WO2017055547A1 - Anti-pd-1 antibodies and compositions - Google Patents

Anti-pd-1 antibodies and compositions Download PDF

Info

Publication number
WO2017055547A1
WO2017055547A1 PCT/EP2016/073421 EP2016073421W WO2017055547A1 WO 2017055547 A1 WO2017055547 A1 WO 2017055547A1 EP 2016073421 W EP2016073421 W EP 2016073421W WO 2017055547 A1 WO2017055547 A1 WO 2017055547A1
Authority
WO
WIPO (PCT)
Prior art keywords
seq
amino acid
antibody
nos
acid sequences
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/EP2016/073421
Other languages
English (en)
French (fr)
Inventor
Gunther GALLER
Monika GAD
Klaus Koefoed
Ivan D. Horak
Thomas Bouquin
Michael Kragh
Mikkel PEDERSEN
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Symphogen AS
Original Assignee
Symphogen AS
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Family has litigation
First worldwide family litigation filed litigation Critical https://patents.darts-ip.com/?family=57042898&utm_source=google_patent&utm_medium=platform_link&utm_campaign=public_patent_search&patent=WO2017055547(A1) "Global patent litigation dataset” by Darts-ip is licensed under a Creative Commons Attribution 4.0 International License.
Priority to IL258214A priority Critical patent/IL258214B2/en
Priority to CA3000564A priority patent/CA3000564C/en
Priority to SI201631586T priority patent/SI3368572T1/sl
Priority to HRP20221041TT priority patent/HRP20221041T1/hr
Priority to DK16774691.6T priority patent/DK3368572T3/da
Priority to AU2016333517A priority patent/AU2016333517B2/en
Priority to EP22174837.9A priority patent/EP4105235A1/en
Priority to KR1020187011821A priority patent/KR102897330B1/ko
Priority to EP16774691.6A priority patent/EP3368572B2/en
Priority to BR112018006257-0A priority patent/BR112018006257B1/pt
Priority to PL16774691.6T priority patent/PL3368572T3/pl
Priority to LTEPPCT/EP2016/073421T priority patent/LT3368572T/lt
Priority to ES16774691T priority patent/ES2924402T3/es
Application filed by Symphogen AS filed Critical Symphogen AS
Priority to MYPI2018701111A priority patent/MY190324A/en
Priority to RU2018115979A priority patent/RU2750675C1/ru
Priority to CN201680069542.1A priority patent/CN108290953B/zh
Priority to RS20220762A priority patent/RS63490B1/sr
Priority to NZ740869A priority patent/NZ740869B2/en
Priority to JP2018516765A priority patent/JP6875385B2/ja
Priority to US15/765,337 priority patent/US11034765B2/en
Priority to MX2018003936A priority patent/MX2018003936A/es
Publication of WO2017055547A1 publication Critical patent/WO2017055547A1/en
Priority to ZA2018/01852A priority patent/ZA201801852B/en
Priority to SA518391262A priority patent/SA518391262B1/ar
Priority to CONC2018/0003500A priority patent/CO2018003500A2/es
Anticipated expiration legal-status Critical
Priority to US17/324,508 priority patent/US12030942B2/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2827Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against B7 molecules, e.g. CD80, CD86
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2818Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD28 or CD152
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/34Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/55Fab or Fab'
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565Complementarity determining region [CDR]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value

