e.g., PAL gene, by recruiting RNA polymerase to the FNR promoter via direct protein-protein interactions.
  • cyclic AMP does not bind to CRP and a PME, e.g., PAL, gene transcription is repressed.
  • a PME e.g., PAL
  • an oxygen level-dependent promoter e.g., an FNR promoter fused to a binding site for a transcriptional activator is used to ensure that a PME, e.g., PAL, is not expressed under anaerobic conditions when sufficient amounts of glucose are present, e.g., by adding glucose to growth media in vitro.
  • one or more PME(s), e.g., LAAD is expressed under the control of an inducible promoter fused to a binding site for a transcriptional activator, e.g., CRP, such that expression is repressed in the presence of glucose.
  • a transcriptional activator e.g., CRP
  • LAAD is under the control of an FNR promoter. In some embodiments, LAAD is under the control of promoter that not the FNR promoter. LAAD requires oxygen to catalyze the degradation of phenylalanine to phenylpyruvate. Therefore, it is desirable to induce LAAD expression under oxygenated, or even in reduced oxygen conditions where it be active (Fig. 25).
  • one or more PME(s), e.g., PAL and/or LAAD, are expressed under the control of an inducible promoter that is responsive to specific molecules or metabolites in the environment, e.g., the mammalian gut.
  • the short-chain fatty acid propionate is a major microbial fermentation metabolite localized to the gut (Hosseini et al., 2011).
  • expression of one or more PME genes is under the control of a propionate-inducible promoter.
  • PME gene expression is under the control of one or more propionate-inducible promoter(s) that is activated by the presence of propionate in the mammalian gut.
  • Non-limiting examples include propionate, bilirubin, aspartate aminotransferase, alanine
  • PME e.g., PAL and/or LAAD
  • gene expression is under the control of a P ar aBAD promoter, which is activated in the presence of the sugar arabinose.
  • LAAD expression is under the control of the ParaBAD promoter.
  • expression of LAAD occurs under aerobic or microaerobic conditions.
  • PAL expression is under the control of the ParaBAD promoter.
  • PAL expression occurs under aerobic or microaerobic conditions.
  • PAL expression occurs under anaerobic or low oxygen conditions and LADD expression occurs under aerobic or microaerobic conditions.
  • PAL expression occurs under anaerobic or low oxygen conditions and LADD expression is under the control of the ParaBAD promoter.
  • the one or more PME genes are expressed under the control of a promoter that is induced by exposure to a chemical and/or nutritional inducer.
  • the one or more PME genes, e.g., PAL and/or LAAD gene are expressed under the control of a promoter that is induced by exposure to tetracycline.
  • the one or more PME genes, e.g., PAL and/or LAAD gene are expressed under the control of a promoter that is induced by exposure to arabinose.
  • the one or more PME genes are expressed under the control of a promoter that is induced by exposure to IPTG or other Lacl inducer.
  • the one or more PME genes, e.g., PAL and/or LAAD gene are expressed under the control of a promoter that is induced by exposure to rhamnose.
  • the one or more PME genes, e.g., PAL and/or LAAD gene are expressed under the control of a promoter that is induced by exposure to teracycline.
  • more than one PME gene is expressed, e.g., PAL and LAAD gene, and each gene is expressed under the control of different promoters, such as any of the promoters discussed in this paragraph and elsewhere herein.
  • the one or more PME genes e.g., PAL and/or LAAD gene are expressed under the control of a promoter that is induced by a change in temperature from a non-permissive temperature to a permissive temperature.
  • gene expression is further optimized by methods known in the art, e.g., by optimizing ribosomal binding sites, manipulating transcriptional regulators, and/or increasing mRNA stability. Bioinformatics tools for the fine tuning and optimization of RBS are known in the art.
  • the engineered bacteria may additionally comprise gene sequence encoding one or more Phe transporter(s), which gene sequence(s) maye be under the control of any of the promoters discussed herein.
  • the genetically engineered bacteria comprise a stably maintained plasmid or chromosome carrying the PAL gene, such that PAL can be expressed in the host cell, and the host cell is capable of survival and/or growth in vitro, e.g., in medium, and/or in vivo, e.g., in the gut.
  • the genetically engineered bacteria comprise two or more distinct PAL genes.
  • the genetically engineered bacteria comprise multiple copies of the same PAL gene.
  • the PAL gene is present on a plasmid and operably linked to a directly or indirectly inducible promoter.
  • the PAL gene is present on a plasmid and operably linked to a promoter that is induced under low- oxygen or anaerobic conditions. In some embodiments, the PAL gene is present on a chromosome and operably linked to a directly or indirectly inducible promoter. In some embodiments, the PAL gene is present in the chromosome and operably linked to a promoter that is induced under low-oxygen or anaerobic conditions. In some embodiments, the PAL gene is present on a plasmid and operably linked to a promoter that is induced by exposure to tetracycline.
  • the PAL gene is present on a plasmid and operably linked to a promoter that is induced by exposure to arabinose. In some embodiments, the PAL gene is present on a plasmid and operably linked to a promoter that is induced by exposure to IPTG or another Lacl inducer. In some embodiments, the PAL gene is present on a plasmid and operably linked to a promoter that is induced by exposure to rhamnose. In some embodiments, the PAL gene is present on a plasmid and operably linked to a promoter that is induced by exposure to tetracycline.
  • the PAL gene is present on a plasmid and operably linked to a promoter that is induced by change in temperature from a non- permissive temperature to a permissive temperature. In some embodiments, the PAL gene is present on a chromosome and operably linked to a promoter that is induced by exposure to arabinose. In some embodiments, the PAL gene is present on a
  • the PAL gene is present on a chromosome and operably linked to a promoter that is induced by exposure to IPTG or another Lacl inducer.
  • the PAL gene is present on a chromosome and operably linked to a promoter that is induced by exposure to rhamnose.
  • the PAL gene is present on a chromosome and operably linked to a promoter that is induced by exposure to tetracycline.
  • the PAL gene is present on a chromosome and operably linked to a promoter that is induced by change in temperature from a non-permissive temperature to a permissive temperature.
  • the genetically engineered bacteria comprise a stably maintained plasmid or chromosome carrying the LAAD gene, such that LAAD can be expressed in the host cell, and the host cell is capable of survival and/or growth in vitro, e.g., in medium, and/or in vivo, e.g., in the gut.
  • the genetically engineered bacteria comprise two or more distinct LAAD genes.
  • the genetically engineered bacteria comprise multiple copies of the same LAAD gene.
  • the LAAD gene is present on a plasmid and operably linked to a directly or indirectly inducible promoter.
  • the LAAD gene is present on a plasmid and operably linked to a promoter that is inducible, e.g., by arabinose or tetracycline. In some embodiments, the LAAD gene is present on a chromosome and operably linked to a directly or indirectly inducible promoter. In some embodiments, the LAAD gene is present in the chromosome and operably linked to a promoter that is induced, e.g., by arabinose or tetracycline. In some embodiments, the LAAD gene is present on a plasmid and operably linked to a promoter that is induced by exposure to tetracycline.
  • the LAAD gene is present on a plasmid and operably linked to a promoter that is induced by exposure to arabinose. In some embodiments, the LAAD gene is present on a plasmid and operably linked to a promoter that is induced by exposure to IPTG or another Lacl inducer. In some embodiments, the LAAD gene is present on a plasmid and operably linked to a promoter that is induced by exposure to rhamnose. In some embodiments, the LAAD gene is present on a plasmid and operably linked to a promoter that is induced by change in temperature from a non-permissive temperature to a permissive temperature.
  • the LAAD gene is present on a plasmid and operably linked to a constitutive promoter. In some embodiments, the LAAD gene is present on a plasmid and operably linked to a promoter that is induced by exposure to tetracycline. In some embodiments, the LAAD gene is present on a chromosome and operably linked to a promoter that is induced by exposure to arabinose. In some embodiments, the LAAD gene is present on a chromosome and operably linked to a promoter that is induced by exposure to IPTG or another Lacl inducer. In some embodiments, the LAAD gene is present on a chromosome and operably linked to a promoter that is induced by exposure to rhamnose.
  • the LAAD gene is present on a chromosome and operably linked to a promoter that is induced by change in temperature from a non- permissive temperature to a permissive temperature. In some embodiments, the LAAD gene is present on a chromosome and operably linked to a constitutive promoter.
  • the bacteria may further comprise gene sequence encoding one or more Phe transporters, which Phe transporter gene sequence(s) may be present on a plasmid or chromosome, which may be the same or a different plasmid or chromosome from the location of the PME gene.
  • the Phe transporter gene sequence(s) may be under the control of the same or a different promoter from the PMR gene sequence(s).
  • the genetically engineered bacteria comprise an oxygen-level dependent transcriptional regulator, e.g., F R, A R, or D R, and corresponding promoter from a different bacterial species.
  • the non-native oxygen-level dependent transcriptional regulator and promoter increase the transcription of genes operably linked to said promoter, e.g., PAL or PAH, in a low-oxygen or anaerobic environment, as compared to the native transcriptional regulator and promoter in the bacteria under the same conditions.
  • the non-native oxygen- level dependent transcriptional regulator is an FNR protein from N. gonorrhoeae (see, e.g., Isabella et al., 2011).
  • the corresponding wild-type transcriptional regulator is left intact and retains wild-type activity.
  • the corresponding wild-type transcriptional regulator is deleted or mutated to reduce or eliminate wild-type activity.
  • the genetically engineered bacteria comprise a wild-type oxygen-level dependent transcriptional regulator, e.g., FNR, ANR, or DNR, and corresponding promoter that is mutated relative to the wild-type promoter from bacteria of the same subtype.
  • the mutated promoter enhances binding to the wild-type transcriptional regulator and increases the transcription of genes operably linked to said promoter, e.g., PAL or PAH, in a low-oxygen or anaerobic environment, as compared to the wild-type promoter under the same conditions.
  • the genetically engineered bacteria comprise a wild-type oxygen-level dependent promoter, e.g., FNR, ANR, or DNR promoter, and corresponding transcriptional regulator that is mutated relative to the wild-type transcriptional regulator from bacteria of the same subtype.
  • the mutated transcriptional regulator enhances binding to the wild-type promoter and increases the transcription of genes operably linked to said promoter, e.g., PAL or PAH, in a low-oxygen or anaerobic environment, as compared to the wild-type transcriptional regulator under the same conditions.
  • the mutant oxygen-level dependent transcriptional regulator is an FNR protein comprising amino acid substitutions that enhance dimerization and FNR activity (see, e.g., Moore et al., 2006).
  • the genetically engineered bacteria of the invention comprise multiple copies of the endogenous gene encoding the oxygen level- sensing transcriptional regulator, e.g., the FNR gene.
  • the gene encoding the oxygen level-sensing transcriptional regulator is present on a plasmid.
