WO2017037196A1 - Stabilized viral class i fusion proteins - Google Patents
Stabilized viral class i fusion proteins Download PDFInfo
- Publication number
- WO2017037196A1 WO2017037196A1 PCT/EP2016/070654 EP2016070654W WO2017037196A1 WO 2017037196 A1 WO2017037196 A1 WO 2017037196A1 EP 2016070654 W EP2016070654 W EP 2016070654W WO 2017037196 A1 WO2017037196 A1 WO 2017037196A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- protein
- amino acid
- fusion
- seq
- class
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/005—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/14—Antivirals for RNA viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/14—Antivirals for RNA viruses
- A61P31/16—Antivirals for RNA viruses for influenza or rhinoviruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/14—Antivirals for RNA viruses
- A61P31/18—Antivirals for RNA viruses for HIV
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/20—Antivirals for DNA viruses
- A61P31/22—Antivirals for DNA viruses for herpes viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/04—Immunostimulants
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2740/00—Reverse transcribing RNA viruses
- C12N2740/00011—Details
- C12N2740/10011—Retroviridae
- C12N2740/16011—Human Immunodeficiency Virus, HIV
- C12N2740/16022—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2760/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses negative-sense
- C12N2760/00011—Details
- C12N2760/14011—Filoviridae
- C12N2760/14111—Ebolavirus, e.g. Zaire ebolavirus
- C12N2760/14122—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2760/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses negative-sense
- C12N2760/00011—Details
- C12N2760/16011—Orthomyxoviridae
- C12N2760/16111—Influenzavirus A, i.e. influenza A virus
- C12N2760/16122—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N7/00—Viruses; Bacteriophages; Compositions thereof; Preparation or purification thereof
Definitions
- the present invention relates to the field of medicine.
- the invention in particular relates to recombinant pre-fusion class I fusion proteins and uses thereof, e.g. in
- Viral fusion proteins are dynamic fusion machines that drive membrane fusion by irreversible protein refolding from a metastable pre-fusion conformation to a stable post- fusion conformation.
- the fusogenicity of the protein is important for viral infection.
- the fusion proteins of enveloped viruses can be classified in different types based on the general irreversible folding mechanism they display to drive fusion of the virus with the target cell. Fusion proteins from unrelated viruses, such as the fusion protein F from
- Herpesviridea gB, Orthomyxovirideae Hemagglutinin (HA) and Hemagglutinin Esterase (HE), and others are classified as class I fusion proteins and refold from a labile pre-fusion state to a stable post-fusion state through a similar mechanism although they do not exhibit any significant sequence homologies.
- Class I fusion proteins thus fuse the viral and host-cell membranes by irreversible protein refolding from the labile pre-fusion conformation to the stable post-fusion conformation. Structures have been determined for a variety of class I fusion proteins in pre-fusion conformation and post-fusion conformation providing insight into the mechanism of this complex fusion machine.
- the inactive mature class I fusion protein e.g. Fo for paramyxoviruses, HA for Orthomyxoviruses
- Fo paramyxoviruses
- HA orthomyxoviruses
- the cleavage site is near or adjacent to a stretch of 20-25 hydrophobic amino acids (the fusion peptide), followed by a heptad repeat region in the C-terminal part.
- the C-terminus contains the transmembrane domain (TM) and after cleavage the membrane bound C-terminal part exposes the N-terminal hydrophobic fusion peptide (FP) ( Figure 1).
- TM transmembrane domain
- FP N-terminal hydrophobic fusion peptide
- Figure 1 the refolding region 1
- RR2 refolding region 2
- HRA heptad repeat A
- the HRA's of all three protomers in the trimer transform from a helix, or from an assembly of loops and secondary structures, to a long continuous trimeric helical coiled coil ( Figure 1).
- the FP located at the N-terminal segment of RR1 , is then able to extend away from the viral membrane and inserts in the proximal membrane of the target cell.