Definitions

  • PD-1 also known as Programmed Cell Death Protein 1 and CD279, is a 268 amino acid cell surface receptor that belongs to the immunoglobulin superfamily. PD-1 is a member of the CD28 family of T cell regulators and is expressed on T cells, B cells and macrophages. It binds ligands PD-L1 (also known as B7 homolog) and PD-L2 (also known as B7-DC).
  • PD-1 is a type I membrane protein whose structure includes an extracellular IgV domain, a transmembrane region and an intracellular tail containing two phosphorylation sites.
  • an immune checkpoint protein PD-1 functions as an inducible immune modulatory receptor, playing a role in, e.g., negative regulation of T cell responses to antigen stimulation.
  • PD-L1 is the predominant ligand for PD-1 . Binding of PD-L1 to PD-1 inhibits T cell activity, reducing cytokine production and suppressing T cell proliferation. Cancer cells that express PD-L1 are able to exploit this mechanism to inactivate the anti-tumor activity of T cells via binding of PD-L1 to the PD-1 receptor.
  • PD-1 has been investigated as a potential target for immunotherapy, including treatment of cancer and autoimmune diseases.
  • the present invention is directed to novel recombinant antibodies targeting PD-1 , as well as pharmaceutical compositions comprising one or more of these antibodies, and use of the antibodies and pharmaceutical compositions for enhancing immunity in a patient, and for treatment of cancers originating from tissues such as skin, lung, intestine, ovary, brain, prostate, kidney, soft tissues, the hematopoietic system, head & neck, liver, bladder, breast, stomach, uterus and pancreas.
  • tissues such as skin, lung, intestine, ovary, brain, prostate, kidney, soft tissues, the hematopoietic system, head & neck, liver, bladder, breast, stomach, uterus and pancreas.
  • the antibodies of the invention may provide a superior clinical response either alone or in combination with another cancer therapeutic, such as an antibody targeting another immune checkpoint protein.
  • the present invention provides an anti-PD-1 antibody or an antigen-binding portion thereof, wherein the antibody competes for binding to human PD-1 with, or binds to the same epitope of human PD-1 as, any one of antibodies 12819.15384, 12748.15381 , 12748.16124, 12865.15377, 12892.15378, 12796.15376, 12777.15382, 12760.15375 and 131 12.15380.
  • the anti-PD-1 antibody comprises H-CDR1 -3 comprising the H-CDR1 -3 sequences, respectively, of antibody 12819.15384, 12748.15381 ,
  • the anti-PD-1 antibody has a heavy chain variable domain (V H ) that is at least 90% (e.g., at least 92%, at least 95%, at least 98%, or at least 99%) identical in amino acid sequence to the V H domain of antibody 12819.15384, 12748.15381 , 12748.16124, 12865.15377, 12892.15378, 12796.15376, 12777.15382, 12760.15375, or 131 12.15380..
  • the anti-PD-1 antibody has a V H that comprises the V H amino acid sequence of antibody 12819.15384, 12748.15381 , 12748.16124,
  • the anti-PD-1 antibody has a heavy chain (HC) that comprises the V H amino acid sequence of antibody 12819.15384, 12748.15381 ,
  • the anti-PD-1 antibody comprises L-CDR1 -3 comprising the L-CDR1 -3 sequences, respectively, of antibody 12819.15384, 12748.15381 ,
  • the anti-PD-1 antibody has a light chain variable domain (V L ) that is at least 90% (e.g., at least 92%, at least 95%, at least 98%, or at least 99%) identical in amino acid sequence to the V L domain of antibody 12819.15384, 12748.15381 , 12748.16124, 12865.15377, 12892.15378, 12796.15376, 12777.15382, 12760.15375, or 131 12.15380.
  • V L light chain variable domain
  • the anti-PD-1 antibody has a V L that comprises the V L amino acid sequence of antibody 12819.15384, 12748.15381 , 12748.16124,
  • the anti-PD-1 antibody has a light chain (LC) that comprises the V L amino acid sequence of antibody 12819.15384, 12748.15381 ,
  • the anti-PD-1 antibody comprises any of the above- described heavy chain sequences and any of the above light chain sequences.
  • the anti-PD-1 antibody comprises the H-CDR3 and L- CDR3 amino acid sequences of antibody 12819.15384, 12748.15381 , 12748.16124, 12865.15377, 12892.15378, 12796.15376, 12777.15382, 12760.15375, or 131 12.15380.
  • the anti-PD-1 antibody comprises the H-CDR1 -3 and L- CDR1 -3 amino acid sequences of antibody 12819.15384, 12748.15381 , 12748.16124, 12865.15377, 12892.15378, 12796.15376, 12777.15382, 12760.15375, or 131 12.15380.
  • the anti-PD-1 antibody has a V H and a V L that are at least 90% (e.g., at least 92%, at least 95%, at least 98%, or at least 99%) identical in amino acid sequence to the V H and V L , respectively, of antibody 12819.15384, 12748.15381 ,
  • the anti-PD-1 antibody has a V H and V L that comprise or consist of the V H and V L amino acid sequences, respectively, of antibody 12819.15384,
  • the anti-PD-1 antibody has an HC and an LC that comprise or consist of the HC and LC amino acid sequences, respectively, of antibody 12819.15384, 12748.15381 , 12748.16124, 12865.15377, 12892.15378, 12796.15376,
  • the anti-PD-1 antibody has (1 ) an HC that comprises the V H amino acid sequence of an antibody selected from the group consisting of antibodies 12819.15384, 12748.15381 , 12748.16124, 12865.15377, 12892.15378, 12796.15376, 12777.15382, 12760.15375, and 131 12.15380, and the heavy chain constant region amino acid sequence of SEQ ID NO: 67; and (2) an LC that comprises the V L amino acid sequence of that selected antibody and the light chain constant region amino acid sequence of SEQ ID NO: 68.
  • the anti-PD-1 antibody or antigen-binding portion of the invention comprises the H-CDR1 -3 and L-CDR1 -3 amino acid sequences of:
  • the anti-PD-1 antibody or antigen-binding portion of the invention comprises a heavy chain variable domain and a light chain variable domain having the amino acid sequences of:
  • the anti-PD-1 antibody of the invention comprises:
  • an HC comprising the amino acid sequences of SEQ ID NOs: 2 and 67 and an LC comprising the amino acid sequences of SEQ ID NOs: 3 and 68; b) an HC comprising the amino acid sequences of SEQ ID NOs: 4 and 67 and an LC comprising the amino acid sequences of SEQ ID NOs: 5 and 68; c) an HC comprising the amino acid sequences of SEQ ID NOs: 4 and 67 and an LC comprising the amino acid sequences of SEQ ID NOs: 66 and 68; d) an HC comprising the amino acid sequences of SEQ ID NOs: 6 and 67 and an LC comprising the amino acid sequences of SEQ ID NOs: 7 and 68; e) an HC comprising the amino acid sequences of SEQ ID NOs: 8 and 67 and an LC comprising the amino acid sequences of SEQ ID NOs: 9 and 68; f) an HC comprising the amino acid sequences of SEQ ID NOs:
  • the antibody or antigen-binding portion of the invention comprises H-CDR1 -3 and L-CDR1 -3 comprising the amino acid sequences of SEQ ID NOs: 18-20 and SEQ ID NOs: 21 -23, respectively.
  • the anti-PD-1 antibody comprises a V H comprising the amino acid sequence of SEQ ID NO: 2 and a V L comprising the amino acid sequence of SEQ ID NO: 3.
  • the anti-PD-1 antibody comprises a heavy chain comprising the amino acid sequences of SEQ ID NOs: 2 and 67 and a light chain comprising the amino acid sequences of SEQ ID NOs: 3 and 68.
  • the invention also provides an anti-PD-1 antibody or an antigen-binding portion thereof that binds to an epitope of PD-1 comprising amino acid residue K131 (e.g., 12819 and 12865 antibodies such as those listed in Tables 1 , 4-9, and 1 1 -14).
  • amino acid residue K131 e.g., 12819 and 12865 antibodies such as those listed in Tables 1 , 4-9, and 1 1 -14.
  • the epitope further comprises amino acid residues P130 and A132, and may additionally comprise amino acid residues V64 and L128 (e.g., a 12819 antibody). In some embodiments, the epitope further comprises amino acid residue E136 (e.g., a 12865 antibody).
  • the invention also provides an anti-PD-1 antibody or an antigen-binding portion thereof that binds to an epitope of PD-1 comprising amino acid residues V44 and T145 of SEQ ID NO: 1 (e.g., a 131 12 antibody such as those listed in Tables 1 , 4-7, 9, and 1 1 -14).
  • an anti-PD-1 antibody or an antigen-binding portion thereof that binds to an epitope of PD-1 comprising amino acid residues V44 and T145 of SEQ ID NO: 1 (e.g., a 131 12 antibody such as those listed in Tables 1 , 4-7, 9, and 1 1 -14).
  • the antibody or portion binds to an epitope of PD-1 comprising amino acid residues V64, L128, P130, K131 , and A132 of SEQ ID NO: 1 (e.g., a 12819 antibody), amino acid residues K131 and E136 of SEQ ID NO: 1 (e.g., a 12865 antibody), or amino acid residues V44 and T145 of SEQ ID NO: 1 (e.g., a 131 12 antibody).
  • amino acid residues V64, L128, P130, K131 , and A132 of SEQ ID NO: 1 e.g., a 12819 antibody
  • amino acid residues K131 and E136 of SEQ ID NO: 1 e.g., a 12865 antibody
  • amino acid residues V44 and T145 of SEQ ID NO: 1 e.g., a 131 12 antibody
  • the invention also provides a monoclonal antibody or an antigen-binding portion thereof that binds to an epitope of PD-1 comprising amino acid residues 69-90 and 122- 140 of SEQ ID NO: 1 (e.g., a 12819 or 12865 antibody).
  • the monoclonal antibody or antigen-binding portion binds to an epitope of PD-1 comprising amino acid residues 56-64, 69-90, and 122-140 of SEQ ID NO: 1 (e.g., a 12819 antibody).
  • the antibody or portion binds to residues 69-75 (or a fragment thereof) of SEQ ID NO: 1 (e.g., a 12819 or 12865 antibody). In certain embodiments, the antibody or portion binds to residues 136-140 (or a fragment thereof) of SEQ ID NO: 1 (e.g., a 12819 or 12865 antibody). In some embodiments, the antibody or portion binds to residues 69-75 (or a fragment thereof) and residues 136-140 (or a fragment thereof) of SEQ ID NO: 1 (e.g., a 12819 or 12865 antibody).
  • the anti-PD-1 antibody or antigen-binding portion of the invention has at least one of the following properties:
  • a) binds to human PD-1 with a K D of 750 pM or less;
  • f) increases IFN- ⁇ secretion in a one-way mixed lymphocyte reaction assay; g) inhibits the interaction of PD-1 with PD-L1 by at least 60% at a concentration of 10 g/ml in a flow cytometric competition assay;
  • h blocks binding of PD-L1 and PD-L2 to PD-1 by at least 90% at a
  • the anti-PD-1 antibody or antigen-binding portion of the invention has all of said properties.
  • the anti-PD-1 antibody or antigen-binding portion has at least properties a, b, and e-h.
  • the anti-PD-1 antibody or antigen-binding portion has at least properties a, b, e, f, and h. In some embodiments, the anti-PD-1 antibody or antigen-binding portion has at least properties a, b, e, and f.
  • 12819, 12748, 12865, 12892, 12796, 12777, 12760 and 131 12 each refers to a group of antibodies that have the same six CDRs and that share the first five digits in their ten-digit numerical designations.
  • 12748 includes antibody variants 12748.15381 and 12748.16124, which have the same six CDRs (as shown in Table 2).
  • Each group of antibodies is expected to share the same or substantially the same biological properties.
  • the anti-PD-1 antibody or antigen-binding portion of the invention does not compete for binding to PD-1 with pembrolizumab or nivolumab.
  • the anti-PD-1 antibody or antigen-binding portion of the invention does not bind to the same epitope as pembrolizumab or nivolumab; for example, the antibody or portion of the invention binds to one or more residues on PD-1 that are not bound by pembrolizumab or nivolumab.
  • the present invention provides pharmaceutical compositions comprising at least one anti-PD-1 antibody or antigen-binding portion thereof as described herein and a pharmaceutically acceptable excipient.
  • the present invention further provides isolated nucleic acid molecules comprising a nucleotide sequence that encodes the heavy chain or an antigen-binding portion thereof, a nucleotide sequence that encodes the light chain or an antigen-binding portion thereof, or both, of an anti-PD-1 antibody as described herein.
  • the present invention also provides vectors comprising such an isolated nucleic acid molecule, wherein said vector further comprises an expression control sequence.
  • the present invention also provide host cells comprising a nucleotide sequence that encodes the heavy chain or an antigen-binding portion thereof, a nucleotide sequence that encodes the light chain or an antigen-binding portion thereof, or both, of an anti-PD-1 antibody as described herein.
  • the present invention also provides a method for producing an antibody or antigen-binding portion thereof as described herein, comprising providing a host cell that comprises a nucleotide sequence that encodes the heavy chain or an antigen-binding portion thereof and a nucleotide sequence that encodes the light chain or an antigen- binding portion thereof of an anti-PD-1 antibody as described herein, cultivating said host cell under conditions suitable for expression of the antibody or portion, and isolating the resulting antibody or portion.
  • the present invention also provides a bispecific binding molecule having the binding specificity of an anti-PD-1 antibody described herein and the binding specificity of another anti-PD-1 antibody (e.g., another anti-PD-1 antibody described herein) or an antibody that targets a different protein, such as another immune checkpoint protein, a cancer antigen, or another cell surface molecule whose activity mediates a disease condition such as cancer.
  • a patient e.g., a human patient
  • the present invention also provides a method for enhancing immunity in a patient (e.g., a human patient) in need thereof, comprising administering to said patient an anti- PD-1 antibody or an antigen-binding portion thereof, a pharmaceutical composition, or a bispecific binding molecule as described herein.
  • the present invention further provides a method for treating cancer in a patient (e.g., a human patient), comprising administering to said patient an anti-PD-1 antibody or an antigen-binding portion thereof, a pharmaceutical composition, or a bispecific binding molecule as described herein.
  • a patient e.g., a human patient
  • the cancer originates in a tissue selected from the group consisting of skin, lung, intestine, ovary, brain, prostate, kidney, soft tissues, hematopoietic system, head & neck, liver, bladder, breast, stomach, uterus and pancreas.
  • the cancer may be, e.g., advanced or metastatic melanoma, non-small cell lung cancer, head and neck squamous cell cancer, renal cell carcinoma, or Hodgkin's lymphoma.
  • the method further comprises administering a chemotherapeutic agent, an anti-neoplastic agent, an anti-angiogenic agent, a tyrosine kinase inhibitor, or a PD-1 pathway inhibitor.
  • the present invention further provides antibodies or antigen-binding portions of the present invention for use in the aforementioned treatments, and the use of the antibodies or antigen-binding portions of the present invention for the manufacture of medicaments for the aforementioned treatments, i.e., treatment of a human in need thereof to enhance his/her immune system, and treatment of a human with cancer, such as one of the aforementioned cancers.
  • Figure 1 shows a PCR product containing the V H and V L regions of the anti-PD-1 antibody AAS-12819 (shown in black) cloned in-frame with the corresponding human heavy chain lgG1 -CH1 -CH2-CH3 and human light chain lambda constant fragments, respectively. Restriction sites for this cloning are Apal and Avrll. Restriction sites AscI and Nhel are shown between the V H and V L 5'-ends. The plasmid origin of replication is depicted as pUC o and the gene conferring ampicillin-resistance is depicted as AmpR.
  • Figure 2 shows an expression construct with a double CMV promoter inserted between 5'-ends of V H and V L using AscI and Nhel restriction sites. V H and V L sequences are depicted in black, other annotated genetic elements are depicted in white.
  • Figures 3A-3C show representative flow cytometry dot plots for (A) an antibody clone that specifically binds to human PD-1 -transfected cells, (B) a clone that non- specifically binds to CHO-S cells, and (C) a clone that does not bind either of the cell populations used in the screening.
  • Figure 4 shows the frequency of lymphocytes expressing PD-1 in six donors (D1 -
  • Figures 5 A- 1 show titration of candidate anti-PD-1 antibodies in an SEB assay.
  • Figures 6A-H shows titration of candidate anti-PD-1 antibodies in a one-way MLR assay.
  • Figures 7A-B show PD-L1 binding to PD-1 -expressing cells in the presence of anti-PD-1 antibodies.
  • Figure 8 shows an overview of the identified epitope groups (epitope bins) for tested anti-PD-1 antibodies 12866.13188, 12807.13177, 12819.17149, 12865.17150, 12892.13195, 12777.15382, 12760.13169, 131 12.15380, and nivolumab and
  • pembrolizumab analogues Antibodies connected by black lines indicate cross blocking activity. Antibodies are grouped according to competition patterns with other anti-PD-1 antibodies. Nivo: nivolumab analogue; Pembro: pembrolizumab analogue.
  • FIG. 9 panels A-G show the location of antibody epitopes on the structure of human PD-1 (PDB 4ZQK and 2M2D).
  • E Molecular model of the 12819 antibody epitope represented as in (C).
  • F Molecular model of the 12865 antibody epitope represented as in (C).
  • G Molecular model of the non-ligand blocking 131 12 antibody epitope represented as in (C).
  • FIG. 10 panels A-D shows the effect of treatment with anti-PD-1 antibody 12819, 17149 or a vehicle on tumor growth in four syngeneic tumor models.
  • Figure 1 1 shows the effect of treatment with anti-PD-1 antibody 12819.17149, pembrolizumab (Keytruda®), or vehicle on tumor growth of a semi-humanized xenograft tumor model, where the human melanoma cell line A375 was mixed with purified human CD8+ and CD4+ T cells prior to inoculation.
  • the grey area denotes the treatment period.
  • Data are presented as means ⁇ SEM. * P ⁇ 0.001 .
  • the present invention provides new anti-human PD-1 antibodies that can be used to enhance the immune system in a human patient, such as a cancer patient.
  • PD-1 refers to human PD-1 .
  • polypeptide sequence is available under Uniprot Accession No. Q151 16
  • PDCD1_HUMAN shown here as SEQ ID NO: 1 .
  • antibody refers to a tetramer comprising two heavy (H) chains (about 50-70 kDa) and two light (L) chains (about 25 kDa) inter-connected by disulfide bonds.
  • Each heavy chain is comprised of a heavy chain variable domain (V H ) and a heavy chain constant region (CH).
  • Each light chain is composed of a light chain variable domain (V L ) and a light chain constant region (CL).
  • V H and V L domains can be subdivided further into regions of hypervariability, termed “complementarity determining regions” (CDRs), interspersed with regions that are more conserved, termed “framework regions” (FRs).
  • CDRs complementarity determining regions
  • FRs framework regions
  • Each V H and V L is composed of three CDRs (H-CDR herein designates a CDR from the heavy chain; and L-CDR herein designates a CDR from the light chain) and four FRs, arranged from amino-terminus to carboxyl-terminus in the following order: FR1 , CDR1 , FR2, CDR2, FR3, CDR3, FR4.
  • the assignment of amino acid numbers in the heavy or light chain may be in accordance with IMGT ® definitions (Lefranc et al., Dev Comp Immunol 27(1 ):55-77 (2003)); or the definitions of Kabat, Sequences of Proteins of Immunological Interest (National Institutes of Health, Bethesda, MD (1987 and 1991 )); Chothia & Lesk, J. Mol. Biol. 196:901 -917 (1987); or Chothia et al., Nature 342:878-883 (1989).
  • the term “recombinant antibody” refers to an antibody that is expressed from a cell or cell line comprising the nucleotide sequence(s) that encode the antibody, wherein said nucleotide sequence(s) are not naturally associated with the cell.
  • isolated protein refers to a protein, polypeptide or antibody that by virtue of its origin or source of derivation (1 ) is not associated with naturally associated components that accompany it in its native state, (2) is free of other proteins from the same species, (3) is expressed by a cell from a different species, and/or (4) does not occur in nature.
  • polypeptide that is chemically synthesized or synthesized in a cellular system different from the cell from which it naturally originates will be "isolated” from its naturally associated components.
  • a protein may also be rendered substantially free of naturally associated components by isolation, using protein purification techniques well known in the art.
  • germline refers to the nucleotide and amino acid sequences of antibody genes and gene segments as they are passed from parents to offspring via germ cells. Germline sequences are distinguished from the nucleotide sequences encoding antibodies in mature B cells, which have been altered by
  • An antibody that "utilizes" a particular germline sequence has a nucleotide or amino acid sequence that aligns with that germline nucleotide sequence or with the amino acid sequence that it specifies more closely than with any other germline nucleotide or amino acid sequence.
  • affinity refers to a measure of the attraction between an antigen and an antibody.
  • the intrinsic attractiveness of the antibody for the antigen is typically expressed as the binding affinity equilibrium constant (K D ) of a particular antibody-antigen interaction.
  • K D binding affinity equilibrium constant
  • An antibody is said to specifically bind to an antigen when the K D is ⁇ 1 mM, preferably ⁇ 100 nM.
  • a K D binding affinity constant can be measured, e.g., by surface plasmon resonance (BIAcoreTM) or Bio-Layer Interferometry, for example using the ProteOnTM XPR36 SPR system from Bio-Rad or the OctetTM system.
  • k 0ff refers to the dissociation rate constant of a particular
  • a k 0ff dissociation rate constant can be measured by Bio- Layer Interferometry, for example using the OctetTM system.
  • epitope refers to a portion (determinant) of an antigen that specifically binds to an antibody or a related molecule such as a bispecific binding molecule.
  • Epitopic determinants generally consist of chemically active surface groupings of molecules such as amino acids or carbohydrate or sugar side chains and generally have specific three-dimensional structural characteristics, as well as specific charge characteristics.
  • An epitope may be "linear” or “conformational.” In a linear epitope, all of the points of interaction between a protein (e.g., an antigen) and an interacting molecule (such as an antibody) occur linearly along the primary amino acid sequence of the protein. In a conformational epitope, the points of interaction occur across amino acid residues on the protein that are separated from one another in the primary amino acid sequence.
  • an antibody to a linear epitope may be generated, e.g., by immunizing an animal with a peptide having the amino acid residues of the linear epitope.
  • An antibody to a conformational epitope may be generated, e.g., by immunizing an animal with a mini-domain containing the relevant amino acid residues of the conformational epitope.
  • An antibody to a particular epitope can also be generated, e.g., by immunizing an animal with the target molecule of interest or a relevant portion thereof (e.g., the ECD of PD-1 ), then screening for binding to the epitope.
  • the test antibody and an anti-PD-1 antibody of the invention bind to at least one common residue (e.g., at least two, three, four, or five common residues) on PD-1 .
  • the contact residues on PD-1 are completely identical between the test antibody and the anti-PD-1 antibody of the invention.
  • Interferometry or flow cytometry To test whether an anti-PD-1 antibody cross-competes with another anti-PD-1 antibody, one may use the competition method described above in two directions, i.e., determining if the known antibody blocks the test antibody and vice versa. Such cross-competition experiments may be performed, e.g., using an IBIS MX96 SPR instrument or the OctetTM system.
  • chimeric antibody refers in its broadest sense to an antibody that contains one or more regions from one antibody and one or more regions from one or more other antibodies, typically an antibody that is partially of human origin and partially of non-human origin, i.e., derived in part from a non-human animal, for example a mouse, rat or other rodent, or an avian such as a chicken. Chimeric antibodies are preferred over non-human antibodies in order to reduce the risk of a human anti-antibody response, e.g., a human anti-mouse antibody response in the case of a murine antibody.
  • An example of a typical chimeric antibody is one in which the variable domain sequences are murine while the constant region sequences are human.
  • the non- human parts may be subjected to further alteration in order to humanize the antibody.
  • the chimeric antibodies described herein have chicken variable domain sequences and human constant region sequences.
  • humanize refers to the fact that where an antibody is wholly or partially of non-human origin (for example, a murine or chicken antibody obtained from
  • mice or chickens, respectively, with an antigen of interest, or a chimeric antibody based on such a murine or chicken antibody it is possible to replace certain amino acids, in particular in the framework regions and constant regions of the heavy and light chains, in order to avoid or minimize an immune response in humans.
  • non-human antibodies tend to be more immunogenic in humans than human antibodies.
  • Chimeric antibodies, where the foreign (e.g., rodent or avian) constant regions have been replaced with sequences of human origin have been shown to be generally less immunogenic than antibodies of fully foreign origin, and the trend in therapeutic antibodies is towards humanized or fully human antibodies. Chimeric antibodies or other antibodies of non-human origin thus can be humanized to reduce the risk of a human anti-antibody response.
  • humanization typically involves modification of the framework regions of the variable domain sequences.
  • Amino acid residues that are part of complementarity determining regions (CDRs) most often will not be altered in connection with humanization, although in certain cases it may be desirable to alter individual CDR amino acid residues, for example to remove a glycosylation site, a deamidation site, an aspartate isomerization site or an undesired cysteine or methionine residue.
  • CDRs complementarity determining regions
  • Removal of an N-glycosylation site may be achieved by mutating either the Asn or the Ser/Thr residue to a different residue, preferably by way of conservative substitution.
  • Deamidation of asparagine and glutamine residues can occur depending on factors such as pH and surface exposure. Asparagine residues are particularly
  • CDR grafting which for, e.g., a murine-derived chimeric antibody involves identification of human germline gene counterparts to the murine variable domain genes and grafting of the murine CDR sequences into this framework.
  • the specificity of an antibody's interaction with a target antigen resides primarily in the amino acid residues located in the six CDRs of the heavy and light chain. The amino acid sequences within CDRs are therefore much more variable between individual antibodies than sequences outside of CDRs.
  • CDR sequences are responsible for most antibody-antigen interactions, it is possible to express recombinant antibodies that mimic the properties of a specific naturally occurring antibody, or more generally any specific antibody with a given amino acid sequence, e.g., by constructing expression vectors that express CDR sequences from the specific antibody grafted into framework sequences from a different antibody. As a result, it is possible to "humanize" a non-human antibody and still substantially maintain the binding specificity and affinity of the original antibody.
  • CDR grafting may be based on the Kabat CDR definitions, although a more recent publication (Magdelaine-Beuzelin et al., Crit Rev. Oncol Hematol.
  • CDR grafting may reduce the binding specificity and affinity, and thus the biological activity, of a CDR-grafted non-human antibody as compared to the parent antibody from which the CDRs are obtained.
  • Back mutations (sometimes referred to as "framework repair") may be introduced at selected positions of the CDR-grafted antibody, typically in the framework regions, in order to reestablish the binding specificity and affinity of the parent antibody. Identification of positions for possible back mutations can be performed using information available in the literature and in antibody databases. Amino acid residues that are candidates for back mutations are typically those that are located at the surface of an antibody molecule, while residues that are buried or that have a low degree of surface exposure will not normally be altered.
  • An alternative humanization technique to CDR grafting and back mutation is resurfacing, in which non-surface exposed residues of non-human origin are retained, while surface residues are altered to human residues.
  • affinity maturation it may also be desirable to alter one or more CDR amino acid residues in order to improve binding affinity to the target epitope.
  • This is known as "affinity maturation” and may optionally be performed in connection with humanization, for example in situations where humanization of an antibody leads to reduced binding specificity or affinity and it is not possible to sufficiently improve the binding specificity or affinity by back mutations alone.
  • affinity maturation methods are known in the art, for example the in vitro scanning saturation mutagenesis method described by Burks et al., Proc Natl Acad Sci USA, 94:412-417 (1997), and the stepwise in vitro affinity maturation method of Wu et al., Proc Natl Acad Sci USA 95:6037-6042 (1998).
  • antigen-binding portion of an antibody (or simply “antibody portion”), as used herein, refers to one or more portions or fragments of an antibody that retain the ability to specifically bind to an antigen (e.g., human PD-1 , or a portion thereof). It has been shown that certain fragments of a full-length antibody can perform the antigen- binding function of the antibody. Examples of binding fragments encompassed within the term “antigen-binding portion” include (i) a Fab fragment: a monovalent fragment consisting of the V L , V H , CL and CH1 domains (for example, the 12819.17149 and
  • a F(ab')2 fragment a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region;
  • an Fd fragment consisting of the V H and CH1 domains;
  • a Fv fragment consisting of the V L and V H domains of a single arm of an antibody,
  • a dAb fragment which consists of a V H domain; and
  • an isolated complementarity determining region capable of specifically binding to an antigen.
  • the two domains of the Fv fragment, V L and V H are encoded by separate genes, they can be joined, using
  • single chain Fv single chain Fv
  • antigen-binding molecules comprising a V H and/or a V L .
  • the molecule may also comprise one or more of a CH1 , hinge, CH2, or CH3 region.
  • Such single chain antibodies are also intended to be encompassed within the term "antigen-binding portion" of an antibody.
  • Other forms of single chain antibodies, such as diabodies, are also encompassed.
  • Diabodies are bivalent, bispecific antibodies in which V H and V L domains are expressed on a single polypeptide chain, but using a linker that is too short to allow for pairing between the two domains on the same chain, thereby forcing the domains to pair with
  • Antibody portions such as Fab and F(ab')2 fragments, can be prepared from whole antibodies using conventional techniques, such as papain or pepsin digestion of whole antibodies. Moreover, antibodies, antibody portions and immunoadhesion molecules can be obtained using standard recombinant DNA techniques, e.g., as described herein.
  • the class (isotype) and subclass of anti-PD-1 antibodies may be determined by any method known in the art.
  • the class and subclass of an antibody may be determined using antibodies that are specific for a particular class and subclass of antibody. Such antibodies are available commercially.