  • the gene encoding the oxygen level-sensing transcriptional regulator and the gene encoding PAL are present on different plasmids.
  • the gene encoding the oxygen level-sensing transcriptional regulator and the gene encoding PAL are present on the same plasmid.
  • the gene encoding the oxygen level-sensing transcriptional regulator is present on a chromosome.
  • the gene encoding the oxygen level-sensing transcriptional regulator and the gene encoding PAL are present on different chromosomes. In some embodiments, the gene encoding the oxygen level-sensing transcriptional regulator and the gene encoding PAL are present on the same chromosome. In some instances, it may be advantageous to express the oxygen level- sensing transcriptional regulator under the control of an inducible promoter in order to enhance expression stability. In some embodiments, expression of the transcriptional regulator is controlled by a different promoter than the promoter that controls expression of the gene encoding the phenylalanine-metabolizing enzyme. In some embodiments, expression of the transcriptional regulator is controlled by the same promoter that controls expression of the phenylalanine-metabolizing enzyme. In some embodiments, the transcriptional regulator and the phenylalanine-metabolizing enzyme are divergently transcribed from a promoter region.
  • the genetically engineered bacteria of the invention produce PAL under exogenous environmental conditions, such as the low- oxygen environment of the mammalian gut, to reduce blood phenylalanine by at least about 1.5-fold, at least about 2-fold, at least about 3-fold, at least about 4-fold, at least about 5-fold, at least about 6-fold, at least about 7-fold, at least about 8-fold, at least about 9-fold, at least about 10-fold, at least about 15-fold, at least about 20-fold, at least about 30-fold, at least about 40-fold, or at least about 50-fold as compared to unmodified bacteria of the same subtype under the same conditions.
  • exogenous environmental conditions such as the low- oxygen environment of the mammalian gut
  • the genetically engineered bacteria of the invention produce PAL under exogenous environmental conditions, such as the low-oxygen environment of the mammalian gut, and increase hippuric acid in the urine by at least about 1.5-fold, at least about 2-fold, at least about 3-fold, at least about 4-fold, at least about 5-fold, at least about 6-fold, at least about 7-fold, at least about 8-fold, at least about 9-fold, at least about 10-fold, at least about 15-fold, at least about 20-fold, at least about 30-fold, at least about 40-fold, or at least about 50-fold as compared to unmodified bacteria of the same subtype under the same conditions. Certain unmodified bacteria will not have appreciable levels of phenylalanine processing to hippurate. In embodiments using genetically modified forms of these bacteria, PAL-mediated processing of
  • phenylalanine will be appreciable under exogenous environmental conditions.
  • the genetically engineered bacteria of the invention produce PAL under exogenous environmental conditions, such as under bacterial culture conditions in vitro, and increase transcinnamic acid in the media by at least about 1.5-fold, at least about 2-fold, at least about 3-fold, at least about 4-fold, at least about 5-fold, at least about 6-fold, at least about 7-fold, at least about 8-fold, at least about 9-fold, at least about 10-fold, at least about 15-fold, at least about 20-fold, at least about 30-fold, at least about 40-fold, or at least about 50-fold as compared to unmodified bacteria of the same subtype under the same conditions.
  • Phenylalanine may be measured by methods known in the art, e.g.
  • cinnamate is measured by methods known in the art to assess PAL activity. Cinnamate production is directly correlated with phenylalanine degradation, and in some embodiments, that cinnamate may be used as an alternative biomarker for strain activity (Fig. 16B). Cinnamate can be further degraded to hippuric acid by liver enzymes; both can be measured as described in Example 24-26. As shown herein, TCA is rapidly converted to hippuric acid in vivo, and hippuric acid
  • hippurate in blood and in particular in the urine, may be an even better biomarker for phenylalanine degradation in vivo.
  • PAL expression is measured by methods known in the art, e.g., measurement of blood phenylalanine levels.
  • Hippuric acid may be measured according to methods described herein in the Examples, and methods known in the art.
  • the genetically engineered bacteria of the invention produce LAAD, to reduce blood phenylalanine by at least about 1.5-fold, at least about 2-fold, at least about 3-fold, at least about 4-fold, at least about 5-fold, at least about 6-fold, at least about 7-fold, at least about 8-fold, at least about 9-fold, at least about 10-fold, at least about 15-fold, at least about 20-fold, at least about 30-fold, at least about 40-fold, or at least about 50-fold as compared to unmodified bacteria of the same subtype under the same conditions. Certain unmodified bacteria will not have appreciable levels of phenylalanine processing.
  • LAAD-mediated processing of phenylalanine will be appreciable under exogenous environmental conditions.
  • Phenylalanine may be measured by methods known in the art, e.g., blood sampling and mass spectrometry. Pyruvic acid and phenylpyruvate, the LAAD generated degradation products can be measured using masspectrometry as described in Examples 24-26, and can be used as an additional readout of LAAD activity.
  • the genetically engineered bacteria of the invention produce more than one PME, e.g., PAL, PAH, and/or LAAD, under exogenous environmental conditions, such as in vivo or under bacterial culture conditions in vitro, and reduce blood phenylalanine and/or increase transcinnamic acid in the media by at least about 1.5-fold, at least about 2-fold, at least about 3-fold, at least about 4-fold, at least about 5-fold, at least about 6-fold, at least about 7-fold, at least about 8-fold, at least about 9-fold, at least about 10-fold, at least about 15-fold, at least about 20-fold, at least about 30-fold, at least about 40-fold, or at least about 50-fold as compared to unmodified bacteria of the same subtype under the same conditions.
  • the bacteris amy further comprise gene sequence(s) encoding one or more Phe transporter polypeptides.
  • one or more PME(s), e.g., PAL, LAAD, and/or PAH are expressed on a low-copy plasmid.
  • the low-copy plasmid may be useful for increasing stability of expression.
  • the low-copy plasmid may be useful for decreasing leaky expression under non-inducing conditions.
  • one or more PME(s), e.g., PAL, LAAD, and/or PAH are expressed on a high-copy plasmid.
  • the high-copy plasmid may be useful for increasing the PME, e.g., PAL, LAAD, and/or PAH, expression, thereby increasing the metabolism of phenylalanine and reducing
  • a genetically engineered bacterium comprising a the PME, e.g., PAL, LAAD, and/or PAH, expressed on a high-copy plasmid does not increase phenylalanine metabolism or decrease phenylalanine levels as compared to a genetically engineered bacterium comprising the same PME, e.g., PAL, LAAD, and/or PAH, expressed on a low-copy plasmid in the absence of heterologous pheP and additional copies of a native pheP.
  • Genetically engineered bacteria comprising the same the PME gene(s), e.g., PAL, LAAD, and/or PAH gene(s) on high and low copy plasmids were generated.
  • PME gene(s) e.g., PAL, LAAD, and/or PAH gene(s) on high and low copy plasmids
  • PALI or PAL3 on a high- copy plasmid and a low-copy plasmid were generated, and each metabolized and reduced phenylalanine to similar levels (Fig. 15).
  • the rate- limiting step of phenylalanine metabolism is phenylalanine availability (see, e.g., Fig. 16).
  • low-copy PAL plasmids are capable of almost completely eliminating Phe from a test sample (see, e.g., Fig. 16A).
  • a low-copy PAL-expressing plasmid in conjunction with the high-copy plasmid.
  • the phenylalanine transporter is used in conjunction with the high-copy plasmid.
  • a transporter may not increase phenylalanine degradation.
  • Proteus mirabilis LAAD is localized to the plasma membrane, with the enzymatic catalysis occurring in the periplasm. Phenylalanine can readily traverse the outer membrane without the need of a transporter. Therefore, in embodiments, in which the genetically engineered bacteria express LAAD, a transporter may not be needed or improve phenylalanine metabolism.
  • the PME(s), e.g., PAL, LAAD, and /or PAH, gene(s) are expressed on a chromosome.
  • expression from the chromosome may be useful for increasing stability of expression of the PME.
  • the PME gene, e.g., PAL, LAAD, and /or PAH gene(s) is integrated into the bacterial chromosome at one or more integration sites in the genetically engineered bacteria.
  • the PME gene, e.g., PAL, LAAD, and /or PAH gene(s) is inserted into the bacterial genome at one or more of the following insertion sites in E.
  • coli Nissle malE/K, insB/I, araC/BAD, lacZ, agal/rsml, thyA, and malP/T.
  • Any suitable insertion site may be used (see, e.g., Fig. 66).
  • the insertion site may be anywhere in the genome, e.g., in a gene required for survival and/or growth, such as thyA (to create an auxotroph); in an active area of the genome, such as near the site of genome replication; and/or in between divergent promoters in order to reduce the risk of unintended transcription, such as between AraB and AraC of the arabinose operon.
  • more than one copy e.g., two, three, four, five, six, seven, eight, nine, ten or more copies of the PME gene, e.g., PAL, PAH, and/or LAAD is integrated into the bacterial chromosome at one or more integration sites in the genetically engineered bacteria.
  • the more than one copy of a PME gene may be more than one copy of the same PME gene or more than one copy of different PME genes.
  • Exemplary constructs are shown in 4-13 below.
  • Table 4 shows the sequence of an exemplary construct comprising a gene encoding PheP and an F R promoter sequence for chromosomal insertion (SEQ ID NO: 21), with the pheP sequence underlined and the FNR promoter sequence bolded.
  • Table 5 shows the sequence of an exemplary construct comprising a gene encoding PALI and an FNR promoter sequence on a high-copy plasmid (SEQ ID NO: 22), with the PALI sequence underlined and the FNR promoter sequence bolded.
  • Table 6 shows the sequence of an exemplary construct comprising a gene encoding PAL3 and an FNR promoter sequence on a high-copy plasmid (SEQ ID NO: 23), with the PAL3 sequence underlined and the FNR promoter sequence bolded.
  • Table 7 shows the sequence of an exemplary construct comprising a gene encoding PALI and a Tet promoter sequence on a high- copy plasmid (SEQ ID NO: 24), with the PALI sequence underlined and the Tet promoter sequence bolded.
  • Table 8 shows the sequence of an exemplary construct comprising a gene encoding PAL3 and a Tet promoter sequence on a high-copy plasmid (SEQ ID NO: 25), with the PAL3 sequence underlined and the Tet promoter sequence bolded.
  • Table 9 shows the sequence of an exemplary construct comprising a gene encoding PALI and an FNR promoter sequence on a low-copy plasmid (SEQ ID NO: 26), with the PALI sequence underlined and the FNR promoter sequence bolded.
  • Table 10 shows the sequence of an exemplary construct comprising a gene encoding PAL3 and an FNR promoter sequence on a low-copy plasmid (SEQ ID NO: 27), with the PAL3 sequence underlined and the FNR promoter sequence bolded.
  • Table 11 shows the sequence of an exemplary construct comprising a gene encoding PALI and a Tet promoter sequence on a low-copy plasmid (SEQ ID NO: 28), with the PALI sequence underlined and the Tet promoter sequence bolded.
  • Table 12 shows the sequence of an exemplary construct comprising a gene encoding PAL3 and a Tet promoter sequence on a low-copy plasmid (SEQ ID NO: 29), with the PAL3 sequence underlined and the Tet promoter sequence bolded.
  • Table 13 shows the sequence of an exemplary construct comprising a gene encoding PheP, a gene coding TetR, and a Tet promoter sequence for chromosomal insertion (SEQ ID NO: 30), with the pheP sequence underlined, the TetR sequence