- the refolding region 2 (RR2), which is located C-terminal to RR2 closer to the TM and often includes the heptad repeat B (HRB), relocates to the other side of the fusion protein and binds the HRA coiled-coil trimer with the HRB domain to form the six-helix bundle (6HB) or with an extended polypeptide chain like Influenza HA.
- HRB heptad repeat B
- the present invention provides stable, recombinant, class I fusion proteins stabilized in the pre-fusion conformation.
- the pre-fusion polypeptides are soluble.
- the invention also provides nucleic acid molecules encoding the pre-fusion polypeptides according to the invention and vectors comprising such nucleic acid molecules.
- the invention also relates to compositions, preferably immunogenic compositions, comprising a class I pre-fusion polypeptide, a nucleic acid molecule and/or a vector, and to the use thereof for inducing an immune response against the class I fusion protein, in particular to the use thereof as a vaccine.
- the invention also relates to methods for inducing an anti-virus immune response in a subject, comprising administering to the subject an effective amount of a pre-fusion polypeptide, a nucleic acid molecule encoding said polypeptide, and/or a vector comprising said nucleic acid molecule.
- the induced immune response is characterized by neutralizing antibodies to the virus and/or protective immunity against said virus infection.
- the invention relates to a method for inducing neutralizing anti-viral antibodies in a subject, comprising administering to the subject an effective amount of an immunogenic composition comprising a pre-fusion polypeptide, a nucleic acid molecule encoding said polypeptide, and/or a vector comprising said nucleic acid molecule.
- FIG. l Cartoon of fusion protein trimer in pre-fusion conformation (top left) and in the intermediate state (top right) and schematic representation of the conserved elements of fusion domain of class I fusion proteins (bottom). Fusion peptide (FP), refolding region 1 (RRl), refolding region 2 (RR2) and transmembrane region (TM) are indicated. Molecular structures of fusion proteins are very diverse and may contain a separate receptor binding domain (top left, checkered), however all fusion proteins contain a recognizable fusion domain (diagonal fill, black fill). Generally, the FP is followed by a heptad repeat region in the C-terminal part (black and diagonal striped fill) which both form the RRl .
- FP refolding region 1
- RR2 refolding region 2
- TM transmembrane region
- the N-terminal part of RRl black which is connected to the base helix (diagonal fill) via a hinge loop is assembled on the base helix to form a long continuous helical coiled coil.
- the post-fusion form of the fusion protein is formed when refolding region 2 binds the refolded RRl . Since these are class I membrane proteins, the C-terminus contains the transmembrane domain (TM).
- FIG. 2 Cartoons of a fragment of RRl (black), hinge loop and base helix (diagonal striped fill) for several class I fusion proteins in the pre-fusion (top row) and post- fusion
- FIG. 3 Trimer percentage and yield of proline substitutions in HIV-1 env sequence based on a consensus of C clade Envs with a stabilizing disulfide at position 501-605 (ConC SOS).
- FIG. 4 A) SEC-MALS profile of Galanthus nivalus lectin-purified HIV- 1 ConC SOS Env variant with I559P substitution (left) and L556P, I559P double substitution (right).
- FIG. 5 A) NativePAGE analysis of cell free supernatant of ebola GP variants with proline substitutions in hinge-loop. Supernatants of transfected expi293 cells were analyzed on NativePAGE and stained with Coomassie. Lanes show expression and quaternary structure of variants. B) The trimer and monomer bands of the WT, T577P and L579P mutants were determined and their relative percentages calculated.
- FIG.6 Analysis of melting temperature (Tm) of wt ebola GP, strain EBOV14 and a variant with the T577P substitution using differential scanning fluorometry (DSF).
- FIG 7 A) Trimer percentage based on bands obtained with NativePAGE analysis of soluble GPs of Ebola strains Mayinga and Sudan Gulu and the variant with a substitution in the hinge loop at position 577 to Proline. B) relative trimer yield of the different soluble GPs based on NativePAGE.