  • the class and subclass can be determined by ELISA, Western Blot as well as other techniques.
  • the class and subclass may be determined by sequencing all or a portion of the constant regions of the heavy and/or light chains of the antibodies, comparing their amino acid sequences to the known amino acid sequences of various classes and subclasses of immunoglobulins, and determining the class and subclass of the antibodies.
  • an indication of, e.g., "35S” refers to the position and residue, i.e., in this case indicating that a serine residue (S) is present in position 35 of the sequence.
  • an indication of, e.g., "13Q+35S” refers to the two residues in the respective positions.
  • the present invention provides antibodies directed against PD-1 , and antigen- binding portions thereof.
  • the antibodies may be chimeric, with variable domains derived from chickens, and human constant regions, or may be humanized.
  • the antibodies disclosed herein are in particular humanized antibodies.
  • V H and V L amino acid sequences (SEQ ID NOs: 2 to 17) of eight selected humanized anti-PD-1 antibodies of the invention are shown further below in Table 4 (Example 4).
  • SEQ ID NOs. are provided below in Table 1 .
  • the anti-PD-1 antibodies disclosed herein may be referred to by either a 5-digit number, e.g., "12819,” or by a 10-digit number, e.g., "12819.15384.”
  • the 5-digit number refers to all antibodies having the heavy and light chain CDR1 -3 sequences shown for that number in Table 2, whereas the use of a 10-digit number refers to a particular humanized variant.
  • 12819.15384 is a particular humanized variant having the CDR sequences of a 12819 antibody as shown in Table 2.
  • the 5-digit number encompasses, for example, antibodies that are identical to the 10-digit variants shown below in Table 1 except for some changes in the FRs (e.g., lacking residues SY at the N- terminus of the mature light chain, or having residues SS in lieu of SY).
  • modifications do not change the functional (e.g., antigen-binding) properties of the antibodies.
  • Table 2 below provides the SEQ ID NOs for the heavy and light chain CDR amino acid sequences of the antibodies.
  • the anti-PD-1 antibody is selected from the group consisting of:
  • V H heavy chain variable domain
  • V L light chain variable domain
  • the anti-PD-1 antibody is selected from the group consisting of:
  • V H heavy chain variable domain
  • V L light chain variable domain
  • the anti-PD-1 antibody is selected from the group consisting of:
  • V H heavy chain variable domain
  • V L light chain variable domain
  • the anti-PD-1 antibody is selected from the group consisting of:
  • V H heavy chain variable domain
  • V L light chain variable domain
  • the anti-PD-1 antibody is selected from the group consisting of: a) an antibody whose H-CDR1 -3 comprise the amino acid sequences of SEQ ID NOs:42-44, respectively;
  • V H heavy chain variable domain
  • HC heavy chain
  • V L light chain variable domain
  • V H comprises the amino acid sequence of SEQ ID NO:
  • V L comprises the amino acid sequence of SEQ ID NO: 1 1 ;
  • the anti-PD-1 antibody is selected from the group consisting of:
  • an antibody whose H-CDR1 -3 comprise the amino acid sequences of SEQ ID NOs: 48-50, respectively; b) an antibody whose heavy chain variable domain (V H ) is at least 90% identical in sequence to the amino acid sequence of SEQ ID NO: 12;
  • HC heavy chain
  • V L light chain variable domain
  • V H comprises the amino acid sequence of SEQ ID NO:
  • V L comprises the amino acid sequence of SEQ ID NO: 13;
  • the anti-PD-1 antibody is selected from the group consisting of:
  • V H heavy chain variable domain
  • HC heavy chain
  • V L light chain variable domain
  • V H comprises the amino acid sequence of SEQ ID NO:
  • V L comprises the amino acid sequence of SEQ ID NO: 15;
  • the anti-PD-1 antibody is selected from the group consisting of:
  • V H heavy chain variable domain
  • V L light chain variable domain
  • V H comprises the amino acid sequence of SEQ ID NO:
  • V L comprises the amino acid sequence of SEQ ID NO: 17;
  • the anti-PD-1 antibody or an antigen-binding portion thereof comprises the H-CDR1 -3 and L-CDR1 -3 amino acid sequences of a 12819 antibody (e.g., antibody 12819.15384).
  • the anti-PD-1 antibody or an antigen-binding portion thereof comprises the H-CDR1 -3 and L-CDR1 -3 amino acid sequences of a 12748 antibody (e.g., antibody 12748.15381 or antibody 12748.16124).
  • a 12748 antibody e.g., antibody 12748.15381 or antibody 12748.16124.
  • the anti-PD-1 antibody or an antigen-binding portion thereof comprises the H-CDR1 -3 and L-CDR1 -3 amino acid sequences of a 12865 antibody (e.g., antibody 12865.15377).
  • the anti-PD-1 antibody or an antigen-binding portion thereof comprises the H-CDR1 -3 and L-CDR1 -3 amino acid sequences of a 12892 antibody (e.g., antibody 12892.15378).
  • the anti-PD-1 antibody or an antigen-binding portion thereof comprises the H-CDR1 -3 and L-CDR1 -3 amino acid sequences of a 12796 antibody (e.g., antibody 12796.15376).
  • the anti-PD-1 antibody or an antigen-binding portion thereof comprises the H-CDR1 -3 and L-CDR1 -3 amino acid sequences of a 12777 antibody (e.g., antibody 12777.15382).
  • the anti-PD-1 antibody or an antigen-binding portion thereof comprises the H-CDR1 -3 and L-CDR1 -3 amino acid sequences of a 12760 antibody (e.g., antibody 12760.15375).
  • the anti-PD-1 antibody or an antigen-binding portion thereof comprises the H-CDR1 -3 and L-CDR1 -3 amino acid sequences of a 131 12 antibody (e.g., antibody 131 12.15380).
  • the anti-PD-1 antibody or an antigen-binding portion thereof has a V H and a V L that are at least 90% (e.g., at least 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%) identical in amino acid sequence to the V H and V L , respectively, of any one of antibodies 12819.15384, 12748.15381 , 12748.16124, 12865.15377,
  • the anti-PD-1 antibody or an antigen-binding portion thereof has a V H and a V L that comprise the V H and V L amino acid sequences, respectively, of any one of antibodies 12819.15384, 12748.15381 , 12748.16124, 12865.15377,
  • the anti-PD-1 antibody or an antigen-binding portion thereof comprises the H-CDR1 -3 and L-CDR1 -3 amino acid sequences of:
  • the anti-PD-1 antibody or an antigen-binding portion thereof comprises a V H that is 80%, 85%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical, and a V L that is 80%, 85%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical, to the amino acid sequences of:
  • the anti-PD-1 antibody or an antigen-binding portion thereof comprises a V H and a V L that are the amino acid sequences of:
  • the anti-PD-1 antibody comprises:
  • an HC comprising the amino acid sequences of SEQ ID NOs: 2 and 67 and an LC comprising the amino acid sequences of SEQ ID NOs: 3 and 68; b) an HC comprising the amino acid sequences of SEQ ID NOs: 4 and 67 and an LC comprising the amino acid sequences of SEQ ID NOs: 5 and 68; c) an HC comprising the amino acid sequences of SEQ ID NOs: 4 and 67 and an LC comprising the amino acid sequences of SEQ ID NOs: 66 and 68; d) an HC comprising the amino acid sequences of SEQ ID NOs: 6 and 67 and an LC comprising the amino acid sequences of SEQ ID NOs: 7 and 68; e) an HC comprising the amino acid sequences of SEQ ID NOs: 8 and 67 and an LC comprising the amino acid sequences of SEQ ID NOs: 9 and 68; f) an HC comprising the amino acid sequences of SEQ ID NOs:
  • an HC consisting of the amino acid sequences of SEQ ID NOs: 14 and 67 and an LC consisting of the amino acid sequences of SEQ ID NOs: 15 and 68; or i) an HC consisting of the amino acid sequences of SEQ ID NOs: 16 and 67 and an LC consisting of the amino acid sequences of SEQ ID NOs: 17 and 68.
  • any of the anti-PD-1 antibodies or antigen-binding portions described herein may have at least one of the following properties:
  • a) binds to human PD-1 with a K D of 750 pM or less;
  • f) increases IFN- ⁇ secretion in a one-way mixed lymphocyte reaction assay; g) inhibits the interaction of PD-1 with PD-L1 by at least 60% at a concentration of 10 g/ml in a flow cytometric competition assay;
  • h blocks binding of PD-L1 and PD-L2 to PD-1 by at least 90% at a
  • any of the anti-PD-1 antibodies or antigen-binding portions described herein may bind to human PD-1 with a K D of at least 900, at least 850, at least 800, at least 750, at least 700, at least 650, at least 600, at least 550, at least 500, at least 450, at least 400, at least 350, at least 300, at least 250, at least 200, at least 150, at least 100, at least 50, at least 40, at least 30, or at least 20 pM.
  • K D K D of at least 900, at least 850, at least 800, at least 750, at least 700, at least 650, at least 600, at least 550, at least 500, at least 450, at least 400, at least 350, at least 300, at least 250, at least 200, at least 150, at least 100, at least 50, at least 40, at least 30, or at least 20 pM.
  • the K D is determined using surface plasmon resonance.
  • the anti-PD-1 antibodies or antigen-binding portions bind to human PD-1 with a higher affinity than nivolumab, pembrolizumab, or both.
  • any of the anti-PD-1 antibodies or antigen-binding portions described herein may bind to cynomolgus PD-1 (SEQ ID NO: 89) with a K D of at least 9000, at least 8000, at least 7000, at least 6000, at least 5000, at least 4000, at least 3000, at least 2500, at least 2000, at least 1500, at least 1000, at least 900, at least 800, at least 700, at least 600, at least 500, at least 400, at least 300, at least 200, at least 100, at least 75, at least 50, at least 25, at least 20, at least 15, at least 10, or at least 5 pM.
  • the K D is determined using surface plasmon resonance.
  • any of the anti-PD-1 antibodies or antigen-binding portions described herein may bind to mouse PD-1 (SEQ ID NO: 91 ) with a K D of at least 1000, at least 950, at least 900, or at least 850 pM.
  • the K D is determined using surface plasmon resonance.
  • any of the anti-PD-1 antibodies or antigen-binding portions described herein may inhibit the interaction of PD-1 with PD-L1 by at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 81 %, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91 %, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% at a concentration of 10 pg/ml in a flow cytometric competition assay.
  • the anti-PD-1 antibodies or antigen-binding portions may inhibit the interaction of PD-1 with PD-L1 by at least 83%.
  • any of the anti-PD-1 antibodies or antigen-binding portions described herein may block binding of PD-L1 and PD-L2 to PD-1 by at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 85%, at least 90%, at least 91 %, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% at a concentration of 10 g/ml as determined by Bio-Layer Interferometry analysis.
  • the anti-PD-1 antibodies or antigen-binding portions block binding of PD-L1 and PD-L2 to PD- 1 by at least 90%.
  • any of the anti-PD-1 antibodies or antigen-binding portions described herein may compete or cross-compete for binding to PD-1 with 12865, 12892, and 12777 antibodies (e.g., antibodies 12865.15377, 12892.15378, and
  • any of the anti-PD-1 antibodies or antigen-binding portions described herein may compete or cross-compete for binding to PD-1 with a 12819 antibody (e.g., antibody 12819.15384). In some embodiments, any of the anti-PD-1 antibodies or antigen-binding portions described herein may compete or cross-compete for binding to PD-1 with 12760 and 131 12 antibodies (e.g., antibodies 12760.15375 and 131 12.15380).
  • an anti-PD-1 antibody of the invention binds to an epitope of PD-1 that includes at least one (e.g., at least one, at least two, at least three, at least four, or at least five) of the following residues of SEQ ID NO: 1 : V44, V64, L128, P130, K131 , A132, E136, and T145.
  • the antibody or antigen-binding portion binds to an epitope of PD-1 that includes residues V64, L128, P130, K131 , and A132 of SEQ ID NO: 1 (such as a 12819 antibody, e.g., antibody 12819.15384).
  • the antibody or antigen- binding portion binds to an epitope of PD-1 that includes residues K131 and E136 of SEQ ID NO: 1 (such as a 12865 antibody, e.g., antibody 12865.15377).
  • an epitope of PD-1 that includes residues K131 and E136 of SEQ ID NO: 1 (such as a 12865 antibody, e.g., antibody 12865.15377).
  • the antibody or antigen-binding portion binds to an epitope of PD-1 that includes residues V44 and T145 of SEQ ID NO: 1 (such as a 131 12 antibody, e.g., antibody 131 12.15380).
  • an anti-PD-1 antibody of the invention binds to an epitope of PD-1 that comprises residues 56-64, 69-90, and/or 122-140 of SEQ ID NO: 1 .
  • the antibody or antigen-binding portion binds to an epitope of PD-1 that comprises residues 69-90 and 122-140 of SEQ ID NO: 1 (such as 12819 and 12865 antibodies, e.g., antibodies 12819.15384 and
  • the antibody or antigen-binding portion binds to an epitope of PD-1 that comprises residues 56-64, 69-90, and 122-140 of SEQ ID NO: 1 (e.g., a 12819 antibody). In certain embodiments, the antibody or antigen-binding portion binds to an epitope of PD-1 that comprises residues 69-90 and 122-140 of SEQ ID NO: 1 (e.g., a 12865 antibody).
  • the antibody or portion binds to residues 69-75 (or a fragment thereof, such as a one, two, three, four, five, or six residue fragment), of SEQ ID NO: 1 (such as 12819 and 12865 antibodies, e.g., antibodies 12819.15384 and 12865.15377). In some embodiments, the antibody or portion binds to residues 136-140 (or a fragment thereof, such as a one, two, three, or four residue fragment) of SEQ ID NO: 1 (such as 12819 and 12865 antibodies, e.g., antibodies 12819.15384 and 12865.15377).
  • the antibody or portion binds to residues 69-75 (or a fragment thereof) and residues 136-140 (or a fragment thereof) of SEQ ID NO: 1 , (such as 12819 and 12865 antibodies, e.g., antibodies 12819.15384 and 12865.15377).
  • residues 69-75 or a fragment thereof
  • residues 136-140 or a fragment thereof
  • An epitope with any combination of the above residues is also contemplated.
  • an amino acid sequence comprising a PD-1 epitope as described herein can be used as an immunogen (e.g., administered to an animal or as an antigen for screening antibody libraries) to generate or identify anti-PD-1 antibodies or antigen-binding portions thereof that bind to said epitope.
  • the class of an anti-PD-1 antibody obtained by the methods described herein may be changed or switched with another class or subclass.
  • a nucleic acid molecule encoding V L or V H is isolated using methods well-known in the art such that it does not include nucleic acid sequences encoding CL or CH.
  • the nucleic acid molecules encoding V L or V H then are operatively linked to a nucleic acid sequence encoding a CL or CH, respectively, from a different class of immunoglobulin molecule.
  • This may be achieved using a vector or nucleic acid molecule that comprises a CL or CH chain, as described above.
  • an anti-PD-1 antibody that was originally IgM may be class switched to IgG.
  • the class switching may be used to convert one IgG subclass to another, e.g., from Igd to lgG 2 .
  • a ⁇ light chain constant region can be changed to a ⁇ light chain constant region.
  • a preferred method for producing an antibody of the invention with a desired Ig isotype comprises the steps of isolating a nucleic acid molecule encoding the heavy chain of an anti-PD-1 antibody and a nucleic acid molecule encoding the light chain of an anti-PD-1 antibody, obtaining the variable domain of the heavy chain, ligating the variable domain of the heavy chain with the constant region of a heavy chain of the desired isotype, expressing the light chain and the ligated heavy chain in a cell, and collecting the anti-PD-1 antibody with the desired isotype.
  • the anti-PD-1 antibody of the invention can be an IgG, an IgM, an IgE, an IgA, or an IgD molecule, but is typically of the IgG isotype, e.g., of IgG subclass Igd, lgG 2 a or lgG 2 b, lgG3 or lgG 4 .
  • the antibody is an Igd .
  • the antibody is an lgG 4 .
  • the anti-PD-1 antibody may comprise at least one mutation in the Fc region.
  • Fc mutations A number of different Fc mutations are known, where these mutations provide altered effector function. For example, in many cases it will be desirable to reduce or eliminate effector function, e.g., where ligand/receptor interactions are undesired or in the case of antibody-drug conjugates.
  • the anti-PD-1 antibody comprises at least one mutation in the Fc region that reduces effector function.
  • Fc region amino acid positions that may be advantageous to mutate in order to reduce effector function include one or more of positions 228, 233, 234 and 235, where amino acid positions are numbered according to the IMGT ® numbering scheme.
  • one or both of the amino acid residues at positions 234 and 235 may be mutated, for example from Leu to Ala (L234A L235A). These mutations reduce effector function of the Fc region of Igd antibodies.
  • the amino acid residue at position 228 may be mutated, for example to Pro.
  • amino acid residue at position 233 may be mutated, e.g., to Pro
  • amino acid residue at position 234 may be mutated, e.g., to Val
  • amino acid residue at position 235 may be mutated, e.g., to Ala.
  • the amino acid positions are numbered according to the IMGT ® numbering scheme.
  • the antibody may comprise the mutation S228P, i.e., having a proline in position 228, where the amino acid position is numbered according to the IMGT ® numbering scheme. This mutation is known to reduce undesired Fab arm exchange.
  • an antibody or antigen-binding portion thereof of the invention may be part of a larger immunoadhesion molecule, formed by covalent or noncovalent association of the antibody or antibody portion with one or more other proteins or peptides.
  • immunoadhesion molecules include use of the streptavidin core region to make a tetrameric scFv molecule (Kipriyanov et al., Human Antibodies and Hybridomas 6:93-101 (1995)) and use of a cysteine residue, a marker peptide and a C-terminal polyhistidine tag to make bivalent and biotinylated scFv molecules (Kipriyanov et al., Mol.
  • CDRs from an antibody are incorporated into a molecule either covalently or noncovalently to make it an immunoadhesin that specifically binds to an antigen of interest.
  • the CDR(s) may be incorporated as part of a larger polypeptide chain, may be covalently linked to another polypeptide chain, or may be incorporated noncovalently.
  • a fusion antibody or immunoadhesin may be made that comprises all or a portion of an anti-PD-1 antibody of the invention linked to another polypeptide.
  • only the variable domains of the anti-PD-1 antibody are linked to the polypeptide.
  • the V H domain of an anti-PD-1 antibody is linked to a first polypeptide
  • the V L domain of an anti-PD-1 antibody is linked to a second polypeptide that associates with the first polypeptide in a manner such that the V H and V L domains can interact with one another to form an antigen-binding site.
  • the V H domain is separated from the V L domain by a linker such that the V H and V L domains can interact with one another (e.g., single-chain antibodies).
  • the V H -linker- V L antibody is then linked to the polypeptide of interest.
  • fusion antibodies can be created in which two (or more) single-chain antibodies are linked to one another. This is useful if one wants to create a divalent or polyvalent antibody on a single polypeptide chain, or if one wants to create a bispecific antibody.
  • V H - and V L -encoding DNA fragments are operatively linked to another fragment encoding a flexible linker, e.g., encoding the amino acid sequence (Gly4 -Ser)3, such that the V H and V L sequences can be expressed as a contiguous single-chain protein, with the V L and V H domains joined by the flexible linker.
  • a flexible linker e.g., encoding the amino acid sequence (Gly4 -Ser)3
  • Gly4 -Ser amino acid sequence
  • the single chain antibody may be monovalent, if only a single V H and V L are used; bivalent, if two V H and V L are used; or polyvalent, if more than two V H and V L are used.
  • Bispecific or polyvalent antibodies may be generated that bind specifically to human PD-1 and to another molecule, for instance.
  • other modified antibodies may be prepared using anti-PD- 1 antibody-encoding nucleic acid molecules.
  • "kappa bodies” III et al., Protein Eng. 10:949-57 (1997)
  • "minibodies” Martin et al., EMBO J. 13:5303-9 (1994)
  • "diabodies” Holliger et al., Proc. Natl. Acad. Sci. USA 90:6444-6448 (1993)
  • “Janusins” Traunecker et al., EMBO J. 10:3655-3659 (1991 ) and Traunecker et al., Int. J. Cancer (Suppl.) 7:51 -52 (1992)
  • standard molecular biological techniques following the teachings of the specification.
  • An anti-PD-1 antibody or antigen-binding portion of the invention can be derivatized or linked to another molecule (e.g., another peptide or protein).
  • another molecule e.g., another peptide or protein.
  • the antibodies or portions thereof are derivatized such that PD-1 binding is not affected adversely by the derivatization or labeling. Accordingly, the antibodies and antibody portions of the invention are intended to include both intact and modified forms of the human anti-PD-1 antibodies described herein.
  • an antibody or antibody portion of the invention can be functionally linked (by chemical coupling, genetic fusion, noncovalent association or otherwise) to one or more other molecular entities, such as another antibody (e.g., a bispecific antibody or a diabody), a detection agent, a pharmaceutical agent, and/or a protein or peptide that can mediate association of the antibody or antibody portion with another molecule (such as a streptavidin core region or a polyhistidine tag).
  • One type of derivatized antibody is produced by crosslinking two or more antibodies (of the same type or of different types, e.g., to create bispecific antibodies).
  • Suitable crosslinkers include those that are heterobifunctional, having two distinctly reactive groups separated by an appropriate spacer (e.g., m-maleimidobenzoyl-N- hydroxysuccinimide ester) or homobifunctional (e.g., disuccinimidyl suberate).
  • Such linkers are available, e.g., from Pierce Chemical Company, Rockford, II.
  • An anti-PD-1 antibody can also be derivatized with a chemical group such as polyethylene glycol (PEG), a methyl or ethyl group, or a carbohydrate group. These groups may be useful to improve the biological characteristics of the antibody, e.g., to increase serum half-life.
  • PEG polyethylene glycol
  • an antibody according to the present invention may also be labeled.
  • the terms "label” or “labeled” refer to incorporation of another molecule in the antibody.
  • the label is a detectable marker, e.g., incorporation of a radiolabeled amino acid or attachment to a polypeptide of biotinyl moieties that can be detected by marked avidin (e.g., streptavidin containing a fluorescent marker or enzymatic activity that can be detected by optical or colorimetric methods).
  • the label or marker can be therapeutic, e.g., a drug conjugate or toxin.
  • Various methods of labeling polypeptides and glycoproteins are known in the art and may be used.
  • labels for polypeptides include, but are not limited to, the following: radioisotopes or radionuclides (e.g., 3H, 14C, 15N, 35S, 90Y, 99Tc, 1 1 1 In, 1251, 131 1), fluorescent labels (e.g., FITC, rhodamine, lanthanide phosphors), enzymatic labels (e.g., horseradish peroxidase, ⁇ -galactosidase, luciferase, alkaline phosphatase), chemiluminescent markers, biotinyl groups, predetermined polypeptide epitopes recognized by a secondary reporter (e.g., leucine zipper pair sequences, binding sites for secondary antibodies, metal binding domains, epitope tags), magnetic agents, such as gadolinium chelates, toxins such as pertussis toxin, taxol, cytochalasin B, gramicidin D, ethidium bromide, e
  • the antibodies of the invention may be present in a neutral form (including zwitter ionic forms) or as a positively or negatively-charged species.
  • the antibodies may be complexed with a counterion to form a pharmaceutically acceptable salt.
  • pharmaceutically acceptable salt refers to a complex comprising one or more antibodies and one or more counterions, wherein the counterions are derived from pharmaceutically acceptable inorganic and organic acids and bases.
  • the invention provides a bispecific binding molecule having the binding specificity of an anti-PD-1 antibody described herein and the binding specificity of another anti-PD-1 antibody (e.g., another anti-PD-1 antibody described herein) or an antibody that targets a different protein, such as another immune checkpoint protein, a cancer antigen, or another cell surface molecule whose activity mediates a disease condition such as cancer.
  • another anti-PD-1 antibody e.g., another anti-PD-1 antibody described herein
  • an antibody that targets a different protein such as another immune checkpoint protein, a cancer antigen, or another cell surface molecule whose activity mediates a disease condition such as cancer.
  • bispecific binding molecules are known in the art, and examples of different types of bispecific binding molecules are given elsewhere herein.
  • the present invention also provides nucleic acid molecules and sequences encoding anti-PD-1 antibodies or antigen-binding portions thereof described herein.
  • different nucleic acid molecules encode the heavy chain and light chain amino acid sequences of the anti-PD-1 antibody or an antigen-binding portion thereof.
  • the same nucleic acid molecule encodes the heavy chain and light chain amino acid sequences of the anti-PD-1 antibody or an antigen-binding portion thereof.
  • a reference to a nucleotide sequence encompasses its complement unless otherwise specified.
  • a reference to a nucleic acid having a particular sequence should be understood to encompass its complementary strand, with its complementary sequence.
  • polynucleotide as referred to herein means a polymeric form of nucleotides of at least 10 bases in length, either ribonucleotides or deoxynucleotides or a modified form of either type of nucleotide. The term includes single and double stranded forms.
  • the invention also provides nucleotide sequences that are at least 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98% or 99% identical to one or more nucleotide sequences recited herein, e.g., to a nucleotide sequence selected from the group consisting of SEQ ID NOs: 69-88.
  • the term "percent sequence identity" in the context of nucleic acid sequences refers to the residues in two sequences that are the same when aligned for maximum correspondence.
  • the length of sequence identity comparison may be over a stretch of at least about nine nucleotides, usually at least about 18 nucleotides, more usually at least about 24 nucleotides, typically at least about 28 nucleotides, more typically at least about 32 nucleotides, and preferably at least about 36, 48 or more nucleotides.
  • FASTA Altschul et al.
  • FASTA which includes, e.g., the programs FASTA2 and FASTA3, provides alignments and percent sequence identity of the regions of the best overlap between the query and search sequences (see, e.g., Pearson, Methods Enzymol. 183:63-98 (1990); Pearson, Methods Mol. Biol. 132:185-219 (2000); Pearson, Methods Enzymol. 266:227-258 (1996); and Pearson, J. Mol. Biol. 276:71 -84 (1998); incorporated herein by reference). Unless otherwise specified, default parameters for a particular program or algorithm are used.
  • percent sequence identity between nucleic acid sequences can be determined using FASTA with its default parameters (a word size of 6 and the NOPAM factor for the scoring matrix) or using Gap with its default parameters as provided in GCG Version 6.1 , incorporated herein by reference.
  • the invention provides a nucleic acid molecule comprising a nucleotide sequence selected from the group consisting of SEQ ID NOs: 69-88.
  • the nucleic acid molecules may be isolated.
  • the present invention provides a vector suitable for expressing one of the chains of an antibody or antigen-binding portion thereof as described herein.
  • the term "vector”, as used herein, means a nucleic acid molecule capable of transporting another nucleic acid to which it has been linked.
  • the vector is a plasmid, i.e., a circular double stranded piece of DNA into which additional DNA segments may be ligated.
  • the vector is a viral vector, wherein additional DNA segments may be ligated into the viral genome.
  • the vectors are capable of autonomous replication in a host cell into which they are introduced (e.g., bacterial vectors having a bacterial origin of replication and episomal mammalian vectors).
  • the vectors e.g., non-episomal mammalian vectors
  • the vectors can be integrated into the genome of a host cell upon introduction into the host cell, and thereby are replicated along with the host genome.
  • certain vectors are capable of directing the expression of genes to which they are operatively linked. Such vectors are referred to herein as "recombinant expression vectors" (or simply, "expression vectors").
  • the invention provides vectors comprising nucleic acid molecules that encode the heavy chain of an anti-PD-1 antibody of the invention or an antigen-binding portion thereof, the light chain of an anti-PD-1 antibody of the invention or an antigen-binding portion thereof, or both the heavy and light chains of an anti-PD-1 antibody of the invention or an antigen-binding portion thereof.
  • the invention further provides vectors comprising nucleic acid molecules encoding fusion proteins, modified antibodies, antibody fragments, and probes thereof.
  • a nucleic acid molecule encoding the heavy and/or light chain of an anti-PD-1 antibody or antigen-binding portion thereof of the invention can be isolated from any source that produces such an antibody or portion.
  • the nucleic acid molecules are isolated from B cells that express an anti-PD-1 antibody isolated from an animal immunized with a human PD-1 antigen, or from an immortalized cell produced from such a B cell. Methods of isolating nucleic acids encoding an antibody are well- known in the art. mRNA may be isolated and used to produce cDNA for use in
  • PCR polymerase chain reaction
  • nucleic acid molecule of the invention can be synthesized rather than isolated.
  • a nucleic acid molecule of the invention can comprise a nucleotide sequence encoding a V H domain from an anti-PD-1 antibody or antigen-binding portion of the invention joined in-frame to a nucleotide sequence encoding a heavy chain constant region from any source.
  • a nucleic acid molecule of the invention can comprise a nucleotide sequence encoding a V L domain from an anti-PD-1 antibody or antigen-binding portion of the invention joined in-frame to a nucleotide sequence encoding a light chain constant region from any source.
  • nucleic acid molecules encoding the variable domain of the heavy (V H ) and/or light (V L ) chains may be "converted" to full-length antibody genes.
  • nucleic acid molecules encoding the V H or V L domains are converted to full-length antibody genes by insertion into an expression vector already encoding heavy chain constant (CH) or light chain constant (CL) domains, respectively, such that the V H segment is operatively linked to the CH segment(s) within the vector, and/or the V L segment is operatively linked to the CL segment within the vector.
  • CH heavy chain constant
  • CL light chain constant
  • nucleic acid molecules encoding the V H and/or V L domains are converted into full-length antibody genes by linking, e.g., ligating, a nucleic acid molecule encoding a V H and/or V L domains to a nucleic acid molecule encoding a CH and/or CL domain using standard molecular biological techniques. Nucleic acid molecules encoding the full-length heavy and/or light chains may then be expressed from a cell into which they have been introduced and the anti-PD-1 antibody isolated.
  • the nucleic acid molecules may be used to recombinantly express large quantities of anti-PD-1 antibodies.