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • General Health & Medical Sciences (AREA)
  • Zoology (AREA)
  • Wood Science & Technology (AREA)
  • Genetics & Genomics (AREA)
  • Medicinal Chemistry (AREA)
  • Biochemistry (AREA)
  • Microbiology (AREA)
  • Molecular Biology (AREA)
  • General Engineering & Computer Science (AREA)
  • Biotechnology (AREA)
  • Veterinary Medicine (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Mycology (AREA)
  • Biomedical Technology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Epidemiology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Biophysics (AREA)
  • Diabetes (AREA)
  • Hematology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Physics & Mathematics (AREA)
  • Immunology (AREA)
  • Analytical Chemistry (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Investigating Or Analysing Biological Materials (AREA)
  • Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
  • Coloring Foods And Improving Nutritive Qualities (AREA)
PCT/US2016/062369 2015-11-16 2016-11-16 Bacteria engineered to reduce hyperphenylalaninemia Ceased WO2017087580A1 (en)

Priority Applications (14)

Application Number Priority Date Filing Date Title
JP2018526505A JP6993970B2 (ja) 2015-11-16 2016-11-16 高フェニルアラニン血症を低減させるように操作された細菌
US15/775,936 US11618894B2 (en) 2015-11-16 2016-11-16 Bacteria engineered to reduce hyperphenylalaninemia
EP16810138.4A EP3377518B1 (en) 2015-11-16 2016-11-16 Bacteria engineered to reduce hyperphenylalaninemia
EP22167588.7A EP4095150A1 (en) 2015-11-16 2016-11-16 Bacteria engineered to reduce hyperphenylalaninemia
PL16810138.4T PL3377518T3 (pl) 2015-11-16 2016-11-16 Bakterie modyfikowane do celów zmniejszenia hiperfenyloalaninemii
ES16810138T ES2925049T3 (es) 2015-11-16 2016-11-16 Bacterias manipuladas para reducir la hiperfenilalaninemia
AU2016356684A AU2016356684C1 (en) 2015-11-16 2016-11-16 Bacteria engineered to reduce hyperphenylalaninemia
CA3005451A CA3005451C (en) 2015-11-16 2016-11-16 Bacteria engineered to reduce hyperphenylalaninemia
US16/069,199 US20190282628A1 (en) 2016-01-11 2017-01-11 Recombinant bacteria engineered to treat diseases and disorders associated with amino acid metabolism and methods of use thereof
PCT/US2017/013074 WO2017123676A1 (en) 2016-01-11 2017-01-11 Recombinant bacteria engineered to treat diseases and disorders associated with amino acid metabolism and methods of use thereof
JP2021200761A JP7245312B2 (ja) 2015-11-16 2021-12-10 高フェニルアラニン血症を低減させるように操作された細菌
AU2022201838A AU2022201838B2 (en) 2015-11-16 2022-03-16 Bacteria engineered to reduce hyperphenylalaninemia
US18/068,004 US20240076645A1 (en) 2015-11-16 2022-12-19 Bacteria engineered to reduce hyperphenylalaninemia
AU2025202726A AU2025202726A1 (en) 2015-11-16 2025-04-17 Bacteria engineered to reduce hyperphenylalaninemia