- FIG. 8 A) Multimer - specific binding of Influenza mini-HA variants with either Proline or Leucine at position 73 in the hinge-loop. B) Overview of expression levels, binding to broadly neutralizing antibodies and trimer binding (as shown in A) of the mini-HA variants. C) Multimer content of mini-HA variant with Tyr or Pro at position 63 shown as percentage of multimer content of 63P vs control with 63Y.
- Virus-cell fusion is the means by which all enveloped viruses, including human pathogens such as for example the influenza virus, the human immunodeficiency virus (HIV) and Ebola virus, enter cells and initiate disease-causing cycles of replication.
- Virus-cell fusion is executed by one or more viral surface glycoproteins, including one that is generally denoted as the fusion protein.
- the fusion proteins of enveloped viruses can be classified in different types based on their general irreversible folding mechanism. Thus, fusion proteins from unrelated viruses, such as the fusion protein F from Paramyxoviridae, Ebola GP, Retroviridae envelope protein, Orthomyxoviridea Hemagglutinin (HA) and Hemagglutinin Esterase (HE) are classified as class I fusion proteins. Class I fusion proteins fuse the viral and host-cell membranes by irreversible protein refolding from the labile pre-fusion conformation to the stable post-fusion conformation.
- class I fusion proteins are for example the GP protein of Arenaviridae, the E1/E2 protein of Togaviridae, the E protein of Flaviviridae, E(TBEV), E1/E2 (HCV), the GN/GC protein of Bunyaviridae, the G protein of Rhabdoviridae, and the gB, gD, gH protein of Herpesviridae.
- the refolding region 1 includes the fusion peptide (FP) and heptad repeat A (HRA).
- HRA fusion peptide
- HRA's and FP's of all three protomers in the trimer transform from a helix, or form an assembly of loops and secondary structures, to a long continuous trimeric helical coiled coil ( Figure 1).
- the FP located at the N-terminal segment of RR1, is then able to extend away from the viral membrane and inserts in the proximal membrane of the target cell.
- the refolding region 2 (RR2), which is located C-terminal to RR2 closer to the TM and often includes the heptad repeat B (HRB), relocates to the other side of the fusion protein and binds the HRA coiled-coil trimer with the HRB domain to form the six- helix bundle or with an extended polypeptide chain like influenza HA.
- HRB heptad repeat B
- the base helix is a part of the dynamic fusion protein that does not change conformation during the
- the base helix is at the heart of the fusion protein and forms a trimeric helical base. After the trigger and the initiation of the refolding, the trimeric helical base is extended by assembly of the first helix of RRl. In respiratory syncytial virus fusion protein (RSV F), the base helix is helix alpha 5. After refolding, helix a4 is the first structural element that assembles on top of the structurally conserved, preformed a5 helix base.
- the flexible ⁇ 4- ⁇ 5 loop is an important structural element because it is the first region in this dynamic protein that needs to hinge in order to achieve the assembly of a4 on top of the a5 ( Figure 2).
- helix 7 can be identified as the base helix.
- the hinge loop between a6 and al and helix 6 are mounted on top of the base helix al to form the long extended coiled coil.
- the a6- al hinge- loop of pre-fusion HIV gp41 is also the most disordered element of the fusion protein.
- the gp41 a6- al loop is in fact completely disordered and no electron density could be measured in the crystal structure.
- An important substitution that increased the stability of pre-fusion gp41 is I559P which is located at a structural homologous position as the stabilizing S215P in RSV-F. Although the gp41 I559P is not visible in the structure, the position in the hinge-loop between the base helix and the mounted helix is very similar to position 215 in the hinge-loop of pre-fusion RSV-F ( Figure 2).
- the proline at position 559 prevents the hinge movement of the a6- al loop in a similar fashion as the proline at position 215 inhibits the hinge movement of the a4- a5 hinge in pre-fusion RSV F (Krarup et al, Nature Communications 8143 (2015), doi:10.1038/ncomms9143).