  • the nucleic acid molecules also may be used to produce chimeric antibodies, bispecific antibodies, single chain antibodies,
  • a nucleic acid molecule of the invention is used as a probe or PCR primer for a specific antibody sequence.
  • the nucleic acid can be used as a probe in diagnostic methods or as a PCR primer to amplify regions of DNA that could be used, inter alia, to isolate additional nucleic acid molecules encoding variable domains of anti-PD-1 antibodies.
  • the nucleic acid molecules are oligonucleotides.
  • the oligonucleotides are from highly variable domains of the heavy and light chains of the antibody of interest.
  • the oligonucleotides encode all or a part of one or more of the CDRs of the anti-PD-1 antibodies or antigen-binding portions thereof of the invention as described herein.
  • the nucleic acid molecules and vectors may be used to make mutated anti-PD-1 antibodies.
  • the antibodies may be mutated in the variable domains of the heavy and/or light chains, e.g., to alter a binding property of the antibody.
  • a mutation may be made in one or more of the CDRs to increase or decrease the K D of the anti-PD-1 antibody, to increase or decrease k 0ff , or to alter the binding specificity of the antibody.
  • one or more mutations are made at an amino acid residue that is known to be changed compared to the germline in a monoclonal antibody of the invention. The mutations may be made in a CDR or
  • the mutations are made in a variable domain.
  • one or more mutations are made at an amino acid residue that is known to be changed compared to the germline in a CDR or framework region of a variable domain of an antibody or antigen-binding portion thereof of the invention.
  • the framework region(s) are mutated so that the resulting framework region(s) have the amino acid sequence of the corresponding germline gene.
  • a mutation may be made in a framework region or constant region to increase the half-life of the anti-PD-1 antibody. See, e.g., PCT Publication WO 00/09560.
  • a mutation in a framework region or constant region also can be made to alter the immunogenicity of the antibody, and/or to provide a site for covalent or non-covalent binding to another molecule.
  • a single antibody may have mutations in any one or more of the CDRs or framework regions of the variable domain or in the constant region.
  • the anti-PD-1 antibodies of the invention or antigen- binding portions thereof are expressed by inserting DNAs encoding partial or full-length light and heavy chains, obtained as described above, into expression vectors such that the genes are operatively linked to necessary expression control sequences such as transcriptional and translational control sequences.
  • Expression vectors include plasmids, retroviruses, adenoviruses, adeno-associated viruses (AAV), plant viruses such as cauliflower mosaic virus, tobacco mosaic virus, cosmids, YACs, EBV derived episomes, and the like.
  • the antibody coding sequence may be ligated into a vector such that transcriptional and translational control sequences within the vector serve their intended function of regulating the transcription and translation of the antibody coding sequence.
  • the expression vector and expression control sequences may be chosen to be compatible with the expression host cell used.
  • the antibody light chain coding sequence and the antibody heavy chain coding sequence can be inserted into separate vectors, and may be operatively linked to the same or different expression control sequences (e.g., promoters).
  • both coding sequences are inserted into the same expression vector, and may be operatively linked to the same expression control sequences (e.g., a common promoter), to separate identical expression control sequences (e.g., promoters), or to different expression control sequences (e.g., promoters).
  • the antibody coding sequences may be inserted into the expression vector by standard methods (e.g., ligation of complementary restriction sites on the antibody gene fragment and vector, or blunt end ligation if no restriction sites are present).
  • a convenient vector is one that encodes a functionally complete human CH or CL immunoglobulin sequence, with appropriate restriction sites engineered so that any V H or V L sequence can easily be inserted and expressed, as described above.
  • the HC- and LC- encoding genes in such vectors may contain intron sequences that will result in enhanced overall antibody protein yields by stabilizing the related mRNA.
  • the intron sequences are flanked by splice donor and splice acceptor sites, which determine where RNA splicing will occur. Location of intron sequences can be either in variable or constant regions of the antibody chains, or in both variable and constant regions when multiple introns are used. Polyadenylation and transcription termination may occur at native chromosomal sites downstream of the coding regions.
  • the recombinant expression vector also can encode a signal peptide that facilitates secretion of the antibody chain from a host cell.
  • the antibody chain gene may be cloned into the vector such that the signal peptide is linked in-frame to the amino terminus of the immunoglobulin chain.
  • the signal peptide can be an
  • immunoglobulin signal peptide or a heterologous signal peptide (i.e., a signal peptide from a non-immunoglobulin protein).
  • the recombinant expression vectors of the invention may carry regulatory sequences that control the expression of the antibody chain genes in a host cell. It will be appreciated by those skilled in the art that the design of the expression vector, including the selection of regulatory sequences, may depend on such factors as the choice of the host cell to be transformed, the level of expression of protein desired, etc.
  • Preferred regulatory sequences for mammalian host cell expression include viral elements that direct high levels of protein expression in mammalian cells, such as promoters and/or enhancers derived from retroviral LTRs, cytomegalovirus (CMV) (such as the CMV promoter/enhancer), Simian Virus 40 (SV40) (such as the SV40 promoter/enhancer), adenovirus, (e.g., the adenovirus major late promoter (AdMLP)), polyoma and strong mammalian promoters such as native immunoglobulin and actin promoters.
  • CMV cytomegalovirus
  • SV40 Simian Virus 40
  • AdMLP adenovirus major late promoter
  • polyoma e.g., the adenovirus major late promoter (AdMLP)
  • AdMLP adenovirus major late promoter
  • polyoma such as native immunoglobulin and actin promoters.
  • recombinant expression vectors of the invention may carry additional sequences, such as sequences that regulate replication of the vector in host cells (e.g., origins of replication) and selectable marker genes.
  • the selectable marker gene facilitates selection of host cells into which the vector has been introduced (see e.g., US Patents 4,399,216,
  • selectable marker gene confers resistance to drugs, such as G418, hygromycin or methotrexate, on a host cell into which the vector has been introduced.
  • selectable marker genes include the dihydrofolate reductase (DHFR) gene (for use in dhfr-host cells with methotrexate selection/amplification), the neo gene (for G418 selection), and the glutamate synthetase gene.
  • DHFR dihydrofolate reductase
  • expression control sequence means polynucleotide sequences that are necessary to effect the expression and processing of coding sequences to which they are ligated.
  • Expression control sequences include appropriate transcription initiation, termination, promoter and enhancer sequences; efficient RNA processing signals such as splicing and polyadenylation signals; sequences that stabilize cytoplasmic mRNA; sequences that enhance translation efficiency (i.e., Kozak consensus sequence); sequences that enhance protein stability; and when desired, sequences that enhance protein secretion.
  • control sequences differs depending upon the host organism; in prokaryotes, such control sequences generally include promoter, ribosomal binding site, and transcription termination sequence; in eukaryotes, generally, such control sequences include promoters and transcription termination sequence.
  • control sequences is intended to include, at a minimum, all components whose presence is essential for expression and processing, and can also include additional components whose presence is advantageous, for example, leader sequences and fusion partner sequences.
  • An additional aspect of the invention relates to methods for producing the antibody compositions and antibodies and antigen-binding portions thereof of the invention.
  • One embodiment of this aspect of the invention relates to a method for producing an antibody as defined herein, comprising providing a recombinant host cell capable of expressing the antibody, cultivating said host cell under conditions suitable for expression of the antibody, and isolating the resulting antibody.
  • Antibodies produced by such expression in such recombinant host cells are referred to herein as "recombinant antibodies”.
  • the invention also provides progeny cells of such host cells, and antibodies produced by same.
  • the term "recombinant host cell” means a cell into which a recombinant expression vector has been introduced.
  • the invention provides host cells that may comprise, e.g., a vector according to the invention described above.
  • the invention also provides host cells that comprise, e.g., a nucleotide sequence encoding the heavy chain or an antigen-binding portion thereof, a nucleotide sequence encoding the light chain or an antigen-binding portion thereof, or both, of an anti-PD-1 antibody or antigen-binding portion thereof of the invention.
  • “recombinant host cell” and “host cell” mean not only the particular subject cell but also the progeny of such a cell. Because certain modifications may occur in succeeding
  • Nucleic acid molecules encoding anti-PD-1 antibodies and vectors comprising these nucleic acid molecules can be used for transfection of a suitable mammalian, plant, bacterial or yeast host cell. Transformation can be by any known method for introducing polynucleotides into a host cell. Methods for introduction of heterologous polynucleotides into mammalian cells are well known in the art and include dextran-mediated transfection, calcium phosphate precipitation, polybrene-mediated transfection, protoplast fusion, electroporation, encapsulation of the polynucleotide(s) in liposomes, and direct microinjection of the DNA into nuclei.
  • nucleic acid molecules may be introduced into mammalian cells by viral vectors.
  • Methods of transforming cells are well known in the art. See, e.g., US Patents 4,399,216, 4,912,040, 4,740,461 , and 4,959,455. Methods of transforming plant cells are well known in the art, including, e.g.,
  • Agrobacterium-mediated transformation biolistic transformation, direct injection, electroporation and viral transformation.
  • Methods of transforming bacterial and yeast cells are also well known in the art.
  • Mammalian cell lines available as hosts for expression are well known in the art and include many immortalized cell lines available from the American Type Culture
  • ATCC Chinese hamster ovary
  • NS0 cells NS0 cells
  • SP2 cells HEK-293T cells
  • 293 Freestyle cells Invitrogen
  • NIH-3T3 cells HeLa cells
  • BHK baby hamster kidney
  • COS African green monkey kidney cells
  • human hepatocellular carcinoma cells e.g., Hep G2
  • A549 cells and a number of other cell lines.
  • Cell lines of particular preference are selected by determining which cell lines have high expression levels.
  • Other cell lines that may be used are insect cell lines, such as Sf9 or Sf21 cells.
  • the antibodies are produced by culturing the host cells for a period of time sufficient to allow for expression of the antibody in the host cells or, more preferably, secretion of the antibody into the culture medium in which the host cells are grown.
  • Antibodies can be recovered from the culture medium using standard protein purification methods.
  • Plant host cells include, e.g., Nicotiana, Arabidopsis, duckweed, corn, wheat, potato, etc.
  • Bacterial host cells include E. coli and Streptomyces species.
  • Yeast host cells include Schizosaccharomyces pombe, Saccharomyces cerevisiae and Pichia pastoris.
  • GS system glutamine synthetase gene expression system
  • EP Patents 0 216 846, 0 256 055, 0 323 997 and 0 338 841 EP Patents 0 216 846, 0 256 055, 0 323 997 and 0 338 841 .
  • compositions comprising as an active ingredient (or as the sole active ingredient) an anti-PD-1 antibody or antigen-binding portion thereof or anti-PD-1 antibody composition of the invention.
  • the pharmaceutical composition may comprise any anti-PD-1 antibody composition or antibody or antigen- binding portion thereof as described herein.
  • the compositions are intended for amelioration, prevention, and/or treatment of a PD-1 -related disorder (e.g., a disorder characterized by overexpression or overactivity of PD-1 ) and/or cancer.
  • a PD-1 -related disorder e.g., a disorder characterized by overexpression or overactivity of PD-1
  • the compositions are intended for activation of the immune system.
  • compositions are intended for amelioration, prevention, and/or treatment of cancer originating in tissues such as skin, lung, intestine, ovary, brain, prostate, kidney, soft tissues, the hematopoietic system, head & neck, liver, bladder, breast, stomach, uterus and pancreas.
  • tissues such as skin, lung, intestine, ovary, brain, prostate, kidney, soft tissues, the hematopoietic system, head & neck, liver, bladder, breast, stomach, uterus and pancreas.
  • the antibodies of the invention or antigen-binding portions thereof are suitable to be administered as a formulation in association with one or more
  • compositions of the invention will comprise one or more anti-PD- 1 antibodies or binding portions of the invention, e.g., one or two anti-PD-1 antibodies or binding portions.
  • the composition comprises a single anti-PD-1 antibody of the invention or binding portion thereof.
  • the pharmaceutical composition may comprise at least one anti-PD-1 antibody or antigen-binding portion thereof, e.g., one anti-PD-1 antibody or portion, and one or more additional antibodies that target one or more relevant cell surface receptors, e.g., one or more cancer-relevant receptors.
  • excipient is used herein to describe any ingredient other than the compound(s) of the invention.
  • excipient(s) will to a large extent depend on factors such as the particular mode of administration, the effect of the excipient on solubility and stability, and the nature of the dosage form.
  • pharmaceutically acceptable excipient includes any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like that are physiologically compatible.
  • Some examples of pharmaceutically acceptable excipients are water, saline, phosphate buffered saline, dextrose, glycerol, ethanol and the like, as well as combinations thereof.
  • isotonic agents for example, sugars, polyalcohols such as mannitol, sorbitol, or sodium chloride in the composition.
  • additional examples of pharmaceutically acceptable substances are wetting agents or minor amounts of auxiliary substances such as wetting or emulsifying agents, preservatives or buffers, which enhance the shelf life or
  • compositions of the present invention and methods for their preparation will be readily apparent to those skilled in the art. Such compositions and methods for their preparation may be found, for example, in Remington's Pharmaceutical Sciences, 19th Edition (Mack Publishing Company, 1995). Pharmaceutical compositions are preferably manufactured under GMP (good manufacturing practices) conditions.
  • a pharmaceutical composition of the invention may be prepared, packaged, or sold in bulk, as a single unit dose, or as a plurality of single unit doses.
  • a "unit dose" is a discrete amount of the pharmaceutical composition comprising a predetermined amount of the active ingredient.
  • the amount of the active ingredient is generally equal to the dosage of the active ingredient which would be administered to a subject or a convenient fraction of such a dosage such as, for example, one-half or one- third of such a dosage.
  • Any method for administering peptides, proteins or antibodies accepted in the art may suitably be employed for the antibodies and antigen-binding portions of the invention.
  • parenteral administration of a pharmaceutical composition includes any route of administration characterized by physical breaching of a tissue of a subject and administration of the pharmaceutical composition through the breach in the tissue, thus generally resulting in the direct administration into the blood stream, into muscle, or into an internal organ.
  • Parenteral administration thus includes, but is not limited to, administration of a pharmaceutical composition by injection of the composition, by application of the composition through a surgical incision, by application of the composition through a tissue-penetrating non-surgical wound, and the like.
  • parenteral administration is contemplated to include, but is not limited to, subcutaneous, intraperitoneal, intramuscular, intrasternal, intravenous, intraarterial, intrathecal, intraventricular, intra urethra I, intracranial, and intrasynovial injection or infusions; and kidney dialytic infusion techniques.
  • Regional perfusion is also contemplated to include, but is not limited to, subcutaneous, intraperitoneal, intramuscular, intrasternal, intravenous, intraarterial, intrathecal, intraventricular, intra urethra I, intracranial, and intrasynovial injection or infusions; and kidney dialytic infusion techniques.
  • Regional perfusion is also
  • Preferred embodiments include the intravenous and the subcutaneous routes.
  • administration typically comprise the active ingredient combined with a pharmaceutically acceptable carrier, such as sterile water or sterile isotonic saline.
  • a pharmaceutically acceptable carrier such as sterile water or sterile isotonic saline.
  • Such formulations may be prepared, packaged, or sold in a form suitable for bolus administration or for continuous administration.
  • injectable formulations may be prepared, packaged, or sold in unit dosage form, such as in ampoules or in multi-dose containers containing a preservative.
  • Formulations for parenteral administration include, but are not limited to, suspensions, solutions, emulsions in oily or aqueous vehicles, pastes, and the like. Such formulations may further comprise one or more additional ingredients including, but not limited to, suspending, stabilizing, or dispersing agents.
  • the active ingredient is provided in dry (i.e., powder or granular) form for reconstitution with a suitable vehicle (e.g., sterile pyrogen-free water) prior to parenteral administration of the reconstituted composition.
  • Parenteral formulations also include aqueous solutions which may contain excipients such as salts, carbohydrates and buffering agents (preferably to a pH of from 3 to 9), but, for some applications, they may be more suitably formulated as a sterile non-aqueous solution or as a dried form to be used in conjunction with a suitable vehicle such as sterile, pyrogen-free water.
  • exemplary parenteral administration forms include solutions or suspensions in sterile aqueous solutions, for example, aqueous propylene glycol or dextrose solutions. Such dosage forms can be suitably buffered, if desired.
  • Other parentally-administrable formulations which are useful include those which comprise the active ingredient in microcrystalline form, or in a liposomal preparation.
  • Formulations for parenteral administration may be formulated to be immediate and/or modified release.
  • Modified release formulations include delayed-, sustained-, pulsed-, controlled-, targeted and programmed release.
  • sterile injectable solutions can be prepared by incorporating the anti-PD-1 antibody or antigen-binding portion thereof or anti-PD-1 antibody composition in the required amount in an appropriate solvent with one or a combination of ingredients enumerated above, as required, followed by filtered
  • dispersions are prepared by incorporating the active compound into a sterile vehicle that contains a basic dispersion medium and the required other ingredients from those enumerated above.
  • sterile powders for the preparation of sterile injectable solutions the preferred methods of preparation are vacuum drying and freeze-drying that yields a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.
  • the proper fluidity of a solution can be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants.
  • Prolonged absorption of injectable compositions can be brought about by including in the composition an agent that delays absorption, for example, monostearate salts and gelatin, and/or by using modified-release coatings (e.g., slow- release coatings).
  • the antibodies of the invention can also be administered intranasally or by inhalation, typically in the form of a dry powder (either alone, as a mixture, or as a mixed component particle, for example, mixed with a suitable pharmaceutically acceptable excipient) from a dry powder inhaler, as an aerosol spray from a pressurised container, pump, spray, atomiser (preferably an atomiser using electrohydrodynamics to produce a fine mist), or nebuliser, with or without the use of a suitable propellant, or as nasal drops.
  • a dry powder either alone, as a mixture, or as a mixed component particle, for example, mixed with a suitable pharmaceutically acceptable excipient
  • atomiser preferably an atomiser using electrohydrodynamics to produce a fine mist
  • nebuliser preferably an atomiser using electrohydrodynamics to produce a fine mist
  • the pressurised container, pump, spray, atomizer, or nebuliser generally contains a solution or suspension of an antibody of the invention comprising, for example, a suitable agent for dispersing, solubilising, or extending release of the active, a propellant(s) as solvent.
  • the drug product Prior to use in a dry powder or suspension formulation, the drug product is generally micronised to a size suitable for delivery by inhalation (typically less than 5 microns). This may be achieved by any appropriate comminuting method, such as spiral jet milling, fluid bed jet milling, supercritical fluid processing to form nanoparticles, high pressure homogenisation, or spray drying.
  • Capsules, blisters and cartridges for use in an inhaler or insufflator may be formulated to contain a powder mix of the compound of the invention, a suitable powder base and a performance modifier.
  • a suitable solution formulation for use in an atomiser using electrohydrodynamics to produce a fine mist may contain a suitable dose of the antibody of the invention per actuation and the actuation volume may for example vary from 1 ⁇ _ to 100 ⁇ _.
  • Suitable flavours such as menthol and levomenthol, or sweeteners, such as saccharin or saccharin sodium, may be added to those formulations of the invention intended for inhaled/intranasal administration.
  • Formulations for inhaled/intranasal administration may be formulated to be immediate and/or modified release.
  • Modified release formulations include delayed-, sustained-, pulsed-, controlled-, targeted and programmed release.
  • the dosage unit is determined by means of a valve which delivers a metered amount.
  • Units in accordance with the invention are typically arranged to administer a metered dose or "puff of an antibody of the invention.
  • the overall daily dose will typically be administered in a single dose or, more usually, as divided doses throughout the day.
  • the antibodies and antibody portions of the invention may also be formulated for an oral route administration.
  • Oral administration may involve swallowing, so that the compound enters the gastrointestinal tract, and/or buccal, lingual, or sublingual
  • Formulations suitable for oral administration include solid, semi-solid and liquid systems such as tablets; soft or hard capsules containing multi- or nano-particulates, liquids, or powders; lozenges (including liquid-filled); chews; gels; fast dispersing dosage forms; films; ovules; sprays; and buccal/mucoadhesive patches.
  • Liquid formulations include suspensions, solutions, syrups and elixirs. Such formulations may be employed as fillers in soft or hard capsules (made, for example, from gelatin or hydroxypropylmethylcellulose) and typically comprise a carrier, for example, water, ethanol, polyethylene glycol, propylene glycol, methylcellulose, or a suitable oil, and one or more emulsifying agents and/or suspending agents. Liquid formulations may also be prepared by the reconstitution of a solid, for example, from a sachet. Therapeutic uses of antibodies and compositions of the invention
  • the anti-PD-1 antibodies and antigen-binding portions thereof, anti- PD-1 compositions, and bi-specific binding molecules of the invention are used to enhance or activate the immune system in a human in need thereof.
  • the patient has a condition characterized by overexpression or overactivity of PD-1 .
  • the patient is immune-suppressed.
  • composition is for use in the treatment of cancer, e.g., cancers that originate in tissues such as skin, lung, intestine, ovary, brain, prostate, kidney, soft tissues, hematopoietic system, head & neck, liver, bladder, breast, stomach, uterus and pancreas, and any cancers or other conditions which rely on PD-1 activity or in which the patient expresses or overexpresses PD-L1 , PD-L2, or both.
  • cancers e.g., cancers that originate in tissues such as skin, lung, intestine, ovary, brain, prostate, kidney, soft tissues, hematopoietic system, head & neck, liver, bladder, breast, stomach, uterus and pancreas, and any cancers or other conditions which rely on PD-1 activity or in which the patient expresses or overexpresses PD-L1 , PD-L2, or both.
  • Cancers treated by the anti-PD-1 antibodies, antigen-binding portions thereof, anti-PD-1 antibody compositions, and/or bi- specific binding molecules of the invention may include, e.g., melanoma (such as advanced melanoma, or unresectable or metastatic melanoma), non-small cell lung cancer, bladder cancer, head and neck squamous cell carcinoma, ovarian cancer, colorectal cancer, Hodgkin's lymphoma, and renal cell carcinoma (RCC).
  • melanoma such as advanced melanoma, or unresectable or metastatic melanoma
  • non-small cell lung cancer such as advanced melanoma, or unresectable or metastatic melanoma
  • bladder cancer such as advanced melanoma, or unresectable or metastatic melanoma
  • head and neck squamous cell carcinoma such as ovarian cancer
  • colorectal cancer such as Hodgkin's lymphoma
  • cancers treated by the anti-PD-1 antibodies, antigen- binding portions, anti-PD-1 compositions, and/or bi-specific binding molecules of the invention may include, e.g., melanoma (e.g., advanced or metastatic melanoma), non- small cell lung cancer, head and neck squamous cell cancer, renal cell carcinoma,
  • Hodgkin's lymphoma Hodgkin's lymphoma, non-Hodgkin's lymphoma, glioblastoma, glioma, squamous cell lung cancer, small-cell lung cancer, hepatocellular carcinoma, bladder cancer, upper urinary tract cancer, esophageal cancer, gastroesophageal junction cancer, gastric cancer, liver cancer, colon cancer, colorectal carcinoma, multiple myeloma, sarcomas, acute myeloid leukemia, chronic myeloid leukemia, myelodysplastic syndrome, nasopharyngeal cancer, chronic lymphocytic leukemia, acute lymphoblastic leukemia, small lymphocytic
  • lymphoma lymphoma, ovarian cancer, gastrointestinal cancer, primary peritoneal cancer, fallopian tube cancer, urothelial cancer, HTLV-associated T-cell leukemia/lymphoma, prostate cancer, genitourinary cancer, meningioma, adrenocortical cancer, gliosarcoma,
  • fibrosarcoma kidney cancer, breast cancer, pancreatic cancer, endometrial cancer, skin basal cell cancer, cancer of the appendix, biliary tract cancer, salivary gland cancer, advanced Merkel cell cancer, diffuse large B cell lymphoma, follicular lymphoma, mesothelioma, and solid tumors.
  • Treatment refers to a method of alleviating or abrogating a biological disorder and/or at least one of its attendant symptoms.
  • to "alleviate” a disease, disorder or condition means reducing the severity and/or occurrence frequency of the symptoms of the disease, disorder, or condition.
  • references herein to “treatment” include references to curative, palliative and prophylactic treatment.
  • Therapeutically effective amount refers to the amount of the therapeutic agent being administered that will relieve to some extent one or more of the symptoms of the disorder being treated.
  • a therapeutically effective amount of an anti-cancer therapeutic may result in tumor shrinkage, increased survival, elimination of cancer cells, decreased disease progression, reversal of metastasis, or other clinical endpoints desired by healthcare professionals.
  • the antibody compositions or antibodies or antigen-binding portions thereof of the invention may be administered alone or in combination with one or more other drugs or antibodies (or as any combination thereof).
  • the pharmaceutical compositions, methods and uses of the invention thus also encompass embodiments of combinations (coadministration) with other active agents, as detailed below.
  • co-administration referring to the antibody compositions and antibodies and antigen- binding portions thereof of the invention with one or more other therapeutic agents, is intended to mean, and does refer to and include the following:
  • each part may be administered by either the same or a different route.
  • the antibody compositions and antibodies and antigen-binding portions thereof of the invention may be administered without additional therapeutic treatments, i.e., as a stand-alone therapy.
  • treatment with the antibody compositions and antibodies and antigen-binding portions thereof of the invention may include at least one additional therapeutic treatment (combination therapy).
  • the antibody composition or antibody or antigen-binding portion thereof may be coadministered or formulated with another medication/drug for the treatment of cancer.
  • the additional therapeutic treatment may comprise, e.g., a chemotherapeutic, anti-neoplastic, or anti-angiogenic agent, a different anti-cancer antibody, and/or radiation therapy.
  • Such compounds may, for example, be selected from the group consisting of retinoic acid, trans-retinoic acids, cis-retinoic acids, phenylbutyrate, nerve growth factor, dimethyl sulfoxide, active form vitamin D3, peroxisome proliferator- activated receptor gamma, 12-O-tetradecanoylphorbol 13-acetate, hexamethylene-bis- acetamide, transforming growth factor-beta, butyric acid, cyclic AMP, and vesnarinone.
  • the compound is selected from the group consisting of retinoic acid, phenylbutyrate, all-trans-retinoic acid and active form vitamin D.
  • Pharmaceutical articles comprising an anti-PD-1 antibody composition or anti-PD- 1 antibody or antigen-binding portion thereof of the invention and at least one other agent (e.g., a chemotherapeutic, anti-neoplastic, or anti-angiogenic agent) may be used as a combination treatment for simultaneous, separate or successive administration in cancer therapy.
  • the other agent may by any agent suitable for treatment of the particular cancer in question, for example, an agent selected from the group consisting of alkylating agents, e.g., platinum derivatives such as cisplatin, carboplatin and/or oxaliplatin; plant alkoids, e.g., paclitaxel, docetaxel and/or irinotecan; antitumor antibiotics, e.g., doxorubicin
  • alkylating agents e.g., platinum derivatives such as cisplatin, carboplatin and/or oxaliplatin
  • plant alkoids e.g., paclitaxel, docetaxel and/or irinotecan
  • antitumor antibiotics e.g., doxorubicin
  • adriamycin daunorubicin, epirubicin, idarubicin mitoxantrone, dactinomycin, bleomycin, actinomycin, luteomycin, and/or mitomycin
  • topoisomerase inhibitors such as topotecan
  • antimetabolites e.g., fluorouracil and/or other fluoropyrimidines.