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US201562256052P 2015-11-16 2015-11-16
US62/256,052 2015-11-16
PCT/US2016/032562 WO2016183531A1 (en) 2015-05-13 2016-05-13 Bacteria engineered to reduce hyperphenylalaninemia
USPCT/US2016/032562 2016-05-13

Related Parent Applications (2)

Application Number Title Priority Date Filing Date
PCT/US2016/032562 Continuation-In-Part WO2016183531A1 (en) 2014-12-05 2016-05-13 Bacteria engineered to reduce hyperphenylalaninemia
US15/260,319 Continuation-In-Part US11384359B2 (en) 2014-12-22 2016-09-08 Bacteria engineered to treat diseases that benefit from reduced gut inflammation and/or tightened gut mucosal barrier

Related Child Applications (3)

Application Number Title Priority Date Filing Date
US15/775,936 A-371-Of-International US11618894B2 (en) 2015-11-16 2016-11-16 Bacteria engineered to reduce hyperphenylalaninemia
PCT/US2016/069052 Continuation-In-Part WO2017123418A1 (en) 2016-01-11 2016-12-28 Bacteria engineered to treat metabolic diseases
US18/068,004 Continuation US20240076645A1 (en) 2015-11-16 2022-12-19 Bacteria engineered to reduce hyperphenylalaninemia

Publications (1)

Publication Number Publication Date
WO2017087580A1 true WO2017087580A1 (en) 2017-05-26

Family

ID=58717781

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2016/062369 Ceased WO2017087580A1 (en) 2015-11-16 2016-11-16 Bacteria engineered to reduce hyperphenylalaninemia

Country Status (7)

Country Link
US (2) US11618894B2 (https=)
EP (2) EP4095150A1 (https=)
JP (4) JP6993970B2 (https=)
AU (3) AU2016356684C1 (https=)
ES (1) ES2925049T3 (https=)
PL (1) PL3377518T3 (https=)
WO (1) WO2017087580A1 (https=)

Cited By (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2018237198A1 (en) 2017-06-21 2018-12-27 Synlogic Operating Company, Inc. BACTERIA FOR THE TREATMENT OF DISORDERS
CN110643585A (zh) * 2019-11-08 2020-01-03 江南大学 一种利用氨基酸脱氨酶生产α-酮-β-甲基正戊酸的方法
WO2020223345A1 (en) 2019-04-29 2020-11-05 Antipov Eugene Enumeration of genetically engineered microorganisms by live cell counting techniques
WO2020247594A1 (en) 2019-06-04 2020-12-10 Cocoon Biotech Inc. Silk-based products, formulations, and methods of use
WO2022120028A2 (en) 2020-12-02 2022-06-09 Synlogic Operating Company, Inc. Engineered microorganisms
WO2022148362A1 (zh) * 2021-01-07 2022-07-14 上海陶宇晟生物技术有限责任公司 具备表面展示苯丙氨酸解氨酶的工程益生菌

Families Citing this family (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
ES2881384T3 (es) 2015-05-13 2021-11-29 Synlogic Operating Co Inc Bacterias manipuladas para reducir la hiperfenilalaninemia
ES2925049T3 (es) * 2015-11-16 2022-10-13 Synlogic Operating Co Inc Bacterias manipuladas para reducir la hiperfenilalaninemia
US20220268782A1 (en) * 2019-07-15 2022-08-25 Inserm (Institut National De La Santé Eat De La Recherche Médicale) Methods for predicting and treating cardiac dysfunction
CN113493796B (zh) * 2020-03-18 2023-05-30 苏州优信合生技术有限公司 苯丙酮尿症治疗用益生菌工程菌株的构建方法与应用
BR112022018571A2 (pt) 2020-03-20 2022-11-01 Synlogic Operating Co Inc Microrganismos manipulados para reduzir a hiperfenilalaninemia
CN113755516B (zh) * 2020-06-05 2026-03-20 中国医学科学院药物研究所 工程粪肠球菌在治疗苯丙酮尿症药物中的应用
US20220031771A1 (en) * 2020-07-31 2022-02-03 Iowa State University Research Foundation, Inc. Microencapsulated and chromosome integrated compositions for l-dopa microbiome therapy
WO2023044479A1 (en) * 2021-09-17 2023-03-23 Synlogic Operating Company, Inc. Methods for reducing hyperphenylalaninemia
CN113969292B (zh) * 2021-11-15 2023-07-07 山东第一医科大学(山东省医学科学院) 治疗苯丙酮尿症的工程益生菌及其构建方法与应用

Citations (16)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5589168A (en) 1991-04-08 1996-12-31 Unilever Patent Holdings B.V. Probiotic
US5989463A (en) 1997-09-24 1999-11-23 Alkermes Controlled Therapeutics, Inc. Methods for fabricating polymer-based controlled release devices
US6203797B1 (en) 1998-01-06 2001-03-20 Stephen C. Perry Dietary supplement and method for use as a probiotic, for alleviating the symptons associated with irritable bowel syndrome
US20030166191A1 (en) 1998-12-02 2003-09-04 Timothy Gardner Bistable genetic toggle switch
US6835376B1 (en) 1999-03-11 2004-12-28 Nestec S.A. Lactobacillus paracasei strain for preventing diarrhea caused by pathogenic bacteria
WO2009004595A2 (en) * 2007-07-05 2009-01-08 North-West University Enhancement of the efficacy of therapeutic proteins
US7731976B2 (en) 2003-08-29 2010-06-08 Cobb And Company, Llp Treatment of irritable bowel syndrome using probiotic composition
WO2013192543A2 (en) * 2012-06-22 2013-12-27 Phytogene, Inc. Enzymes and methods for styrene synthesis
US20140079701A1 (en) 2010-12-23 2014-03-20 Biogen Idec Ma Inc. Linker peptides and polypeptides comprising same
WO2014066945A1 (en) * 2012-11-01 2014-05-08 The Sydney Children's Hospital Network (Randwick & Westmead) Genetically-modified probiotic for treatment of phenylketonuria
WO2014138324A1 (en) 2013-03-07 2014-09-12 The General Hospital Corporation Compositions and methods for bacterial delivery of polypeptides
US20150238545A1 (en) 2000-07-25 2015-08-27 Thomas Julius Borody Probiotic recolonisation therapy
US20150359894A1 (en) 2006-09-27 2015-12-17 Little Calumet Holdings, Llc Probiotic oral dosage forms
WO2016183532A1 (en) * 2015-05-13 2016-11-17 Synlogic, Inc. Bacteria engineered to treat a disease or disorder
WO2016183531A1 (en) * 2015-05-13 2016-11-17 Synlogic, Inc. Bacteria engineered to reduce hyperphenylalaninemia
WO2016210373A2 (en) * 2015-06-24 2016-12-29 Synlogic, Inc. Recombinant bacteria engineered for biosafety, pharmaceutical compositions, and methods of use thereof

Family Cites Families (23)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN1154845A (zh) 1996-09-09 1997-07-23 首都医学院附属北京红十字朝阳医院 能表达活性苯丙氨酸脱氨酶的基因工程菌口服制剂
DK1383897T3 (da) 2001-05-03 2006-10-30 Vlaams Interuniv Inst Biotech Selv-containing Lactococcus-stamme
US7314974B2 (en) * 2002-02-21 2008-01-01 Monsanto Technology, Llc Expression of microbial proteins in plants for production of plants with improved properties
JP4452914B2 (ja) 2003-09-08 2010-04-21 味の素株式会社 新規トランスポータタンパク質
EP2080769A3 (en) * 2004-07-02 2010-12-01 Metanomics GmbH Process for the production of fine chemicals
GB0501540D0 (en) 2005-01-25 2005-03-02 Univ Leeds Controlled production and delivery of biologically active agents by gut bacteria
EP2886658A1 (en) * 2005-03-10 2015-06-24 BASF Enzymes LLC Lyase enzymes, nucleic acids encoding them and methods for making and using them
WO2008118176A2 (en) 2006-06-02 2008-10-02 Verenium Corporation Lase enzymes, nucleic acids encoding them and methods for making and using them
TW200819540A (en) 2006-07-11 2008-05-01 Genelux Corp Methods and compositions for detection of microorganisms and cells and treatment of diseases and disorders
CN101586111B (zh) 2008-05-22 2012-03-07 北京三元基因工程有限公司 一种活性乳酸乳球菌制品的制备方法
EP3181682B1 (en) 2008-09-29 2021-04-21 Intrexon Actobiotics NV Reduced colonization of microbes at the mucosa
BR112012022054A2 (pt) 2010-03-02 2015-09-15 Functional Technologies Corp microorganismo transformado, método de redução de asparagina durante o preparo ou processamento de alimento, médtodo de redução de acrilamidia em um produto alimentício, e, produto alimentício
US8129170B1 (en) 2010-12-06 2012-03-06 E.I. Du Pont De Nemours And Company Recombinant bacteria having the ability to metabolize sucrose
US9017961B2 (en) 2012-03-05 2015-04-28 E.I. Du Pont De Nemours And Company Recombinant bacteria comprising novel sucrose transporters
FR2990699B1 (fr) 2012-05-21 2016-02-05 Agronomique Inst Nat Rech Cassettes d'expression procaryotes regulees par le stress
AU2013295621A1 (en) 2012-07-27 2015-03-12 University Of North Texas Genetically modified probiotic for the treatment of phenylketonuria (PKU) disease
CN105144204B (zh) 2012-12-13 2018-02-27 麻省理工学院 基于重组酶的逻辑与存储系统
US9688967B2 (en) * 2014-12-05 2017-06-27 Synlogic, Inc. Bacteria engineered to treat diseases associated with hyperammonemia
AU2016276973B2 (en) * 2015-06-10 2022-09-01 Synlogic Operating Company, Inc. Bacteria engineered to treat disorders involving the catabolism of a branched chain amino acid
US20170216370A1 (en) * 2015-07-31 2017-08-03 Synlogic, Inc. Bacteria engineered to treat disorders involving propionate catabolism
ES2925049T3 (es) * 2015-11-16 2022-10-13 Synlogic Operating Co Inc Bacterias manipuladas para reducir la hiperfenilalaninemia
CN110709095B (zh) * 2017-04-05 2024-05-03 马萨诸塞大学 小基因治疗
SK289101B6 (sk) * 2020-12-17 2023-08-09 Ústav molekulárnej biológie Slovenskej akadémie vied, verejná výskumná inštitúcia Antimikrobiálny proteín, antimikrobiálny rekombinantný proteín s lytickými vlastnosťami, expresný vektor, spôsob ich prípravy a použitie

Patent Citations (16)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5589168A (en) 1991-04-08 1996-12-31 Unilever Patent Holdings B.V. Probiotic
US5989463A (en) 1997-09-24 1999-11-23 Alkermes Controlled Therapeutics, Inc. Methods for fabricating polymer-based controlled release devices
US6203797B1 (en) 1998-01-06 2001-03-20 Stephen C. Perry Dietary supplement and method for use as a probiotic, for alleviating the symptons associated with irritable bowel syndrome
US20030166191A1 (en) 1998-12-02 2003-09-04 Timothy Gardner Bistable genetic toggle switch
US6835376B1 (en) 1999-03-11 2004-12-28 Nestec S.A. Lactobacillus paracasei strain for preventing diarrhea caused by pathogenic bacteria
US20150238545A1 (en) 2000-07-25 2015-08-27 Thomas Julius Borody Probiotic recolonisation therapy
US7731976B2 (en) 2003-08-29 2010-06-08 Cobb And Company, Llp Treatment of irritable bowel syndrome using probiotic composition
US20150359894A1 (en) 2006-09-27 2015-12-17 Little Calumet Holdings, Llc Probiotic oral dosage forms
WO2009004595A2 (en) * 2007-07-05 2009-01-08 North-West University Enhancement of the efficacy of therapeutic proteins
US20140079701A1 (en) 2010-12-23 2014-03-20 Biogen Idec Ma Inc. Linker peptides and polypeptides comprising same
WO2013192543A2 (en) * 2012-06-22 2013-12-27 Phytogene, Inc. Enzymes and methods for styrene synthesis
WO2014066945A1 (en) * 2012-11-01 2014-05-08 The Sydney Children's Hospital Network (Randwick & Westmead) Genetically-modified probiotic for treatment of phenylketonuria
WO2014138324A1 (en) 2013-03-07 2014-09-12 The General Hospital Corporation Compositions and methods for bacterial delivery of polypeptides
WO2016183532A1 (en) * 2015-05-13 2016-11-17 Synlogic, Inc. Bacteria engineered to treat a disease or disorder
WO2016183531A1 (en) * 2015-05-13 2016-11-17 Synlogic, Inc. Bacteria engineered to reduce hyperphenylalaninemia
WO2016210373A2 (en) * 2015-06-24 2016-12-29 Synlogic, Inc. Recombinant bacteria engineered for biosafety, pharmaceutical compositions, and methods of use thereof

Non-Patent Citations (102)