  • An anti-PD-1 antibody or antigen-binding portion thereof or anti-PD-1 antibody composition of the invention may also be used in combination with other anti-cancer therapies such as vaccines, cytokines, enzyme inhibitors and T cell therapies.
  • a vaccine it may, e.g., be a protein, peptide or DNA vaccine containing one or more antigens which are relevant for the cancer being treated, or a vaccine comprising dendritic cells along with an antigen.
  • Suitable cytokines include, for example, IL-2, IFN-gamma and GM-CSF.
  • Adoptive T cell therapy refers to various immunotherapy techniques that involve expanding or engineering patients' own T cells to recognize and attack their tumors.
  • an anti-PD-1 antibody or antigen-binding portion thereof or anti-PD-1 antibody composition of the invention may be used in adjunctive therapy in connection with tyrosine kinase inhibitors.
  • tyrosine kinase inhibitors synthetic, mainly quinazoline-derived, low molecular weight molecules that interact with the intracellular tyrosine kinase domain of receptors and inhibiting ligand-induced receptor phosphorylation by competing for the intracellular Mg-ATP binding site.
  • the antibody composition or antibody or antigen-binding portion thereof may be used in combination with another medication/drug that mediates immune system activation, including, but not limited to, an agent that mediates the expression or activity of A2AR, BLTA, B7-H3, B7-H4, CTLA-4, CD27, CD28, CD40, CD55, CD73, CD122, CD137, CD160, CGEN-15049, CHK1 , CHK2, CTLA-3, CEACAM (e.g., CEACAM-1 and/or CEACAM-5), GAL9, GITR, HVEM, ICOS, IDO, KIR, LAIR1 , LAG-3, OX40, TIGIT, TIM-3, TGFR-beta, VISTA and/or 2B4.
  • another medication/drug that mediates immune system activation
  • another medication/drug that mediates immune system activation including, but not limited to, an agent that mediates the expression or activity of A2AR, BLTA, B7-H3, B7
  • the agent is an antibody or an antigen-binding fragment thereof that binds to one of the above molecules.
  • the antibody composition or antibody or antigen- binding portion thereof of the invention may be administered in combination with a CTLA-4 inhibitor (e.g., an anti-CTLA-4 antibody such as tremelimumab or ipilimumab).
  • a CTLA-4 inhibitor e.g., an anti-CTLA-4 antibody such as tremelimumab or ipilimumab.
  • the antibody composition or antibody or antigen-binding portion thereof of the invention may be administered in combination with ipilimumab.
  • the antibodies and antigen-binding portions of the invention may be administered in combination with another inhibitor of the PD-1 pathway, which may target PD-1 or one or more of its ligands.
  • another inhibitor of the PD-1 pathway which may target PD-1 or one or more of its ligands.
  • inhibitors include other anti- PD-1 antibodies, anti-PD-L1 antibodies, and anti-PD-L2 antibodies.
  • an antibody composition, antibody, and/or antigen-binding portion of the invention may be administered in combination with pembrolizumab and/or nivolumab.
  • the antibody compositions and antibodies and antigen- binding portions thereof of the invention may be used in a method of treatment as described herein, may be for use in a treatment as described herein, and/or may be for use in the manufacture of a medicament for a treatment as described herein,
  • the antibody compositions of the invention will be administered in an effective amount for treatment of the condition in question, i.e., at dosages and for periods of time necessary to achieve a desired result.
  • a therapeutically effective amount may vary according to factors such as the particular condition being treated, the age, sex and weight of the patient, and whether the antibodies are being administered as a stand-alone treatment or in combination with one or more additional anti-cancer treatments.
  • Dosage regimens may be adjusted to provide the optimum desired response. For example, a single bolus may be administered, several divided doses may be administered over time or the dose may be proportionally reduced or increased as indicated by the exigencies of the therapeutic situation. It is especially advantageous to formulate parenteral compositions in dosage unit form for ease of administration and uniformity of dosage.
  • Dosage unit form refers to physically discrete units suited as unitary dosages for the patients/subjects to be treated; each unit containing a predetermined quantity of active compound calculated to produce the desired therapeutic effect in association with the required pharmaceutical carrier.
  • the specification for the dosage unit forms of the invention are generally dictated by and directly dependent on (a) the unique characteristics of the chemotherapeutic agent and the particular therapeutic or prophylactic effect to be achieved, and (b) the limitations inherent in the art of compounding such an active compound for the treatment of sensitivity in individuals.
  • the dose and dosing regimen are adjusted in accordance with methods well- known in the therapeutic arts. That is, the maximum tolerable dose can be readily established, and the effective amount providing a detectable therapeutic benefit to a patient may also be determined, as can the temporal requirements for administering each agent to provide a detectable therapeutic benefit to the patient. Accordingly, while certain dose and administration regimens are exemplified herein, these examples in no way limit the dose and administration regimen that may be provided to a patient in practicing the present invention.
  • dosage values may vary with the type and severity of the condition to be alleviated, and may include single or multiple doses. It is to be further understood that for any particular subject, specific dosage regimens should be adjusted over time according to the individual need and the professional judgment of the person
  • the dosage regimen with the compositions of this invention may be based on a variety of factors, including the type of disease, the age, weight, sex, medical condition of the patient, the severity of the condition, the route of administration, and the particular antibody employed.
  • the dosage regimen can vary widely, but can be determined routinely using standard methods. For example, doses may be adjusted based on pharmacokinetic or pharmacodynamic parameters, which may include clinical effects such as toxic effects and/or laboratory values.
  • the present invention encompasses intra-patient dose-escalation as determined by the skilled artisan.
  • a suitable dose of an antibody composition of the invention will be in the range of 0.1 -100 mg/kg, such as about 0.5-50 mg/kg, e.g., about 1 -20 mg/kg.
  • the antibody composition may for example be administered in a dosage of at least 0.25 mg/kg, e.g., at least 0.5 mg/kg, such as at least 1 mg/kg, e.g., at least 1 .5 mg/kg, such as at least 2 mg/kg, e.g., at least 3 mg/kg, such as at least 4 mg/kg, e.g., at least 5 mg/kg; and e.g., up to at most 50 mg/kg, such as up to at the most 30 mg/kg, e.g., up to at the most 20 mg/kg, such as up to at the most 15 mg/kg.
  • Administration will normally be repeated at suitable intervals, e.g., once every week, once every two weeks, once every three weeks, or once every four weeks, and for as long as deemed appropriate by the responsible doctor, who may optionally increase or decrease the dosage as necessary.
  • An effective amount for tumor therapy may be measured by its ability to stabilize disease progression and/or ameliorate symptoms in a patient, and preferably to reverse disease progression, e.g., by reducing tumor size.
  • composition of the invention to inhibit cancer may be evaluated by in vitro assays, e.g., as described in the examples, as well as in suitable animal models that are predictive of the efficacy in human tumors.
  • Suitable dosage regimens will be selected in order to provide an optimum therapeutic response in each particular situation, for example, administered as a single bolus or as a continuous infusion, and with possible adjustment of the dosage as indicated by the exigencies of each case.
  • the antibodies of the present invention also are useful in diagnostic processes (e.g., in vitro, ex vivo).
  • the antibodies can be used to detect and/or measure the level of PD-1 in a sample from a patient (e.g., a tissue sample, or a body fluid sample such as an inflammatory exudate, blood, serum, bowel fluid, saliva, or urine).
  • a sample from a patient e.g., a tissue sample, or a body fluid sample such as an inflammatory exudate, blood, serum, bowel fluid, saliva, or urine.
  • Suitable detection and measurement methods include immunological methods such as flow cytometry, enzyme-linked immunosorbent assays (ELISA), chemiluminescence assays, radioimmunoassay, and immunohistology.
  • kits e.g., diagnostic kits comprising the antibodies described herein.
  • Example 1 Cloning of anti-PD-1 antibodies from chicken B cells
  • ASC antibody-secreting B cells
  • V H and V L amplified fragments are joined by overlap-extension PCR in a so-called nested PCR step.
  • PCR products are pooled prior to cloning into a plasmid vector. This is done in such a way that the cloned DNA fragments encoding the variable domains of the chicken antibody can be expressed as a full chimeric antibody from a single plasmid expression construct in transfected mammalian cells. Consequently, it is possible to screen cell supernatants for chimeric antibodies exhibiting specific binding to the PD-1 antigen.
  • Step 1 The amplified PCR products containing the paired V H and V L fragments were amplified in a nested PCR reaction. This allowed for addition of flanking restriction enzyme recognition sites for Apal and Avrll at each end. Since the cognate V H and V L sequences were paired in a single PCR product from each sorted ASC, cloning of the PCR products was performed after pooling all the PCR fragments.
  • the plasmid pML392 was constructed to receive the SymplexTM PCR products by digestion of the corresponding restriction sites Apal and Avrll. The resulting ligation of pooled PCR products and pML392 is shown in Figure 1 . Here the insertion of the PCR product placed the V H and V L sequences in front of human CH1 -CH2-CH3 and lambda constant cDNA regions, respectively, so that full length heavy and light chain reading frames were obtained.
  • Step 2 In the initial constructs, the two reading frames encoding heavy and light chain sequences were placed head-to-head and separated by a DNA sequence that contained restriction enzyme recognition sites for Ascl and Nhel. By insertion of a corresponding Ascl/Nhel-digested double CMV promoter DNA fragment including 5 ' -UTRs and signal peptides between the two 5 ' -ends of the heavy and light chain genes, a complete expression construct was obtained as depicted in Figure 2.
  • Amino acid sequences encoding the variable heavy and light chain domains of antibody analogues of nivolumab and pembrolizumab were obtained from the IMGT ® website imgt.org/mAb-DB/; see Table 3 below.
  • the protein sequences were reverse translated to DNA sequences with human codon usage.
  • the corresponding DNA sequences were then gene synthesized and cloned into expression vectors containing constant human lgG 4 heavy chain or kappa light chain domains, resulting in expression of full-length antibodies.
  • the serine residue at position 228 was substituted with proline (Angal et al., Mol. Immunol. 30:105-108 (1993)).
  • CHO cells were transfected with the corresponding expression plasmids using a standard protein expression system.
  • the corresponding antibody supernatants were purified using standard protein A purification column chromatography.
  • Example 3 Screening of antibody repertoires for binding to cell surface-expressed PD-1
  • CHO-S cells were transfected in 384-well format to express full-length human PD-1 using the FreestyleTM MAX reagent (Invitrogen, Cat. No. 16447-100), and non-transfected cells were used as negative control.
  • non-transfected cells were labeled using CFSE and mixed with non-labeled PD-1 -transfected cells at a ratio of 1 to 1 , and a density of 1 E6 cells per ml, each.
  • Figures 3A-3C show representative flow cytometry dot plots for (A) an antibody clone that specifically binds to human PD-1 -transfected cells, (B) a clone that non- specifically binds to CHO-S cells, and (C) a clone that does not bind either of the cell populations used in the screening.
  • the selected human amino acid sequences for J-gene region humanization were derived from IGHJ1 * 01 (J00256) and IGLJ6 * 01 (M18338) for V H and V L , respectively.
  • the antibody V H and V L genes were aligned against chicken immunoglobulin germline genes to identify somatic mutations in the framework regions that may play a role in antibody function and/or structure. Such residues may be included in the final humanized antibody genes as so-called "back mutation” residues.
  • some amino acid positions, so- called “Vernier residues” so- called “Vernier residues” (Foote and Winter, J Mol Biol. 224(2):487-99 (1992)), that are known to play an important role in antibody structure, stability and function, were considered to generate alternative humanized antibody variants including either human or chicken residues from the corresponding germlines.
  • the CDR sequences herein were determined according to the IMGT ® definitions for CDR1 and CDR2.
  • the definitions herein include one extra amino acid residue upstream of the IMGT-CDR3 (Cys) and one extra amino acid residue downstream (Trp for V H CDR3, Phe for V L CDR3).
  • the expression vector also contained the necessary regulatory sequences, allowing
  • the final humanized antibody sequences are shown below in Table 4, and the CDR sequences are shown separately in Table 5.
  • the CDR sequences are defined in the Tables in accordance with the IMGT ® numbering scheme.
  • All of the humanized antibodies comprised the lgG1 "LALA” variant heavy chain constant region and light chain constant region amino acid sequences shown below.
  • PD-1 is mainly expressed on the surface of activated T-lymphocytes, where it negatively regulates T-cell activity.
  • SEB Staphylococcus Enterotoxin B
  • SEB is a super-antigen that binds to MHC class II molecules and specific ⁇ regions of T cell receptors (TCR) and drives non-specific stimulation of T-cells. This results in polyclonal T cell activation/proliferation and release of cytokines including IL-2 and IFN- ⁇ .
  • the top 10 anti-PD-1 antibody lead candidates were identified.
  • the anti-PD-1 antibody lead candidates were then further titrated to obtain dose-response curves for each individual antibody in comparison with the positive controls, reference analogues of the anti-PD-1 antibodies pembrolizumab (Merck) and nivolumab (Bristol- Myers Squibb); see Example 2.
  • the functionality of the top 10 selected anti-PD-1 antibodies was validated in an alternative in vitro assay, the one-way mixed lymphocyte reaction (MLR) assay.
  • MLR mixed lymphocyte reaction
  • DCs dendritic cells
  • CD4 + T-cells from another donor were co-cultured with CD4 + T-cells from another donor to obtain alloantigen specific stimulation, induced in 10-15% of all T-cells, leading to T-cell activation/proliferation and cytokine secretion.
  • Figures 5A-H shows the results obtained with the humanized anti-PD-1 antibodies. Due to aggregation above 5% for one of the antibodies [12748.15381 ], an alternative framework for this antibody was tested. Data in Figure 5I shows similar functionality of the original humanized antibody [12748.15381] and its germline
  • the functionality of the anti-PD-1 antibodies was validated in a one-way MLR assay.
  • dendritic cells and CD4 + T cells ratio 1 :10 from two different donors were co-cultured, and IFN- ⁇ secretion was measured by MesoScale after 5 days. Each data point represents an average of six replicates, with the bars indicating the SEM.
  • the data obtained from the one-way MLR assay and illustrated in Figures 6A-H show the same functionality and ranking of the anti-PD-1 antibodies as the data obtained from the SEB assay. This consistency in data between different assays provides further confirmation that the selected antibodies are functional.
  • the selected antibodies originate from two different main epitope bins, indicating that they bind to two different non-overlapping epitopes. All of the anti-PD-1 antibodies shown belong to Bin 1 , except for 12760 and 131 12 antibodies, which belong to Bin 2. It was found that the anti-PD-1 antibodies from Bin 1 show the highest functionality in these in vitro assays.
  • Example 6 Flow cytometric analysis of anti-PD-1 antibodies for PD-L1 ligand blocking activity
  • This example illustrates how the panel of anti-PD-1 antibodies was tested for PD- L1 ligand blocking activity by performing a flow cytometric competition assay using cell surface-expressed PD-1 and fluorochrome-labeled soluble PD-L1 .
  • PD-L1 ligand blocking activity was investigated in a multiplex cellular assay, in which human and cynomolgus PD-1 were recombinantly expressed on CHO-S cells and binding of R-PE (R-phycoerythrin) labeled human PD-L1 -Fc chimera protein was analyzed by flow cytometry.
  • R-PE R-phycoerythrin
  • Commercially available recombinant PD-L1 -Fc chimera protein was conjugated to R-PE using the Lightning-Link ® R-Phycoerythrin Conjugation Kit (Innova Biosciences, UK).
  • CHO-S cells transiently transfected to express human PD-1 were mixed with CFSE-stained CHO-S cells transiently expressing
  • the humanized variants shown in Table 6 have the same amino acid sequences as those in Table 1 sharing the first 5 digits in their names, except that the variants in Table 1 have amino acid residues "SY" at the N-terminus of the light chain.
  • the SY dipeptide improves signal peptide processing during expression of the antibody light chain.
  • the variants in Tables 1 and 6 are expected to have identical functional properties.
  • Binding kinetics were measured under monovalent antigen conditions by immobilizing anti-PD-1 antibodies and keeping the monovalent PD-1 antigen in solution as described previously (Canziani et al., Anal Biochem 325(2):301 -307 (2004)). The lowest possible anti-PD-1 antibody density was applied to prevent non-specific binding and mass transport limitation.
  • anti-PD-1 antibodies were adjusted to a concentration of 1 .0 pg/irnl and captured on anti-human IgG Fc surfaces generated by immobilizing approximately 1000 RU of a monoclonal anti-human Fc antibody (Biacore, Denmark).
  • Anti-PD-1 antibodies were tested for binding to human or cynomolgus PD-1 ECD in a 3-fold concentration range from 25 nM to 0.31 nM followed by regeneration of the surfaces with 3 M MgCI2 regeneration buffer (Biacore, Denmark). A high flow rate of 20 ⁇ /min, an association time of 3.33 min and a dissociation time between 1 .5 hours and 2.75 hours was employed. The recorded binding responses were fitted to a simple Langmuir 1 :1 binding model for calculation of the on-rate (k on or ka), off-rate (k 0ff or kd) and affinity (K D ) constants using double referencing.
  • pembrolizumab analogues The highest affinity antibody [12819.15384] binds human PD- 1 with a K D of 20 pM.
  • Antibody PD-1 ECD kon (M-1 s-1) kon koff (s-1) koff K D (pM)
  • Example 8 Epitope binning of anti-PD-1 antibodies
  • This example illustrates how the PD-1 antibodies were grouped into epitope bins based on paired competition patterns. Antibodies belonging to different epitope bins recognize different epitopes on PD-1 ECD.
  • Antibodies were spotted onto an E2S SensEye® and conjugated for 15 minutes using a Continuous Flow Microspotter. After spotting, the SensEye® was positioned in the IBIS MX96 biosensor and deactivated with 1 M ethanolamine, pH 8.5 for 10 minutes. After sensor preparation, antibody competition analysis was performed using a classical sandwich assay. Monovalent PD-1 ECD antigen (Sino Biological, China) was diluted in HBS-EP running buffer and injected at 50 nM concentration and captured by the conjugated array of anti-PD-1 antibodies. Next, individual injections of each of the ten PD- 1 antibodies diluted to 100 nM in HBS-EP running buffer were performed to establish antibody competition patterns. After each competition cycle, the sensor surface was regenerated with 10 mM Glycine HCI buffer, pH 2.0.
  • 12760 and 131 12 were found to bind a separate epitope Bin 2 because they cross blocked each other, but did not block the binding of any of the antibodies from epitope Bin 1 . Consequently 12760 and 131 12 likely bind to a different site on PD-1 that does not overlap with the PD-L1 and PD-L2 ligand binding site.
  • the cross blocking functional antibodies 12819, 12865, 12892, 12777, nivolumab and pembrolizumab belonging to epitope Bin 1 could be further subdivided into four sub- bins based on competition with 12866 and 12807 ( Figure 8).
  • 12819 (Bin 1 C) was the only antibody that blocked the binding of both 12866 and 12807, while nivolumab (Bin 1 D) only blocked 12866 and pembrolizumab (Bin 1 F) only blocked 12807.
  • the group of antibodies belonging to Bin 1 E (12865, 12892 and 12777) was unique in that they did not block the binding of either 12866 or 12807.
  • Example 9 Measurement of PD-1 antibody cross reactivity to mouse and rat PD-1 ECD antigen
  • His-tagged mouse and rat PD-1 ECD were purchased from Sino Biologicals. Kinetic binding analysis was conducted as described in Example 7.
  • the binding kinetics are tabulated in Table 8 below.
  • the anti-PD-1 antibody 12819.15384 binds mouse PD-1 with a K D of 809 pM but does not recognized rat PD-1 .
  • the affinity to human PD-1 ECD was similar to that measured in Example 7.
  • Antibody 12865.17150 did not bind mouse or rat PD-1 .
  • Neither of nivolumab and pembrolizumab reference analogues cross- reacted with mouse or rat PD-1 (data not shown).
  • This example illustrates how the panel of anti-PD-1 antibodies was analyzed for PD-L1 or PD-L2 ligand blocking activity by performing a competition assay using Bio-Layer Interferometry analysis.
  • ligand blocking activity of PD-L1 or PD-L2 was assessed by incubation with human PD-L1 or PD-L2 Fc fusion proteins (Sino Biological) tested at 5 g/ml.
  • Example 11 Epitope mapping of anti-PD-1 antibodies by PD-1 mutagenesis
  • Antibody epitopes can generally be characterized as linear epitopes (also termed continuous epitopes) or conformational epitopes (also termed discontinuous epitopes). While linear epitopes are defined based on a single continuous amino acid sequence, conformational epitopes may consist of many smaller discontinuous linear sequences or single contact residues. A collection of contact residues that cluster at the intermolecular protein interface between the antibody and the antigen is also termed a hot spot or core epitope (Moreira et al., Proteins 68(4):803-12 (2007)). It is now widely acknowledged that most B-cell epitopes are discontinuous in nature (Sivalingam and Shepherd, Mol Immunol.
  • this example illustrates how the binding epitopes of 12819 and 12865 antibodies can be divided into linear epitopes and hotspots that are distinct from the epitopes recognized by nivolumab and pembrolizumab.
  • the human PD-1 receptor consists of an extracellular domain of 268 amino acids (residues 21 -288).
  • the extracellular domain spans amino acids 21 -170 followed by a transmembrane domain (residues 171 -191 ) and a cytoplasmic domain (residues 192-288).
  • PD-1 belongs to the immunoglobulin superfamily and is composed of a two layer ⁇ - sandwich made from interactions of 8 anti-parallel ⁇ -strands arranged into two ⁇ -sheets with GFCC ⁇ -strands on one side and ABED ⁇ -strands on the opposing side. The two ⁇ - sheets are stabilized by a disulphide bond between residues C54 - C123.
  • Human PD-1 binds human PD-L1 or PD-L2 ligands in a 1 :1 stoichiometry and binding mainly occurs at overlapping binding sites mediated by the GFCC ⁇ -sheet (Cheng et al., J Biol Cftem 288(17):1 1771 -1 1785 (2013)) ( Figure 9, panels A and B).
  • Human PD-L1 binds human PD-1 through contact residues V64, N66, Y68 situated in the C ⁇ -strand and G124, 1126, L128, A132, 1134 and E136 located in the F and G ⁇ -strands (Zak et. al., Structure 23(12):2341 -8 (2015)).
  • Human PD-L1 and PD-L2 bind human PD-1 with K D s of 8 ⁇ and 2 ⁇ , respectively (Cheng et. al., supra).
  • the protein sequence of human PD-1 was downloaded from Uniprot (Accession No. Q151 16; the amino acid sequence is represented in SEQ ID NO: 1 ).
  • the full-length Macaca fascicularis protein sequence was downloaded from Uniprot (Accession No.
  • B0LAJ3_MACFA (SEQ ID NO: 89)).
  • the full-length protein sequences of Gallus galus, Mus musculus and Rattus norvegicus PD-1 were downloaded from NCBI (XP_422723. (SEQ ID NO: 90), NP_032824.1 (SEQ ID NO: 91 ) and XP_006245633.1 (SEQ ID NO: 92), respectively).
  • the sequence identities of the different PD-1 extracellular amino acid sequences as compared to human PD-1 are shown in Table 10 below.
  • a molecular model of human PD-1 was built by combining structural information from the crystal structure of human PD-1 :Human PD-L1 complex determined at 2.45 A resolution (PDB 4ZQK) and a NMR structure of APO human PD-1 (PDB 2M2D).
  • the structure PDB 4ZQK was used as the basis for the model with the missing CD loop and c- terminal part of PD-1 provided from the NMR structure.
  • surface exposed amino acid residues were highlighted and 83 individual alanine substitutions were designed on surface exposed residues on human PD-1 ECD (alanine scanning) and 5 exposed residue positions that differed between human, mouse and rat PD-1 were back-mutated to rat PD- 1 residues.
  • the PD-1 cDNA coding for the extracellular domain of human PD-1 was synthesized and cloned into a vector containing CMV promoter and human Igd Fc sequence (residues P101 -K330) resulting in fusion of Igd Fc C-terminally to the cloned PD-1 ECD.
  • the mutated human PD-1 Fc fusion constructs were generated by standard PCR and engineering techniques and protein was expressed transiently in 2 ml culture using an ExpiCHOTM expression system.
  • the human PD-1 Fc fusion constructs were harvested after 9 days and supernatants were tested for binding affinity to anti-PD-1 Fabs by Surface Plasmon Resonance (SPR). Culture supernatants containing PD-1 fusion proteins were immobilized onto an G-a-hu-lgG Fc SensEye® (Ssens BV, The
  • the core epitope of nivolumab (Figure 9, panel D) was present on the end of the F ⁇ -strand and on the whole G ⁇ -strand covering some of the reported PD-1 contact residues utilized by human PD-L1 .
  • the core epitopes of 12819 and 12865 ( Figure 9, panels E and F) were located on the F and G ⁇ -strands covering more area than nivolumab and overlapping with all reported contact residues for human PD-L1 in this region. 12865 was also very sensitive for mutations at residues 69-75.
  • 12819 also shared one contact residue with pembrolizumab (V64) on the C ⁇ -strand that has also been reported to be a contact residue for human PD-L1 .
  • Both 12819 and 12865 shared linear epitopes that mapped to the C and C ⁇ -strands and some of the CD Loop. Apart from residue V64, no other contact residues were shared between tested antibodies.
  • the non- ligand blocking antibody 131 12 was shown by alanine scanning to map to a region distant from the PD-L1 and PD-L2 ligand blocking site ( Figure 9, panel G).
  • this example illustrates that although 12819, 12865, nivolumab and pembrolizumab bind to overlapping epitopes on human PD-1 that can block the binding of PD-L1 and PD-L2 ligands, each antibody has a distinct binding epitope as evidenced from competition binding analysis (epitope binning, Example 8) and shown at a molecular level by mapping individual linear epitopes and contact residues with a panel of 1 1 1 PD-1 mutants as summarized in Table 13.
  • 12819 is also the only antibody in the investigated anti-PD-1 panel that cross-reacts with mouse PD-1 ECD (K D of 809 pM, Example 9), highlighting that the binding epitope of this antibody is unique compared to the other tested PD-1 antibodies.
  • Example 12 In vivo efficacy of a 12819 antibody in four syngeneic murine tumor models
  • This example demonstrates the in vivo efficacy of a 12819 antibody in four syngeneic murine tumor models.
  • mice were treated three times weekly with a total of six treatments by intraperitoneal injection of vehicle buffer or the monoclonal antibody 12819.17149 followed by an observation period.
  • the antibody treatments were dosed at 10 mg/kg.
  • Two-way ANOVA with Bonferroni's multiple comparisons test was applied to compare tumor volumes at each time-point between treatment groups.
  • Statistical analyses were performed using GraphPad Prism version 5.0 (GraphPad Software, Inc.).
  • Example 13 In vivo efficacy of a 12819 antibody in a semi-humanized xenograft tumor model with a mixture of CD8 + /CD4 + T cells and A375 melanoma cells
  • This example demonstrates the in vivo efficacy of a 12819 antibody in a semi- humanized xenograft tumor model, where the human melanoma cell line A375 was mixed with purified human CD8 + and CD4 + T cells.
  • CD8 + and CD4 + T cells were isolated from a human PBMC donor and mixed with 2.05x10 6 A375 (human melanoma) cancer cells prior to subcutaneous inoculation into the flank of 6-8 week old female NODsc/c/ mice. Treatment was initiated on the day of tumor inoculation and the mice were treated three times weekly for a total of six treatments by intraperitoneal injection of vehicle buffer, Keytruda® (pembrolizumab) (10 mg/kg), or the monoclonal antibody 12819.17149 (10 mg/kg) followed by an
  • SEQ ID NO: 1 Human PD-1 polypeptide, Uniprot Accession No. Q151 16
  • SEQ ID NO: 2 Humanized [12819.15384] V H amino acid sequence
  • SEQ ID NO: 4 Humanized [12748.15381 ] and [12748.16124] V H amino acid sequence
  • SEQ ID NO: 5 Humanized [12748.15381 ] V L amino acid sequence
  • SEQ ID NO: 7 Humanized [12865.15377] V L amino acid sequence
  • SEQ ID NO: 8 Humanized [12892.15378] V H amino acid sequence
  • SEQ ID NO: 10 Humanized [12796.15376] V H amino acid sequence
  • SEQ ID NO: 12 Humanized [12777.15382] V H amino acid sequence
  • SEQ ID NO: 13 Humanized [12777.15382] V L amino acid sequence
  • SEQ ID NO: 14 Humanized [12760.15375] V H amino acid sequence
  • SEQ ID NO: 15 Humanized [12760.15375] V L amino acid sequence
  • SEQ ID NO: 16 Humanized [131 12.15380] V H amino acid sequence
  • SEQ ID NO: 24 (12748 HCDR1 amino acid sequence)
  • GFTFSDYA SEQ ID NO: 25 (12748 HCDR2 amino acid sequence)
  • SEQ ID NO: 26 (12748 HCDR3 amino acid sequence)
  • SEQ ID NO: 27 (12748 LCDR1 amino acid sequence)
  • SEQ ID NO: 28 (12748 LCDR2 amino acid sequence)
  • SEQ ID NO: 29 (12748 LCDR3 amino acid sequence)
  • SEQ ID NO: 42 (12796 HCDR1 amino acid sequence)
  • SEQ ID NO: 44 (12796 HCDR3 amino acid sequence)
  • SEQ ID NO: 45 (12796 LCDR1 amino acid sequence)
  • SEQ ID NO: 46 (12796 LCDR2 amino acid sequence)
  • SEQ ID NO: 47 (12796 LCDR3 amino acid sequence)
  • SEQ ID NO: 65 (131 12 LCDR3 amino acid sequence)
  • SEQ ID NO: 68 Light chain lambda constant region amino acid sequence
  • GQPKANPTVTLFPPSSEELQANKATLVCLI SDFYPGAVTVAWKADGSPVKAGVE KPSKQSNNKY AASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
  • SEQ ID NO: 70 Humanized [12819.15384] V L DNA sequence
  • SEQ ID NO: 71 Humanized [12748.15381 ] and [12748.16124] V H DNA sequence
  • SEQ ID NO: 72 Humanized [12748.15381 ] V L DNA sequence
  • SEQ ID NO: 75 Humanized [12892.15378] V H DNA sequence
  • SEQ ID NO: 78 Humanized [12796.15376] V L DNA sequence
  • SEQ ID NO: 80 Humanized [12777.15382] V L DNA sequence
  • SEQ ID NO: 81 Humanized [12760.15375] V H DNA sequence
  • SEQ ID NO: 82 Humanized [12760.15375] V L DNA sequence
  • SEQ ID NO: 85 Humanized [12748.16124] V L DNA sequence (alternative germline)
  • SEQ ID NO: 86 Heavy chain constant region genomic DNA sequence with introns included
  • SEQ ID NO: 88 Light chain lambda constant region DNA sequence
  • SEQ ID NO: 90 (Gallus Gallus PD-1 polypeptide, NCBI Accession No. XP_422723.3)
  • SEQ ID NO: 92 (Rattus norvegicus PD-1 polypeptide, NCBI Accession No.
  • PVLLLLAWAL AVFCSTSMSE ARGAGSKDDT LKEEPSAAPV PSVAYEELDF QGREKTPELP