* Cited by examiner, † Cited by third party
Title
"Remington's Pharmaceutical Sciences, 22nd ed.", 2012, MACK PUBLISHING CO,
A. GENNARO: "Remington's Pharmaceutical Sciences", MACK PUBLISHING CO.
A1 HAFID N; CHRISTODOULOU J: "Phenylketonuria: a review of current and future treatments", TRANSL PEDIATR., vol. 4, no. 4, October 2015 (2015-10-01), pages 304 - 317
ALBENBERG ET AL., GASTROENTEROLOGY, vol. 147, no. 5, 2014, pages 1055 - 1063
ALTENHOEFER ET AL.: "The probiotic Escherichia coli strain Nissle 1917 interferes with invasion of human intestinal epithelial cells by different enteroinvasive bacterial pathogens", FEMS IMMUNOL MED MICROBIOL., vol. 40, no. 3, 9 April 2004 (2004-04-09), pages 223 - 229, XP002492185, DOI: doi:10.1016/S0928-8244(03)00368-7
ANDERSEN ET AL.: "Uracil uptake in Escherichia coli K-12: isolation of uraA mutants and cloning of the gene", J BACTERIOL., vol. 177, no. 8, April 1995 (1995-04-01), pages 2008 - 2013, XP002341974
ARAI ET AL.: "Expression of the nir and nor genes for denitrification of Pseudomonas aeruginosa requires a novel CRP/FNR-related transcriptional regulator, DNR, in addition to ANR", FEBS LETT., vol. 371, no. 1, 28 August 1995 (1995-08-28), pages 73 - 76
ARGOS, EMBO J., vol. 8, 1989, pages 779 - 785
ARTHUR ET AL.: "Intestinal inflammation targets cancer-inducing activity of the microbiota", SCIENCE, vol. 338, no. 6103, 5 October 2012 (2012-10-05), pages 120 - 123
BAEK ET AL., JOURNAL OF BASIC MICROBIOLOGY, vol. 51, 2011, pages 129 - 135
BERGOFSKY ET AL., J CLIN. INVEST., vol. 41, no. 11, 1962, pages 1971 - 1980
CALLURA ET AL.: "Tracking, Tuning and terminating microbial physiology using synthetic riboregulators", PROC NATL ACAD SCI USA., vol. 27, no. 36, 2010, pages 15898 - 15903, XP055286282, DOI: doi:10.1073/pnas.1009747107
CASTIGLIONE ET AL.: "The transcription factor DNR from Pseudomonas aeruginosa specifically requires nitric oxide and haem for the activation of a target promoter in Escherichia coli", MICROBIOLOGY, vol. 155, September 2009 (2009-09-01), pages 2838 - 2844
CHANG ET AL.: "A new theory of enterorecirculation of amino acids and its use for depleting unwanted amino acids using oral enzyme-artificial cells, as in removing phenylalanine in phenylketonuria", ARTIF CELLS BLOOD SUBSTIT IMMOBIL BIOTECHNOL., vol. 23, no. 1, 1995, pages 1 - 21
CHANG,: "Artificial Cells: Biotechnology, Nanomedicine, Regenerative Medicine, Blood Substitutes, Bioencapsulation, and Cell/Stem Cell Therapy", 2007, WORLD SCIENTIFIC PUBLISHING, article "Use of Enzyme Artificial Cells for Genetic Enzyme Defects", pages: 147 - 159
CHEN ET AL.: "Incorporation of therapeutically modified bacteria into gut microbiota inhibits obesity", J CLIN INVEST, vol. 124, no. 8, 2014, pages 3391 - 3406, XP002761847
CHRISTINEH N. SARKISSIAN ET AL: "Quantitation of phenylalanine and itstrans-cinnamic, benzoic and hippuric acid metabolites in biological fluids in a single GC-MS analysis", JOURNAL OF MASS SPECTROMETRY., vol. 42, no. 6, 1 June 2007 (2007-06-01), GB, pages 811 - 817, XP055348903, ISSN: 1076-5174, DOI: 10.1002/jms.1218 *
CLARKSON ET AL.: "Diaminopimelic acid and lysine auxotrophs of Pseudomonas aeruginosa 8602", J GEN MICROBIOL., vol. 66, no. 2, May 1971 (1971-05-01), pages 161 - 169
CROMPTON ET AL., J EXP. BIOL., vol. 43, 1965, pages 473 - 478
CUEVAS-RAMOS ET AL.: "Escherichia coli induces DNA damage in vivo and triggers genomic instability in mammalian cells", PROC NATL ACAD SCI USA., vol. 107, no. 25, 22 June 2010 (2010-06-22), pages 11537 - 11542, XP055063641, DOI: doi:10.1073/pnas.1001261107
DANINO ET AL.: "Programmable probiotics for detection of cancer in urine", SCI TRANSL MED., vol. 7, no. 289, 27 May 2015 (2015-05-27), pages 289RA84
DAYHOFF, M. O.,: "The Atlas of Protein Sequence and Structure 5", 1978, NATIONAL BIOMEDICAL RESEARCH FOUNDATION
DEUTSCHER: "The mechanisms of carbon catabolite repression in bacteria", CURR OPIN MICROBIOL., vol. 11, no. 2, April 2008 (2008-04-01), pages 87 - 93, XP022616728, DOI: doi:10.1016/j.mib.2008.02.007
DINLEYICI ET AL.: "Saccharomyces boulardii CNCM 1-745 in different clinical conditions", EXPERT OPIN BIOL THER., vol. 14, no. 11, November 2014 (2014-11-01), pages 1593 - 1609
DOBBELAERE ET AL.: "Evaluation of nutritional status and pathophysiology of growth retardation in patients with phenylketonuria", J INHERIT METAB DIS, vol. 26, no. 1, 2003, pages 1 - 11
DUAN ET AL.: "Secretion of Insulinotropic Proteins by Commensal Bacteria: Rewiring the Gut To Treat Diabetes", APPL. ENVIRON. MICROBIOL., vol. 74, no. 23, December 2008 (2008-12-01), pages 7437 - 7438, XP002632694, DOI: doi:10.1128/AEM.01019-08
EIGLMEIER ET AL.: "Molecular genetic analysis of FNR-dependent promoters", MOL MICROBIOL., vol. 3, no. 7, July 1989 (1989-07-01), pages 869 - 878, XP000607279, DOI: doi:10.1111/j.1365-2958.1989.tb00236.x
ESTREM ET AL.: "Identification of an UP element consensus sequence for bacterial promoters", PROC NATL ACAD SCI USA., vol. 95, no. 17, 18 August 1998 (1998-08-18), pages 9761 - 9766, XP002182863, DOI: doi:10.1073/pnas.95.17.9761
GALIMAND ET AL.: "Positive FNR-like control of anaerobic arginine degradation and nitrate respiration in Pseudomonas aeruginosa", J BACTERIOL., vol. 173, no. 5, March 1991 (1991-03-01), pages 1598 - 1606
GARDNER ET AL.: "Construction of a genetic toggle switch in Escherichia coli", NATURE, vol. 403, 2000, pages 339 - 342, XP002216760, DOI: doi:10.1038/35002131
GERDES ET AL.: "Essential genes on metabolic maps", CURR OPIN BIOTECHNOL, vol. 17, no. 5, 2006, pages 448 - 456, XP024962825, DOI: doi:10.1016/j.copbio.2006.08.006
GERDES ET AL.: "Essential genes on metabolic maps", CURR OPIN BIOTECHNOL., vol. 17, no. 5, October 2006 (2006-10-01), pages 448 - 456, XP024962825, DOI: doi:10.1016/j.copbio.2006.08.006
GILBERT ET AL.: "Molecular cloning of the phenylalanine ammonia lyase gene from Rhodosporidium toruloides in Escherichia coli K-12", J BACTERIOL., vol. 161, no. 1, January 1985 (1985-01-01), pages 314 - 320, XP001318242
GORKE B; STIILKE J: "Carbon catabolite repression in bacteria: many ways to make the most out of nutrients", NAT REV MICROBIOL, vol. 6, no. 8, August 2008 (2008-08-01), pages 613 - 624, XP009142600
GOSSEN M; BUJARD H., PN4S, vol. 89, no. 12, 15 June 1992 (1992-06-15), pages 5547 - 51
HASEGAWA ET AL.: "Activation of a consensus FNR-dependent promoter by DNR of Pseudomonas aeruginosa in response to nitrite", FEMS MICROBIOL LETT., vol. 166, no. 2, 15 September 1998 (1998-09-15), pages 213 - 217
HE ET AL., PNAS (USA, vol. 96, 1999, pages 4586 - 4591
HE ET AL.: "Noninvasive measurement of anatomic structure and intraluminal oxygenation in the gastrointestinal tract of living mice with spatial and spectral EPR imaging", PROC NATL ACAD SCI USA., vol. 96, no. 8, 13 April 1999 (1999-04-13), pages 4586 - 91
HOEKS ET AL.: "Adult issues in phenylketonuria", NETH J MED., vol. 67, no. 1, January 2009 (2009-01-01), pages 2 - 7
HOEREN ET AL.: "Sequence and expression of the gene encoding the respiratory nitrous-oxide reductase from Paracoccus denitrificans", EUR J BIOCHEM., vol. 218, no. 1, 15 November 1993 (1993-11-15), pages 49 - 57
HOSKINS JA; GRAY: "Phenylalanine ammonia lyase in the management of phenylketonuria: the relationship between ingested cinnamate and urinary hippurate in humans", J RES COMMUN CHEM PATHOL PHARMACOL., vol. 35, no. 2, February 1982 (1982-02-01), pages 275 - 82
HOSSEINI ET AL.: "Propionate as a health-promoting microbial metabolite in the human gut", NUTR REV., vol. 69, no. 5, May 2011 (2011-05-01), pages 245 - 258
HOU ET AL., APPL MICROBIOL BIOTECHNOL., vol. 99, no. 20, October 2015 (2015-10-01), pages 8391 - 402
HOU ET AL., APPL MICROBIOL TECHNOL, vol. 99, no. 20, October 2015 (2015-10-01), pages 8391 - 402
ISABELLA ET AL.: "Deep sequencing-based analysis of the anaerobic stimulon in Neisseria gonorrhoeae", BMC GENOMICS, vol. 12, 20 January 2011 (2011-01-20), pages 51, XP021086464, DOI: doi:10.1186/1471-2164-12-51
IVANOVSKA ET AL.: "Pediatric drug formulations: a review of challenges and progress", PEDIATRICS, vol. 134, no. 2, August 2014 (2014-08-01), pages 361 - 372
JERVIS AJ: "The 02 sensitivity of the transcription factor FNR is controlled by Ser24 modulating the kinetics of [4Fe-4S] to [2Fe-2S] conversion", PROC NATL ACAD SCI USA., vol. 106, no. 12, 24 March 2009 (2009-03-24), pages 4659 - 64
KOBE ET AL.: "Regulation and crystallization of phosphorylated and dephosphorylated forms of truncated dimeric phenylalanine hydroxylase", PROTEIN SCI., vol. 6, no. 6, June 1997 (1997-06-01), pages 1352 - 1357
KWOK ET AL.: "Nucleotide sequence of a full-length complementary DNA clone and amino acid sequence of human phenylalanine hydroxylase", BIOCHEMISTRY, vol. 24, no. 3, 29 January 1985 (1985-01-29), pages 556 - 561, XP001319106
LEE, D.-H.; FEIST, A. M.; BARRETT, C. L.; PALSSON, B. 0.: "Cumulative Number of Cell Divisions as a Meaningful Timescale for Adaptive Laboratory Evolution of Escherichia coli", PLOS ONE, vol. 6, 2011, pages E26172
LEONARD JV: "Inborn Metabolic Diseases, 4th ed", 2006, SPRINGER MEDIZIN VERLAG, article "Disorders of the urea cycle and related enzymes", pages: 263 - 272
LONGO ET AL.: "Phase 1 Trial of Subcutaneous rAvPAL-PEG in Subjects with Phenylketonuria", LANCET, vol. 384, no. 9937, 5 July 2014 (2014-07-05), pages 37 - 44