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Immunology (AREA)
  • Organic Chemistry (AREA)
  • Medicinal Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Biochemistry (AREA)
  • Genetics & Genomics (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biophysics (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Epidemiology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Microbiology (AREA)
  • Mycology (AREA)
  • Engineering & Computer Science (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Acyclic And Carbocyclic Compounds In Medicinal Compositions (AREA)
PCT/EP2016/073421 2015-10-02 2016-09-30 Anti-pd-1 antibodies and compositions Ceased WO2017055547A1 (en)

Priority Applications (25)

Application Number Priority Date Filing Date Title
MX2018003936A MX2018003936A (es) 2015-10-02 2016-09-30 Anticuerpos anti proteina de muerte celular programada 1 (pd-1) y composiciones.
MYPI2018701111A MY190324A (en) 2015-10-02 2016-09-30 Anti-pd-1 antibodies and compositions
SI201631586T SI3368572T1 (sl) 2015-10-02 2016-09-30 Protitelesa proti PD-1 in sestavki
HRP20221041TT HRP20221041T1 (hr) 2015-10-02 2016-09-30 Anti-pd-1 antitijela i sastavi
DK16774691.6T DK3368572T3 (da) 2015-10-02 2016-09-30 Anti-pd-1-antistoffer og -sammensætninger
AU2016333517A AU2016333517B2 (en) 2015-10-02 2016-09-30 Anti-PD-1 antibodies and compositions
EP22174837.9A EP4105235A1 (en) 2015-10-02 2016-09-30 Anti-pd-1 antibodies and compositions
KR1020187011821A KR102897330B1 (ko) 2015-10-02 2016-09-30 항-pd-1 항체 및 조성물
EP16774691.6A EP3368572B2 (en) 2015-10-02 2016-09-30 Anti-pd-1 antibodies and compositions
BR112018006257-0A BR112018006257B1 (pt) 2015-10-02 2016-09-30 Anticorpo anti-pd-1 ou porção de ligação ao antígeno do mesmo, seu método de produção, seu uso, composição farmacêutica, moléculas de ácido nucleico isoladas, vetor, molécula de ligação biespecífica e seu uso
PL16774691.6T PL3368572T3 (pl) 2015-10-02 2016-09-30 Przeciwciała anty-PD-1 oraz kompozycje
LTEPPCT/EP2016/073421T LT3368572T (lt) 2015-10-02 2016-09-30 Anti-pd-1 antikūnai ir kompozicijos
ES16774691T ES2924402T3 (es) 2015-10-02 2016-09-30 Anticuerpos anti-PD-1 y composiciones
IL258214A IL258214B2 (en) 2015-10-02 2016-09-30 Antibodies - anti pd-1 and preparations
CN201680069542.1A CN108290953B (zh) 2015-10-02 2016-09-30 抗pd-1抗体和组合物
JP2018516765A JP6875385B2 (ja) 2015-10-02 2016-09-30 抗pd−1抗体および組成物
RU2018115979A RU2750675C1 (ru) 2015-10-02 2016-09-30 Антитела против pd-1 и композиции
RS20220762A RS63490B1 (sr) 2015-10-02 2016-09-30 Anti-pd-1 antitela i kompozicije
NZ740869A NZ740869B2 (en) 2016-09-30 Anti-pd-1 antibodies and compositions
CA3000564A CA3000564C (en) 2015-10-02 2016-09-30 Anti-pd-1 antibodies and compositions
US15/765,337 US11034765B2 (en) 2015-10-02 2016-09-30 Anti-PD-1 antibodies and compositions
ZA2018/01852A ZA201801852B (en) 2015-10-02 2018-03-20 Anti¿pd¿1 antibodies and compositions
SA518391262A SA518391262B1 (ar) 2015-10-02 2018-04-02 Pd-1 أجـسـام مـضـادة لـ وتـركـيـبـات
CONC2018/0003500A CO2018003500A2 (es) 2015-10-02 2018-04-02 Anticuerpos anti-pd-1 y composiciones
US17/324,508 US12030942B2 (en) 2015-10-02 2021-05-19 Anti-PD-1 antibodies and compositions

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201562236341P 2015-10-02 2015-10-02
US62/236,341 2015-10-02

Related Child Applications (3)

Application Number Title Priority Date Filing Date
US15/765,337 A-371-Of-International US11034765B2 (en) 2015-10-02 2016-09-30 Anti-PD-1 antibodies and compositions
US17/324,508 Continuation-In-Part US12030942B2 (en) 2015-10-02 2021-05-19 Anti-PD-1 antibodies and compositions
US17/324,508 Division US12030942B2 (en) 2015-10-02 2021-05-19 Anti-PD-1 antibodies and compositions

Publications (1)

Publication Number Publication Date
WO2017055547A1 true WO2017055547A1 (en) 2017-04-06

Family

ID=57042898

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2016/073421 Ceased WO2017055547A1 (en) 2015-10-02 2016-09-30 Anti-pd-1 antibodies and compositions

Country Status (27)

Country Link
US (1) US11034765B2 (https=)
EP (2) EP3368572B2 (https=)
JP (1) JP6875385B2 (https=)
KR (1) KR102897330B1 (https=)
CN (1) CN108290953B (https=)
AU (1) AU2016333517B2 (https=)
CO (1) CO2018003500A2 (https=)
CY (1) CY1125327T1 (https=)
DK (1) DK3368572T3 (https=)
ES (1) ES2924402T3 (https=)
HR (1) HRP20221041T1 (https=)
HU (1) HUE059788T2 (https=)
IL (1) IL258214B2 (https=)
LT (1) LT3368572T (https=)
MX (1) MX2018003936A (https=)
MY (1) MY190324A (https=)
PE (1) PE20181044A1 (https=)
PL (1) PL3368572T3 (https=)
PT (1) PT3368572T (https=)
RS (1) RS63490B1 (https=)
RU (1) RU2750675C1 (https=)
SA (1) SA518391262B1 (https=)
SG (1) SG10201912943RA (https=)
SI (1) SI3368572T1 (https=)
TW (1) TWI751981B (https=)
WO (1) WO2017055547A1 (https=)
ZA (1) ZA201801852B (https=)

Cited By (65)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2017220988A1 (en) 2016-06-20 2017-12-28 Kymab Limited Multispecific antibodies for immuno-oncology
WO2018085358A1 (en) * 2016-11-02 2018-05-11 Jounce Therapeutics, Inc. Antibodies to pd-1 and uses thereof
WO2018185232A1 (en) 2017-04-05 2018-10-11 Symphogen A/S Combination therapies targeting pd-1, tim-3, and lag-3
US10323091B2 (en) 2015-09-01 2019-06-18 Agenus Inc. Anti-PD-1 antibodies and methods of use thereof
US10428145B2 (en) 2015-09-29 2019-10-01 Celgene Corporation PD-1 binding proteins and methods of use thereof
WO2019217457A1 (en) 2018-05-07 2019-11-14 Genmab A/S Methods of treating cancer with a combination of an anti-pd-1 antibody and an anti-tissue factor antibody-drug conjugate
US10493148B2 (en) 2018-03-02 2019-12-03 Eli Lilly And Company PD-1 agonist antibodies and uses thereof
WO2019241758A1 (en) * 2018-06-15 2019-12-19 Alpine Immune Sciences, Inc. Pd-1 variant immunomodulatory proteins and uses thereof
US10513558B2 (en) 2015-07-13 2019-12-24 Cytomx Therapeutics, Inc. Anti-PD1 antibodies, activatable anti-PD1 antibodies, and methods of use thereof
WO2020056085A1 (en) * 2018-09-14 2020-03-19 The Board Of Trustees Of The Leland Stanford Junior University Spd-1 variant - fc fusion proteins
EP3613768A4 (en) * 2017-04-20 2020-06-17 Suzhou Stainwei Biotech Inc. MONOCLONAL ANTIBODIES AS ANTAGONISTS AND INHIBITATION OF THE BINDING BETWEEN HUMAN PD-1 ANTIGENS AND LIGAND THEREOF, PRODUCTION METHOD THEREFOR AND APPLICATION THEREOF
WO2020127367A1 (en) * 2018-12-21 2020-06-25 Ose Immunotherapeutics Humanized anti-human-pd-1 antibody
US10751414B2 (en) 2016-09-19 2020-08-25 Celgene Corporation Methods of treating psoriasis using PD-1 binding antibodies
US10766958B2 (en) 2016-09-19 2020-09-08 Celgene Corporation Methods of treating vitiligo using PD-1 binding antibodies
JP2020529862A (ja) * 2017-06-25 2020-10-15 システィミューン, インク.Systimmune, Inc. 抗pd−1抗体とその作製及び使用方法
US10882914B2 (en) 2016-04-15 2021-01-05 Alpine Immune Sciences, Inc. ICOS ligand variant immunomodulatory proteins and uses thereof
WO2021006199A1 (ja) 2019-07-05 2021-01-14 小野薬品工業株式会社 Pd-1/cd3二重特異性タンパク質による血液がん治療
WO2021025140A1 (ja) 2019-08-08 2021-02-11 小野薬品工業株式会社 二重特異性タンパク質
WO2021044005A1 (en) 2019-09-06 2021-03-11 Symphogen A/S Anti-cd73 antibodies
US11008391B2 (en) 2015-08-11 2021-05-18 WuXi Biologics Ireland Limited Anti-PD-1 antibodies
US11078282B2 (en) 2016-04-15 2021-08-03 Alpine Immune Sciences, Inc. CD80 variant immunomodulatory proteins and uses thereof
US11096988B2 (en) 2017-03-16 2021-08-24 Alpine Immune Sciences, Inc. CD80 variant immunomodulatory proteins and uses thereof
JP2021130686A (ja) * 2017-08-24 2021-09-09 コルマー コリア カンパニー リミテッドKolmar Korea Co., Ltd. 細胞受容体結合親和性のあるペプチドを含むマイクロカプセル及びこれを含む化粧料組成物
US20210355185A1 (en) * 2019-10-03 2021-11-18 Xencor, Inc. Targeted il-12 heterodimeric fc-fusion proteins
CN113896797A (zh) * 2017-08-01 2022-01-07 Ab工作室有限公司 双特异性抗体及其用途
US11319359B2 (en) 2015-04-17 2022-05-03 Alpine Immune Sciences, Inc. Immunomodulatory proteins with tunable affinities
WO2022108931A2 (en) 2020-11-17 2022-05-27 Seagen Inc. Methods of treating cancer with a combination of tucatinib and an anti-pd-1/anti-pd-l1 antibody
EP3837354A4 (en) * 2018-08-16 2022-06-01 Musc Foundation for Research Development RECOMBINANT MYXOMA VIRUSES AND THEIR APPLICATIONS
US11359018B2 (en) 2016-11-18 2022-06-14 Symphogen A/S Anti-PD-1 antibodies and compositions
EP3823991A4 (en) * 2018-07-19 2022-08-03 Tayu Huaxia Biotech Medical Group Co., Ltd. ANTI-PD-1 ANTIBODIES, DOSAGE FORMS AND USES THEREOF
US11414487B2 (en) 2016-09-21 2022-08-16 Cstone Pharmaceuticals Monoclonal antibodies to programmed death 1 (PD-1)
WO2022254227A1 (en) 2021-06-04 2022-12-08 Kymab Limited Treatment of pd-l1 negative or low expressing cancer with anti-icos antibodies
EP3901172A4 (en) * 2018-12-21 2023-01-11 Sinocelltech Ltd. HUMANIZED ANTI-PD-1 ANTIBODIES AND THEIR USE
WO2023285552A1 (en) 2021-07-13 2023-01-19 BioNTech SE Multispecific binding agents against cd40 and cd137 in combination therapy for cancer
US11560430B2 (en) 2017-01-20 2023-01-24 Tayu Huaxia Biotech Medical Group Co., LTD Anti-PD-1 antibodies and uses thereof
US11613566B2 (en) 2017-10-18 2023-03-28 Alpine Immune Sciences, Inc. Variant ICOS ligand immunomodulatory proteins and related compositions and methods
WO2023057534A1 (en) 2021-10-06 2023-04-13 Genmab A/S Multispecific binding agents against pd-l1 and cd137 in combination
WO2023057381A1 (en) 2021-10-04 2023-04-13 Les Laboratoires Servier Cancer therapy targeting nkg2a
WO2023083868A1 (en) 2021-11-09 2023-05-19 BioNTech SE Tlr7 agonist and combinations for cancer treatment
EP3931223A4 (en) * 2019-04-10 2023-07-12 Bio-Thera Solutions, Ltd. ANTIBODIES BINDING TO PD-1
WO2023218046A1 (en) 2022-05-12 2023-11-16 Genmab A/S Binding agents capable of binding to cd27 in combination therapy
EP4101464A4 (en) * 2020-02-07 2024-04-03 Shanghai Junshi Biosciences Co., Ltd. USE OF ANTI-PD-1 ANTIBODIES FOR THE TREATMENT OF MALIGNANT TUMORS
US11993653B2 (en) 2016-12-07 2024-05-28 Agenus Inc. Antibodies and methods of use thereof
WO2024115725A1 (en) 2022-12-01 2024-06-06 BioNTech SE Multispecific antibody against cd40 and cd137 in combination therapy with anti-pd1 ab and chemotherapy
US12030942B2 (en) 2015-10-02 2024-07-09 Les Laboratoires Servier Anti-PD-1 antibodies and compositions
EP4204454A4 (en) * 2020-08-31 2024-07-24 Biosion, Inc. PD-1 BINDING ANTIBODIES AND THEIR USES
WO2024160721A1 (en) 2023-01-30 2024-08-08 Kymab Limited Antibodies
WO2024209072A1 (en) 2023-04-06 2024-10-10 Genmab A/S Multispecific binding agents against pd-l1 and cd137 for treating cancer
US12239688B2 (en) 2018-04-18 2025-03-04 Xencor, Inc. IL-15/IL-15RA heterodimeric Fc fusion proteins and uses thereof
US12246025B2 (en) 2018-03-21 2025-03-11 Genmab A/S Methods of treating cancer with a combination of a platinum-based agent and an anti-tissue factor antibody-drug conjugate
US12297253B2 (en) 2018-01-03 2025-05-13 Alpine Immune Sciences, Inc. Multi-domain immunomodulatory proteins and methods of use thereof
US12312405B2 (en) 2020-05-26 2025-05-27 Boehringer Ingelheim International Gmbh Anti-PD-1 antibodies
US12319735B2 (en) 2018-11-07 2025-06-03 Merck Sharp & Dohme Llc Co-formulations of anti-LAG3 antibodies and anti-PD-1 antibodies
WO2025114541A1 (en) 2023-11-30 2025-06-05 Genmab A/S Antibodies capable of binding to ox40 in combination therapy
US12324841B2 (en) 2018-05-07 2025-06-10 Genmab A/S Methods of treating cancer with a combination of an anti-PD-1 antibody and an anti-tissue factor antibody-drug conjugate
US12410258B2 (en) 2023-05-12 2025-09-09 Ganmab A/S Antibodies capable of binding to OX40, variants thereof and uses thereof
US12448423B2 (en) 2018-12-20 2025-10-21 Xencor, Inc. Targeted heterodimeric Fc fusion proteins containing NKG2D antigen binding domains
US12448448B2 (en) 2018-06-20 2025-10-21 Incyte Corporation Anti-PD-1 antibodies and uses thereof
US12453781B2 (en) 2018-10-30 2025-10-28 Genmab A/S Methods of treating cancer with a combination of an anti-VEGF antibody and an anti-tissue factor antibody-drug conjugate
US12463463B2 (en) 2019-01-28 2025-11-04 Ab Therapeutics, Inc. Bispecific antibodies and uses thereof
US12509495B2 (en) 2018-04-18 2025-12-30 Xencor, Inc. LAG-3 targeted heterodimeric fusion proteins containing IL-15/IL-15RA Fc-fusion proteins and LAG-3 antigen binding domains
US12552853B2 (en) 2018-11-30 2026-02-17 Alpine Immune Sciences, Inc. CD86 variant immunomodulatory proteins and uses thereof
US12570751B2 (en) 2017-08-04 2026-03-10 Genmab A/S Binding agents binding to PD-L1 and CD137 and use thereof
US12576159B2 (en) 2018-10-31 2026-03-17 Merck Sharp & Dohme Llc Anti-human PD-1 antibody crystals and methods of use thereof
KR102956921B1 (ko) 2018-12-21 2026-04-23 오제 이뮈노테라프틱스 인간화된 항-인간-pd-1 항체

Families Citing this family (22)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
PE20181326A1 (es) 2015-11-03 2018-08-20 Janssen Biotech Inc Anticuerpos que se unen especificamente a pd-1 y sus usos
US12398209B2 (en) 2018-01-22 2025-08-26 Janssen Biotech, Inc. Methods of treating cancers with antagonistic anti-PD-1 antibodies
JP7090204B2 (ja) * 2018-07-19 2022-06-23 イーライ リリー アンド カンパニー 免疫チェックポイントを標的とする二重特異性抗体
AU2019359475A1 (en) * 2018-10-12 2021-05-20 Xencor, Inc. PD-1 targeted IL-15/IL-15Ralpha Fc fusion proteins and uses in combination therapies thereof
CN112915202B (zh) * 2019-12-06 2025-08-01 正大天晴药业集团股份有限公司 喹啉衍生物与pd-1单抗的药物组合
US11807688B2 (en) * 2020-02-28 2023-11-07 Les Laboratoires Servier Anti-AXL antibodies and compositions
US20230348902A1 (en) * 2020-08-10 2023-11-02 Integral Molecular, Inc. Methods and compositions for making antibody libraries and antibodies isolated from the same
KR102661163B1 (ko) * 2021-02-04 2024-04-26 주식회사 지뉴브 항 pd-1 항체 및 그의 용도
AU2022314734A1 (en) 2021-07-19 2024-02-08 Regeneron Pharmaceuticals, Inc. Il12 receptor agonists and methods of use thereof
KR20240046251A (ko) 2021-08-16 2024-04-08 리제너론 파아마슈티컬스, 인크. 신규 il27 수용체 효능제 및 그의 사용 방법
KR20250024872A (ko) 2022-05-11 2025-02-19 리제너론 파마슈티칼스 인코포레이티드 다중특이적 결합 분자 전구단백질 및 이의 용도
CA3257348A1 (en) 2022-05-27 2023-11-30 Regeneron Pharmaceuticals, Inc. INTERLEUKIN-2 PROPROTEINS AND THEIR USES
CA3258187A1 (en) 2022-06-04 2023-12-07 Regeneron Pharmaceuticals, Inc. INTERLEUKIN-2 PROPROTEINS AND THEIR USES
US20240067691A1 (en) 2022-08-18 2024-02-29 Regeneron Pharmaceuticals, Inc. Interferon receptor agonists and uses thereof
CN120051483A (zh) 2022-08-18 2025-05-27 再生元制药公司 干扰素前蛋白及其用途
IL322055A (en) 2023-01-13 2025-09-01 Regeneron Pharma IL12 receptor agonists and methods of using them
JP2026507123A (ja) 2023-02-28 2026-02-27 リジェネロン・ファーマシューティカルズ・インコーポレイテッド T細胞活性化剤およびその使用方法
AR132543A1 (es) * 2023-04-28 2025-07-16 Initial Therapeutics Inc Compuestos, composiciones y métodos para la atenuación de la traducción en mamíferos de proteínas c-myc o n-myc de la familia de protooncogenes myc de factores de transcripción bhlh
WO2025106469A1 (en) 2023-11-14 2025-05-22 Regeneron Pharmaceuticals, Inc. Engineered heavy chain variable domains and uses thereof
WO2025122614A1 (en) 2023-12-05 2025-06-12 Regeneron Pharmaceuticals, Inc. Il18 receptor agonists and methods of use thereof
WO2025199243A1 (en) 2024-03-20 2025-09-25 Regeneron Pharmaceuticals, Inc. Trivalent multispecific binding molecules and methods of use thereof
WO2025255480A1 (en) 2024-06-07 2025-12-11 Regeneron Pharmaceuticals, Inc. Tetravalent multispecific binding molecules and methods of use thereof

Family Cites Families (31)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4399216A (en) 1980-02-25 1983-08-16 The Trustees Of Columbia University Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials
US5179017A (en) 1980-02-25 1993-01-12 The Trustees Of Columbia University In The City Of New York Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials
US4634665A (en) 1980-02-25 1987-01-06 The Trustees Of Columbia University In The City Of New York Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials
US4510245A (en) 1982-11-18 1985-04-09 Chiron Corporation Adenovirus promoter system
US4740461A (en) 1983-12-27 1988-04-26 Genetics Institute, Inc. Vectors and methods for transformation of eucaryotic cells
US5168062A (en) 1985-01-30 1992-12-01 University Of Iowa Research Foundation Transfer vectors and microorganisms containing human cytomegalovirus immediate-early promoter-regulatory DNA sequence
EP0216846B2 (en) 1985-04-01 1995-04-26 Celltech Limited Transformed myeloma cell-line and a process for the expression of a gene coding for a eukaryotic polypeptide employing same
US4968615A (en) 1985-12-18 1990-11-06 Ciba-Geigy Corporation Deoxyribonucleic acid segment from a virus
GB8601597D0 (en) 1986-01-23 1986-02-26 Wilson R H Nucleotide sequences
US4959455A (en) 1986-07-14 1990-09-25 Genetics Institute, Inc. Primate hematopoietic growth factors IL-3 and pharmaceutical compositions
US4912040A (en) 1986-11-14 1990-03-27 Genetics Institute, Inc. Eucaryotic expression system
GB8717430D0 (en) 1987-07-23 1987-08-26 Celltech Ltd Recombinant dna product
GB8809129D0 (en) 1988-04-18 1988-05-18 Celltech Ltd Recombinant dna methods vectors and host cells
EP1105427A2 (en) 1998-08-17 2001-06-13 Abgenix, Inc. Generation of modified molecules with increased serum half-lives
US6517529B1 (en) 1999-11-24 2003-02-11 Radius International Limited Partnership Hemodialysis catheter
TWI333977B (en) 2003-09-18 2010-12-01 Symphogen As Method for linking sequences of interest
TWI380996B (zh) 2004-09-17 2013-01-01 Hoffmann La Roche 抗ox40l抗體
DK2439273T3 (da) * 2005-05-09 2019-06-03 Ono Pharmaceutical Co Humane monoklonale antistoffer til programmeret død-1(pd-1) og fremgangsmåder til behandling af cancer ved anvendelse af anti-pd-1- antistoffer alene eller i kombination med andre immunterapeutika
EP2054086A1 (en) 2006-08-17 2009-05-06 F. Hoffmann-Roche AG A conjugate of an antibody against ccr5 and an antifusogenic peptide
DK2121920T3 (da) 2007-03-01 2011-11-21 Symphogen As Fremgangsmåde til kloning af sammenhørende antistoffer
CN102137928A (zh) 2008-08-29 2011-07-27 西福根有限公司 克隆禽源抗体的方法
AU2009290544B2 (en) 2008-09-12 2015-07-16 Oxford University Innovation Limited PD-1 specific antibodies and uses thereof
US9181342B2 (en) 2008-09-12 2015-11-10 Isis Innovation Limited PD-1 specific antibodies and uses thereof
TW201134488A (en) 2010-03-11 2011-10-16 Ucb Pharma Sa PD-1 antibodies
WO2011159877A2 (en) 2010-06-18 2011-12-22 The Brigham And Women's Hospital, Inc. Bi-specific antibodies against tim-3 and pd-1 for immunotherapy in chronic immune conditions
PT2691112T (pt) * 2011-03-31 2018-07-10 Merck Sharp & Dohme Formulações estáveis de anticorpos para o recetor pd-1 humano de morte programada e tratamentos relacionados
CN104250302B (zh) 2013-06-26 2017-11-14 上海君实生物医药科技股份有限公司 抗pd‑1抗体及其应用
SG10201804945WA (en) 2013-12-12 2018-07-30 Shanghai hengrui pharmaceutical co ltd Pd-1 antibody, antigen-binding fragment thereof, and medical application thereof
TWI681969B (zh) 2014-01-23 2020-01-11 美商再生元醫藥公司 針對pd-1的人類抗體
PE20170255A1 (es) * 2014-01-24 2017-03-22 Dana Farber Cancer Inst Inc Moleculas de anticuerpo que se unen a pd-1 y usos de las mismas
DK3237446T3 (en) 2014-12-22 2021-07-26 Pd 1 Acquisition Group Llc Anti-PD-1-antistoffer

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
C. WANG ET AL: "In Vitro Characterization of the Anti-PD-1 Antibody Nivolumab, BMS-936558, and In Vivo Toxicology in Non-Human Primates", CANCER IMMUNOLOGY RESEARCH, vol. 2, no. 9, 28 May 2014 (2014-05-28), pages 846 - 856, XP055206944, ISSN: 2326-6066, DOI: 10.1158/2326-6066.CIR-14-0040 *