LOPEZ G; ANDERSON JC: "Synthetic Auxotrophs with Ligand-Dependent Essential Genes for a BL21(DE3) Biosafety Strain", ACS SYNTH BIOL., vol. 4, no. 12, 18 December 2015 (2015-12-18), pages 1279 - 1286, XP055334885, DOI: doi:10.1021/acssynbio.5b00085
LOPEZ; ANDERSON: "Synthetic Auxotrophs with Ligand-Dependent Essential Genes for a BL21 (DE3) Biosafety Strain", ACS SYNTH BIOL, vol. 4, no. 12, 2015, pages 1279 - 1286, XP055334885, DOI: doi:10.1021/acssynbio.5b00085
MACDONALD ET AL., BIOCHEM CELL BIOL, vol. 85, 2007, pages 273 - 82
MACLEOD ET AL.: "Nutritional Management of Phenylketonuria", ANN NESTLE ENG, vol. 68, no. 2, June 2010 (2010-06-01), pages 58 - 69, XP055170206, DOI: doi:10.1159/000312813
MAJANDER ET AL.: "Extracellular secretion of polypeptides using a modified Escherichia coli flagellar secretion apparatus", NATBIOTECHNOL., vol. 23, no. 4, April 2005 (2005-04-01), pages 475 - 81, XP002426110, DOI: doi:10.1038/nbt1077
MCKEOWN, BR. J. RADIOL., vol. 87, 2014, pages 20130676
MEADOW ET AL.: "Biosynthesis of diaminopimelic acid and lysine in Escherichia coli", BIOCHEM J., vol. 72, no. 3, July 1959 (1959-07-01), pages 396 - 400
MILLER: "Experiments in Molecular Genetics", 1972, COLD SPRING HARBOR LABORATORY PRESS
MILTON H. SAIER, JR.: "Protein Secretion Systems in Gram-Negative Bacteria Gram-negative bacteria possess many protein secretion-membrane insertion systems that apparently evolved independently", MICROBE, vol. 1, no. 9, 2006
MOFFITT ET AL.: "Discovery of two cyanobacterial phenylalanine ammonia lyases: kinetic and structural characterization.", BIOCHEMISTRY, vol. 46, no. 4, 30 January 2007 (2007-01-30), pages 1004 - 1012, XP002501766, DOI: doi:10.1021/BI061774G
MOORE ET AL.: "Regulation of FNR dimerization by subunit charge repulsion", J BIOL CHEM., vol. 281, no. 44, 3 November 2006 (2006-11-03), pages 33268 - 33275
NEMANI ET AL.: "Magnetic nanoparticle hyperthermia induced cytosine deaminase expression in microencapsulated E. coli for enzyme-prodrug therapy", J BIOTECHNOL., vol. 203, 10 June 2015 (2015-06-10), pages 32 - 40
NENAD BLAU ET AL: "Alternative therapies to address the unmet medical needs of patients with phenylketonuria", EXPERT OPINION ON PHARMACOTHERAPY, vol. 16, no. 6, 13 April 2015 (2015-04-13), LONDON, UK, pages 791 - 800, XP055348839, ISSN: 1465-6566, DOI: 10.1517/14656566.2015.1013030 *
NOUGAYREDE ET AL.: "Escherichia coli induces DNA double-strand breaks in eukaryotic cells", SCIENCE, vol. 313, no. 5788, 11 August 2006 (2006-08-11), pages 848 - 51, XP002423942, DOI: doi:10.1126/science.1127059
OLIER ET AL.: "Genotoxicity of Escherichia coli Nissle 1917 strain cannot be dissociated from its probiotic activity", GUT MICROBES, vol. 3, no. 6, November 2012 (2012-11-01), pages 501 - 509, XP055086123, DOI: doi:10.4161/gmic.21737
PELMONT J ET AL.: "L-amino acid oxidases of Proteus mirabilis: general properties", BIOCHIMIE, vol. 54, 1972, pages 1359 - 1374
PI ET AL.: "Cloning and sequencing of the pheP gene, which encodes the phenylalanine-specific transport system of Escherichia coli", 0, vol. 173, no. 12, pages 3622 - 3629
PI ET AL.: "Functional consequences of changing proline residues in the phenylalanine-specific permease of Escherichia coli", J BACTERIOL., vol. 180, no. 21, pages 5515 - 5519
PI ET AL.: "Topology of the phenylalanine-specific permease of Escherichia coli", 0, vol. 178, no. 9, pages 2650 - 2655
PROC NATL ACAD SCI U S A., vol. 106, no. 12, 24 March 2009 (2009-03-24), pages 4659 - 64
PROC NATL ACAD SCI USA., vol. 106, no. 12, 24 March 2009 (2009-03-24), pages 4659 - 64
PURCELL ET AL.: "Towards a whole-cell modeling approach for synthetic biology", CHAOS, vol. 23, no. 2, June 2013 (2013-06-01), pages 025112, XP055247395, DOI: doi:10.1063/1.4811182
RAY ET AL.: "The effects of mutation of the anr gene on the aerobic respiratory chain of Pseudomonas aeruginosa", FEMS MICROBIOL LETT., vol. 156, no. 2, 15 November 1997 (1997-11-15), pages 227 - 232
REISTER ET AL.: "Complete genome sequence of the Gram-negative probiotic Escherichia coli strain Nissle 1917", J BIOTECHNOL., vol. 187, 10 October 2014 (2014-10-10), pages 106 - 107
REMBACKEN ET AL.: "Non-pathogenic Escherichia coli versus mesalazine for the treatment of ulcerative colitis: a randomised trial", LANCET, vol. 354, no. 9179, 21 August 1999 (1999-08-21), pages 635 - 639, XP025535540, DOI: doi:10.1016/S0140-6736(98)06343-0
SALMON ET AL.: "Global gene expression profiling in Escherichia coli K12. The effects of oxygen availability and FNR", J BIOL CHEM., vol. 278, no. 32, 8 August 2003 (2003-08-08), pages 29837 - 29855
SARKISSIAN ET AL., J MASS SPECTROM., vol. 42, no. 6, June 2007 (2007-06-01), pages 811 - 7
SARKISSIAN ET AL., MOL GENET METAB., vol. 104, no. 3, November 2011 (2011-11-01), pages 249 - 254
SARKISSIAN ET AL.: "A different approach to treatment of phenylketonuria: phenylalanine degradation with recombinant phenylalanine ammonia lyase", PROC NATL ACAD SCI USA., vol. 96, no. 5, 2 March 1999 (1999-03-02), pages 2339 - 2344, XP002525651, DOI: doi:10.1073/pnas.96.5.2339
SAT ET AL.: "The Escherichia coli mazEF suicide module mediates thymineless death", J BACTERIOL., vol. 185, no. 6, March 2003 (2003-03-01), pages 1803 - 1807
SAWERS: "Identification and molecular characterization of a transcriptional regulator from Pseudomonas aeruginosa P AO 1 exhibiting structural and functional similarity to the FNR protein of Escherichia coli", MOL MICROBIOL., vol. 5, no. 6, June 1991 (1991-06-01), pages 1469 - 1481
SCHULTZ: "Clinical use of E. coli Nissle 1917 in inflammatory bowel disease", INFLAMM BOWEL DIS., vol. 14, no. 7, July 2008 (2008-07-01), pages 1012 - 1018
SILHAVY, T. J.; KAHNE, D.; WALKER, S: "The bacterial cell envelope", COLD SPRING HARB PERSPECT BIOL, vol. 2, 2010, pages A000414
SONNENBORN ET AL.: "The non-pathogenic Escherichia coli strain Nissle 1917 - features of a versatile probiotic", MICROBIAL ECOLOGY IN HEALTH AND DISEASE, vol. 21, 2009, pages 122 - 158, XP008182214, DOI: doi:10.3109/08910600903444267
STEELE, FED PROC., vol. 45, no. 7, June 1986 (1986-06-01), pages 2060 - 4
TRUNK ET AL.: "Anaerobic adaptation in Pseudomonas aeruginosa: definition of the Anr and Dnr regulons", ENVIRON MICROBIOL., vol. 12, no. 6, June 2010 (2010-06-01), pages 1719 - 1733
UKENA ET AL.: "Probiotic Escherichia coli Nissle 1917 inhibits leaky gut by enhancing mucosal integrity", PLOS ONE., vol. 2, no. 12, 12 December 2007 (2007-12-12), pages E1308, XP055082936, DOI: doi:10.1371/journal.pone.0001308
UNDEN ET AL.: "Alternative respiratory pathways of Escherichia coli: energetics and transcriptional regulation in response to electron acceptors", BIOCHIM BIOPHYS ACTA, vol. 1320, no. 3, 4 July 1997 (1997-07-04), pages 217 - 234, XP004338502, DOI: doi:10.1016/S0005-2728(97)00034-0
VOCKLEY ET AL.: "Phenylalanine hydroxylase deficiency: diagnosis and management guideline", GENET MED., vol. 16, no. 2, February 2014 (2014-02-01), pages 188 - 200
WANNER ET AL.: "The phenylalanine ammonia-lyase gene family in Arabidopsis thaliana", PLANT MOL BIOL, vol. 27, no. 2, January 1995 (1995-01-01), pages 327 - 338, XP008162922, DOI: doi:10.1007/BF00020187
WILLIAMS ET AL.: "The gene stlA encodes a phenylalanine ammonia-lyase that is involved in the production of a stilbene antibiotic in Photorhabdus luminescens TT01", MICROBIOLOGY, vol. 151, August 2005 (2005-08-01), pages 2543 - 2550
WINTELER ET AL.: "The homologous regulators ANR of Pseudomonas aeruginosa and FNR of Escherichia coli have overlapping but distinct specificities for anaerobically inducible promoters", MICROBIOLOGY, vol. 142, March 1996 (1996-03-01), pages 685 - 693, XP000882879
WRIGHT ET AL.: "GeneGuard: A Modular Plasmid System Designed for Biosafety", ACS SYNTH BIOL, vol. 4, no. 3, 20 March 2015 (2015-03-20), pages 307 - 316
WRIGHT ET AL.: "GeneGuard: A Modular Plasmid System Designed for Biosafety", ACS SYNTH BIOL, vol. 4, no. 3, 2015, pages 307 - 316
WU ET AL.: "Direct regulation of the natural competence regulator gene tfoX by cyclic AMP (cAMP) and cAMP receptor protein in Vibrios", SCI REP., vol. 5, 7 October 2015 (2015-10-07), pages 14921
XIANG L; MOORE BS: "Biochemical characterization of a prokaryotic phenylalanine ammonia lyase", J BACTERIOL., vol. 187, no. 12, June 2005 (2005-06-01), pages 4286 - 4289, XP002501767, DOI: doi:10.1128/JB.187.12.4286-4289.2005
ZHANG ET AL.: "Development and Application of an Arabinose-Inducible Expression System by Facilitating Inducer Uptake in Corynebacterium glutamicum", APPL. ENVIRON. MICROBIOL, vol. 78, no. 16, August 2012 (2012-08-01), pages 5831 - 5838, XP055312833, DOI: doi:10.1128/AEM.01147-12
ZHANG R; LIN Y: "DEG 5.0, a database of essential genes in both prokaryotes and eukaryotes", NUCLEIC ACIDS RES., vol. 37, January 2009 (2009-01-01), pages D455 - D458
ZHANG; LIN: "DEG 5.0, a database of essential genes in both prokaryotes and eukaryotes", NUCL ACIDS RES, vol. 37, 2009, pages D455 - D458
ZIMMERMANN ET AL.: "Anaerobic growth and cyanide synthesis of Pseudomonas aeruginosa depend on anr, a regulatory gene homologous with fnr of Escherichia coli", MOL MICROBIOL., vol. 5, no. 6, June 1991 (1991-06-01), pages 1483 - 1490