Cited By (114)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11319359B2 (en) 2015-04-17 2022-05-03 Alpine Immune Sciences, Inc. Immunomodulatory proteins with tunable affinities
US12486312B2 (en) 2015-04-17 2025-12-02 Alpine Immune Sciences, Inc. Immunomodulatory proteins with tunable affinities
US10513558B2 (en) 2015-07-13 2019-12-24 Cytomx Therapeutics, Inc. Anti-PD1 antibodies, activatable anti-PD1 antibodies, and methods of use thereof
US11008391B2 (en) 2015-08-11 2021-05-18 WuXi Biologics Ireland Limited Anti-PD-1 antibodies
US11643465B2 (en) 2015-08-11 2023-05-09 WuXi Biologics Ireland Limited Anti-PD-1 antibodies
US11345755B2 (en) 2015-09-01 2022-05-31 Agenus Inc. Anti-PD-1 antibodies and methods of use thereof
US10323091B2 (en) 2015-09-01 2019-06-18 Agenus Inc. Anti-PD-1 antibodies and methods of use thereof
US10450373B2 (en) 2015-09-01 2019-10-22 Agenus Inc. Anti-PD-1 antibodies and methods of use thereof
US10428145B2 (en) 2015-09-29 2019-10-01 Celgene Corporation PD-1 binding proteins and methods of use thereof
US12030942B2 (en) 2015-10-02 2024-07-09 Les Laboratoires Servier Anti-PD-1 antibodies and compositions
US11479609B2 (en) 2016-04-15 2022-10-25 Alpine Immune Sciences, Inc. CD80 variant immunomodulatory proteins and uses thereof
US11359022B2 (en) 2016-04-15 2022-06-14 Alpine Immune Sciences, Inc. CD80 variant immunomodulatory proteins and uses thereof
US11498967B2 (en) 2016-04-15 2022-11-15 Alpine Immune Sciences, Inc. CD80 variant immunomodulatory proteins and uses thereof
US11078282B2 (en) 2016-04-15 2021-08-03 Alpine Immune Sciences, Inc. CD80 variant immunomodulatory proteins and uses thereof
US12110339B2 (en) 2016-04-15 2024-10-08 Alpine Immune Sciences, Inc. ICOS ligand variant immunomodulatory proteins and uses thereof
US10882914B2 (en) 2016-04-15 2021-01-05 Alpine Immune Sciences, Inc. ICOS ligand variant immunomodulatory proteins and uses thereof
WO2017220988A1 (en) 2016-06-20 2017-12-28 Kymab Limited Multispecific antibodies for immuno-oncology
WO2017220990A1 (en) 2016-06-20 2017-12-28 Kymab Limited Anti-pd-l1 antibodies
WO2017220989A1 (en) 2016-06-20 2017-12-28 Kymab Limited Anti-pd-l1 and il-2 cytokines
US10751414B2 (en) 2016-09-19 2020-08-25 Celgene Corporation Methods of treating psoriasis using PD-1 binding antibodies
US10766958B2 (en) 2016-09-19 2020-09-08 Celgene Corporation Methods of treating vitiligo using PD-1 binding antibodies
US11414487B2 (en) 2016-09-21 2022-08-16 Cstone Pharmaceuticals Monoclonal antibodies to programmed death 1 (PD-1)
WO2018085358A1 (en) * 2016-11-02 2018-05-11 Jounce Therapeutics, Inc. Antibodies to pd-1 and uses thereof
US11905329B2 (en) 2016-11-02 2024-02-20 Jounce Therapeutics, Inc. Anti-PD-1 antibodies and uses thereof
US11384147B2 (en) 2016-11-02 2022-07-12 Jounce Therapeutics, Inc. Anti-PD-1 antibodies and uses thereof
US10654929B2 (en) 2016-11-02 2020-05-19 Jounce Therapeutics, Inc. Antibodies to PD-1 and uses thereof
US11359018B2 (en) 2016-11-18 2022-06-14 Symphogen A/S Anti-PD-1 antibodies and compositions
US11993653B2 (en) 2016-12-07 2024-05-28 Agenus Inc. Antibodies and methods of use thereof
US11560430B2 (en) 2017-01-20 2023-01-24 Tayu Huaxia Biotech Medical Group Co., LTD Anti-PD-1 antibodies and uses thereof
US11117949B2 (en) 2017-03-16 2021-09-14 Alpine Immune Sciences, Inc. CD80 variant immunomodulatory proteins and uses thereof
US11639375B2 (en) 2017-03-16 2023-05-02 Alpine Immune Sciences, Inc. CD80 variant immunomodulatory proteins and uses thereof
US11117948B2 (en) 2017-03-16 2021-09-14 Alpine Immune Sciences, Inc. CD80 variant immunomodulatory proteins and uses thereof
US11117950B2 (en) 2017-03-16 2021-09-14 Alpine Immune Sciences, Inc. CD80 variant immunomodulatory proteins and uses thereof
US11230588B2 (en) 2017-03-16 2022-01-25 Alpine Immune Sciences, Inc. CD80 variant immunomodulatory proteins and uses thereof
US11096988B2 (en) 2017-03-16 2021-08-24 Alpine Immune Sciences, Inc. CD80 variant immunomodulatory proteins and uses thereof
US20200407444A1 (en) * 2017-04-05 2020-12-31 Symphogen A/S Combination therapies targeting pd-1, tim-3, and lag-3
EP4230654A1 (en) 2017-04-05 2023-08-23 Symphogen A/S Combination therapies targeting pd-1, tim-3, and lag-3
WO2018185232A1 (en) 2017-04-05 2018-10-11 Symphogen A/S Combination therapies targeting pd-1, tim-3, and lag-3
US11939380B2 (en) * 2017-04-05 2024-03-26 Les Laboratoires Servier Combination therapies targeting PD-1, TIM-3, and LAG-3
EP4116328A1 (en) 2017-04-05 2023-01-11 Chia Tai Tianqing Pharmaceutical Group Co., Ltd. Combination therapies targeting pd-1, tim-3, and lag-3
EP3613768A4 (en) * 2017-04-20 2020-06-17 Suzhou Stainwei Biotech Inc. MONOCLONAL ANTIBODIES AS ANTAGONISTS AND INHIBITATION OF THE BINDING BETWEEN HUMAN PD-1 ANTIGENS AND LIGAND THEREOF, PRODUCTION METHOD THEREFOR AND APPLICATION THEREOF
JP2020517264A (ja) * 2017-04-20 2020-06-18 蘇州思坦維生物技術股▲ふん▼有限公司Suzhou Stainwei Biotech Inc. ヒトpd−1抗原とそのリガンドの結合を拮抗・阻害するモノクローナル抗体およびその製造方法と使用
JP7601635B2 (ja) 2017-06-25 2024-12-17 システィミューン, インク. 抗pd-1抗体とその作製及び使用方法
JP2020529862A (ja) * 2017-06-25 2020-10-15 システィミューン, インク.Systimmune, Inc. 抗pd−1抗体とその作製及び使用方法
JP7490109B2 (ja) 2017-06-25 2024-05-24 システィミューン, インク. 抗pd-1抗体とその作製及び使用方法
JP2023107246A (ja) * 2017-06-25 2023-08-02 システィミューン, インク. 抗pd-1抗体とその作製及び使用方法
US11566083B2 (en) 2017-08-01 2023-01-31 Ab Studio Inc. Bispecific antibodies and uses thereof
US11440972B2 (en) 2017-08-01 2022-09-13 Ab Studio Inc. Bispecific antibodies and uses thereof
US12049517B2 (en) 2017-08-01 2024-07-30 Ab Studio Inc. Bispecific antibodies and uses thereof
CN113896797A (zh) * 2017-08-01 2022-01-07 Ab工作室有限公司 双特异性抗体及其用途
US12570751B2 (en) 2017-08-04 2026-03-10 Genmab A/S Binding agents binding to PD-L1 and CD137 and use thereof
JP7129141B2 (ja) 2017-08-24 2022-09-01 コルマー コリア カンパニー リミテッド 細胞受容体結合親和性のあるペプチドを含むマイクロカプセル及びこれを含む化粧料組成物
JP2021130686A (ja) * 2017-08-24 2021-09-09 コルマー コリア カンパニー リミテッドKolmar Korea Co., Ltd. 細胞受容体結合親和性のあるペプチドを含むマイクロカプセル及びこれを含む化粧料組成物
US11613566B2 (en) 2017-10-18 2023-03-28 Alpine Immune Sciences, Inc. Variant ICOS ligand immunomodulatory proteins and related compositions and methods
US12297253B2 (en) 2018-01-03 2025-05-13 Alpine Immune Sciences, Inc. Multi-domain immunomodulatory proteins and methods of use thereof
US10493148B2 (en) 2018-03-02 2019-12-03 Eli Lilly And Company PD-1 agonist antibodies and uses thereof
US12246025B2 (en) 2018-03-21 2025-03-11 Genmab A/S Methods of treating cancer with a combination of a platinum-based agent and an anti-tissue factor antibody-drug conjugate
US12509495B2 (en) 2018-04-18 2025-12-30 Xencor, Inc. LAG-3 targeted heterodimeric fusion proteins containing IL-15/IL-15RA Fc-fusion proteins and LAG-3 antigen binding domains
US12239688B2 (en) 2018-04-18 2025-03-04 Xencor, Inc. IL-15/IL-15RA heterodimeric Fc fusion proteins and uses thereof
US12324841B2 (en) 2018-05-07 2025-06-10 Genmab A/S Methods of treating cancer with a combination of an anti-PD-1 antibody and an anti-tissue factor antibody-drug conjugate
WO2019217457A1 (en) 2018-05-07 2019-11-14 Genmab A/S Methods of treating cancer with a combination of an anti-pd-1 antibody and an anti-tissue factor antibody-drug conjugate
WO2019241758A1 (en) * 2018-06-15 2019-12-19 Alpine Immune Sciences, Inc. Pd-1 variant immunomodulatory proteins and uses thereof
US12065476B2 (en) 2018-06-15 2024-08-20 Alpine Immune Sciences, Inc. PD-1 variant immunomodulatory proteins and uses thereof
US12448448B2 (en) 2018-06-20 2025-10-21 Incyte Corporation Anti-PD-1 antibodies and uses thereof
EP3823991A4 (en) * 2018-07-19 2022-08-03 Tayu Huaxia Biotech Medical Group Co., Ltd. ANTI-PD-1 ANTIBODIES, DOSAGE FORMS AND USES THEREOF
US12258407B2 (en) 2018-07-19 2025-03-25 Tayu Huaxia Biotech Medical Group Co., Ltd. Anti-PD-1 antibodies, dosages and uses thereof
EP3837354A4 (en) * 2018-08-16 2022-06-01 Musc Foundation for Research Development RECOMBINANT MYXOMA VIRUSES AND THEIR APPLICATIONS
CN112969710A (zh) * 2018-09-14 2021-06-15 莱兰斯坦福初级大学评议会 Spd-1变异体-fc融合蛋白
US11498955B2 (en) 2018-09-14 2022-11-15 The Board Of Trustees Of The Leland Stanford Junior University SPD-1 variant# FC fusion proteins
WO2020056085A1 (en) * 2018-09-14 2020-03-19 The Board Of Trustees Of The Leland Stanford Junior University Spd-1 variant - fc fusion proteins
JP2021535761A (ja) * 2018-09-14 2021-12-23 ザ ボード オブ トラスティーズ オブ ザ レランド スタンフォード ジュニア ユニバーシティー sPD−1バリアント−Fc融合タンパク質
US12453781B2 (en) 2018-10-30 2025-10-28 Genmab A/S Methods of treating cancer with a combination of an anti-VEGF antibody and an anti-tissue factor antibody-drug conjugate
US12576159B2 (en) 2018-10-31 2026-03-17 Merck Sharp & Dohme Llc Anti-human PD-1 antibody crystals and methods of use thereof
US12319735B2 (en) 2018-11-07 2025-06-03 Merck Sharp & Dohme Llc Co-formulations of anti-LAG3 antibodies and anti-PD-1 antibodies
US12552853B2 (en) 2018-11-30 2026-02-17 Alpine Immune Sciences, Inc. CD86 variant immunomodulatory proteins and uses thereof
US12448423B2 (en) 2018-12-20 2025-10-21 Xencor, Inc. Targeted heterodimeric Fc fusion proteins containing NKG2D antigen binding domains
US12331118B2 (en) 2018-12-21 2025-06-17 Ose Immunotherapeutics Humanized anti-human-PD-1 antibody and methods of using them for cancer treatment
US12275790B2 (en) 2018-12-21 2025-04-15 Sinocelltech Ltd. Humanized anti-PD-1 antibody and the use thereof
KR102956921B1 (ko) 2018-12-21 2026-04-23 오제 이뮈노테라프틱스 인간화된 항-인간-pd-1 항체
AU2019409184B2 (en) * 2018-12-21 2024-05-23 Sinocelltech Ltd. Humanized anti-PD-1 antibody and use thereof
EP3901172A4 (en) * 2018-12-21 2023-01-11 Sinocelltech Ltd. HUMANIZED ANTI-PD-1 ANTIBODIES AND THEIR USE
WO2020127367A1 (en) * 2018-12-21 2020-06-25 Ose Immunotherapeutics Humanized anti-human-pd-1 antibody
WO2020127366A1 (en) * 2018-12-21 2020-06-25 Ose Immunotherapeutics Humanized anti-human-pd-1 antibody
IL283812B2 (en) * 2018-12-21 2023-02-01 Ose Immunotherapeutics Humanized anti-human-pd-1 antibody
KR20210097197A (ko) * 2018-12-21 2021-08-06 오제 이뮈노테라프틱스 인간화된 항-인간-pd-1 항체
IL283812B (en) * 2018-12-21 2022-10-01 Ose Immunotherapeutics Humanized antibody against human pd–1
AU2019409184B9 (en) * 2018-12-21 2024-08-08 Sinocelltech Ltd. Humanized anti-PD-1 antibody and use thereof
EP4257199A3 (en) * 2018-12-21 2024-01-10 Ose Immunotherapeutics Humanized anti-human-pd-1 antibody
US11352430B2 (en) 2018-12-21 2022-06-07 Ose Immunotherapeutics Humanized anti-human-PD-1 antibody and its use in cancer treatment
KR102371173B1 (ko) 2018-12-21 2022-03-04 오제 이뮈노테라프틱스 인간화된 항-인간-pd-1 항체
US12463463B2 (en) 2019-01-28 2025-11-04 Ab Therapeutics, Inc. Bispecific antibodies and uses thereof
US12466887B2 (en) 2019-04-10 2025-11-11 Bio-Thera Solutions, Ltd. Antibody binding to PD-1
EP3931223A4 (en) * 2019-04-10 2023-07-12 Bio-Thera Solutions, Ltd. ANTIBODIES BINDING TO PD-1
WO2021006199A1 (ja) 2019-07-05 2021-01-14 小野薬品工業株式会社 Pd-1/cd3二重特異性タンパク質による血液がん治療
WO2021025140A1 (ja) 2019-08-08 2021-02-11 小野薬品工業株式会社 二重特異性タンパク質
WO2021044005A1 (en) 2019-09-06 2021-03-11 Symphogen A/S Anti-cd73 antibodies
US11851466B2 (en) * 2019-10-03 2023-12-26 Xencor, Inc. Targeted IL-12 heterodimeric Fc-fusion proteins
US20210355185A1 (en) * 2019-10-03 2021-11-18 Xencor, Inc. Targeted il-12 heterodimeric fc-fusion proteins
EP4101464A4 (en) * 2020-02-07 2024-04-03 Shanghai Junshi Biosciences Co., Ltd. USE OF ANTI-PD-1 ANTIBODIES FOR THE TREATMENT OF MALIGNANT TUMORS
US12312405B2 (en) 2020-05-26 2025-05-27 Boehringer Ingelheim International Gmbh Anti-PD-1 antibodies
EP4204454A4 (en) * 2020-08-31 2024-07-24 Biosion, Inc. PD-1 BINDING ANTIBODIES AND THEIR USES
WO2022108931A2 (en) 2020-11-17 2022-05-27 Seagen Inc. Methods of treating cancer with a combination of tucatinib and an anti-pd-1/anti-pd-l1 antibody
WO2022254227A1 (en) 2021-06-04 2022-12-08 Kymab Limited Treatment of pd-l1 negative or low expressing cancer with anti-icos antibodies
WO2023285552A1 (en) 2021-07-13 2023-01-19 BioNTech SE Multispecific binding agents against cd40 and cd137 in combination therapy for cancer
WO2023057381A1 (en) 2021-10-04 2023-04-13 Les Laboratoires Servier Cancer therapy targeting nkg2a
WO2023057534A1 (en) 2021-10-06 2023-04-13 Genmab A/S Multispecific binding agents against pd-l1 and cd137 in combination
WO2023083439A1 (en) 2021-11-09 2023-05-19 BioNTech SE Tlr7 agonist and combinations for cancer treatment
WO2023083868A1 (en) 2021-11-09 2023-05-19 BioNTech SE Tlr7 agonist and combinations for cancer treatment
WO2023218046A1 (en) 2022-05-12 2023-11-16 Genmab A/S Binding agents capable of binding to cd27 in combination therapy
WO2024115725A1 (en) 2022-12-01 2024-06-06 BioNTech SE Multispecific antibody against cd40 and cd137 in combination therapy with anti-pd1 ab and chemotherapy
WO2024160721A1 (en) 2023-01-30 2024-08-08 Kymab Limited Antibodies
WO2024209072A1 (en) 2023-04-06 2024-10-10 Genmab A/S Multispecific binding agents against pd-l1 and cd137 for treating cancer
US12410258B2 (en) 2023-05-12 2025-09-09 Ganmab A/S Antibodies capable of binding to OX40, variants thereof and uses thereof
WO2025114541A1 (en) 2023-11-30 2025-06-05 Genmab A/S Antibodies capable of binding to ox40 in combination therapy

Also Published As

Publication number Publication date
ES2924402T3 (es) 2022-10-06
NZ740869A (en) 2024-12-20
ZA201801852B (en) 2024-02-28
US11034765B2 (en) 2021-06-15
EP3368572B9 (en) 2023-04-26
IL258214A (en) 2018-05-31
SG10201912943RA (en) 2020-02-27
SA518391262B1 (ar) 2021-07-28
EP3368572B1 (en) 2022-05-25
IL258214B (en) 2022-12-01
PE20181044A1 (es) 2018-07-03
KR20180053752A (ko) 2018-05-23
RS63490B1 (sr) 2022-09-30
TWI751981B (zh) 2022-01-11
KR102897330B1 (ko) 2025-12-05
PT3368572T (pt) 2022-06-23
CY1125327T1 (el) 2025-03-28
PL3368572T3 (pl) 2022-09-12
CA3000564A1 (en) 2017-04-06
JP2018529359A (ja) 2018-10-11
HUE059788T2 (hu) 2022-12-28
IL258214B2 (en) 2023-04-01
RU2750675C1 (ru) 2021-07-01
CN108290953B (zh) 2022-05-31
EP4105235A1 (en) 2022-12-21
BR112018006257A2 (en) 2018-10-16
HRP20221041T1 (hr) 2022-11-11
LT3368572T (lt) 2022-07-25
AU2016333517A1 (en) 2018-04-12
EP3368572B2 (en) 2026-03-11
TW201726734A (zh) 2017-08-01
US20190144542A1 (en) 2019-05-16
JP6875385B2 (ja) 2021-05-26
CN108290953A (zh) 2018-07-17
AU2016333517B2 (en) 2023-09-07
SI3368572T1 (sl) 2022-10-28
DK3368572T3 (da) 2022-08-08
EP3368572A1 (en) 2018-09-05
MX2018003936A (es) 2018-07-06
CO2018003500A2 (es) 2018-07-10
MY190324A (en) 2022-04-14

Similar Documents

Publication Publication Date Title
US11834503B2 (en) Anti-lag-3 antibodies and compositions
EP3368572B1 (en) Anti-pd-1 antibodies and compositions
US11634500B2 (en) Anti-CD73 antibodies and compositions
EP3443009A1 (en) Anti-tim-3 antibodies and compositions
US12030942B2 (en) Anti-PD-1 antibodies and compositions
HK40085294A (en) Anti-pd-1 antibodies and compositions
CA3000564C (en) Anti-pd-1 antibodies and compositions
HK1256846A1 (en) Anti-pd-1 antibodies and compositions
HK1256846B (en) Anti-pd-1 antibodies and compositions
BR112018006257B1 (pt) Anticorpo anti-pd-1 ou porção de ligação ao antígeno do mesmo, seu método de produção, seu uso, composição farmacêutica, moléculas de ácido nucleico isoladas, vetor, molécula de ligação biespecífica e seu uso

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 16774691

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 258214

Country of ref document: IL

WWE Wipo information: entry into national phase

Ref document number: 11201802334R

Country of ref document: SG

WWE Wipo information: entry into national phase

Ref document number: 000485-2018

Country of ref document: PE

Ref document number: MX/A/2018/003936

Country of ref document: MX

ENP Entry into the national phase

Ref document number: 3000564

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 2018516765

Country of ref document: JP

NENP Non-entry into the national phase

Ref country code: DE

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112018006257

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 2016333517

Country of ref document: AU

Date of ref document: 20160930

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 20187011821

Country of ref document: KR

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 2016774691

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 2018115979

Country of ref document: RU

ENP Entry into the national phase

Ref document number: 112018006257

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20180328

WWG Wipo information: grant in national office

Ref document number: 740869

Country of ref document: NZ