Cited By (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2018237198A1 (en) 2017-06-21 2018-12-27 Synlogic Operating Company, Inc. BACTERIA FOR THE TREATMENT OF DISORDERS
WO2020223345A1 (en) 2019-04-29 2020-11-05 Antipov Eugene Enumeration of genetically engineered microorganisms by live cell counting techniques
WO2020247594A1 (en) 2019-06-04 2020-12-10 Cocoon Biotech Inc. Silk-based products, formulations, and methods of use
CN110643585A (zh) * 2019-11-08 2020-01-03 江南大学 一种利用氨基酸脱氨酶生产α-酮-β-甲基正戊酸的方法
WO2022120028A2 (en) 2020-12-02 2022-06-09 Synlogic Operating Company, Inc. Engineered microorganisms
WO2022148362A1 (zh) * 2021-01-07 2022-07-14 上海陶宇晟生物技术有限责任公司 具备表面展示苯丙氨酸解氨酶的工程益生菌

Also Published As

Publication number Publication date
AU2016356684B2 (en) 2021-12-16
EP3377518B1 (en) 2022-04-13
US11618894B2 (en) 2023-04-04
CA3005451A1 (en) 2017-05-26
JP2022046527A (ja) 2022-03-23
JP7245312B2 (ja) 2023-03-23
AU2025202726A9 (en) 2026-03-05
US20180320161A1 (en) 2018-11-08
US20240076645A1 (en) 2024-03-07
JP2018535678A (ja) 2018-12-06
JP7813312B2 (ja) 2026-02-12
ES2925049T3 (es) 2022-10-13
AU2022201838A1 (en) 2022-04-07
EP3377518A1 (en) 2018-09-26
PL3377518T3 (pl) 2022-09-26
EP4095150A1 (en) 2022-11-30
JP2024112925A (ja) 2024-08-21
AU2016356684C1 (en) 2022-11-10
JP2023085294A (ja) 2023-06-20
AU2022201838B2 (en) 2025-01-23
JP6993970B2 (ja) 2022-02-15
JP7494345B2 (ja) 2024-06-03
AU2025202726A1 (en) 2025-05-08
AU2016356684A1 (en) 2018-05-31

Similar Documents

Publication Publication Date Title
JP7592777B2 (ja) 高フェニルアラニン血症を低減させるように操作された細菌
JP7494345B2 (ja) 高フェニルアラニン血症を低減させるように操作された細菌
JP2018535678A5 (https=)
WO2017123592A1 (en) Bacteria engineered to treat disorders associated with bile salts
WO2017075485A1 (en) Bacteria engineered to treat disorders in which trimethylamine (tma) is detrimental
CA3005451C (en) Bacteria engineered to reduce hyperphenylalaninemia
HK40085223A (en) Bacteria engineered to reduce hyperphenylalaninemia

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 16810138

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 15775936

Country of ref document: US

ENP Entry into the national phase

Ref document number: 3005451

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 2018526505

Country of ref document: JP

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2016356684

Country of ref document: AU

Date of ref document: 20161116

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 2016810138

Country of ref document: EP