- This analogy between two unrelated class I fusion proteins reveals the importance of the hinge as a critical step in refolding of RR1. It also shows that stabilizing the unstable hinge loop is a successful strategy to stabilize the unstable pre-fusion conformation of class I fusion proteins.
- Introduction of a proline in the hinge loop and preferably relatively close to the base helix thus can be used as a common solution to stabilize the pre-fusion conformation of class I fusion proteins which would make them superior vaccine components.
- stabilized hinge loops have been designed for several class I fusion proteins, in particular the class I fusion proteins for which a pre-fusion structure has been elucidated, like influenza HA, retrovirus envelope protein and Ebola GP.
- class I fusion proteins for which a pre-fusion structure has been elucidated, like influenza HA, retrovirus envelope protein and Ebola GP.
- proline residues in the hinge loop C-terminal to the base helix stabilize the pre-fusion conformation. Therefore, the base helices in the class I fusion proteins were identified and based on the position of the stabilizing proline in RSV F and HIV gp41 hinge loop, the approximate position for a stabilizing proline in the other hinge loops were deduced ( Figure 2 and Table 1).
- the present invention thus provides recombinant pre-fusion class I fusion proteins that are stabilized in the pre-fusion conformation.
- the stable class I pre-fusion proteins of the invention are in the pre-fusion conformation, i.e. they comprise (display) epitopes that is specific to the pre-fusion conformation of the fusion protein.
- An epitope that is specific to the pre-fusion conformation protein is an epitope that is not presented in the post-fusion conformation.
- the pre-fusion conformation of class I fusion proteins may contain epitopes that are the same as those on the protein expressed on natural virions, and therefore may provide advantages for eliciting protective neutralizing antibodies.
- the proteins of the invention thus comprise at least one epitope that is recognized by a pre-fusion specific monoclonal antibody.
- class I fusion proteins can be stabilized in the hinge-loop that is present between the base helix and the RRl by mutation of one or more specific amino acid residue(s), in particular by mutation of one or more specific hydrophobic amino acid residues into proline (Pro).
- Table 2 discloses the amino acid sequence of the regions comprising the hinge loop of several class I fusion proteins. The actual hinge loops correspond to the underlined sequences in Table 2.
- the class I fusion protein is a retroviral envelope protein.
- the retroviral envelope protein is a HIV- 1 envelope protein.
- the hinge loop (underlined) is comprised within the amino acid sequence:
- the stable HIV-1 envelope protein according to the invention comprises a mutation in the hinge loop of the amino acid residue Leu on position 555, a mutation of amino acid residue Leu on position 556, and/or a mutation of the amino acid residue Ala at position 58.
- the stable pre-fusion HIV-1 envelope protein according to the invention comprises a mutation in the hinge loop of the amino acid residue Leu on position 555 into Pro, a mutation of the amino acid residue Leu on position 556 into Pro, and/or a mutation of the amino acid residue Ala on position 558 into Pro.
- the stable pre-fusion HIV-1 envelope protein according to the invention comprises an amino acid sequence selected from the group consisting of:
- OAROLLSGIVOOONNPLRAIEAOOHLLOLTVWGIKOLOARI SEQ ID NO: 3
- QARQLLSGIVQQQNNLPRAIEAQOHLLQLTVWGIKQLQARI SEQ ID NO: 4
- QARQLLSGIVQOONNLLRPIEAQQHLLOLTVWGI QLOARI SEQ ID NO: 5
- QARQLLSGIVQQQSNPLRAIEAQQHMLQLTVWGIKQLQTRV SEQ ID NO: 6
- OAROLLSGIVOOOSNLPRAIEAOOHMLOLTVWGIKOLOTRV SEQ ID NO: 7
- the numbering of the amino acid residues relates to the numbering of the amino acid residues in the full-length HIV- 1 envelope protein.
- the present invention thus provides a stable pre-fusion HIV-1 envelope protein comprising an amino acid sequence, wherein the amino acid residue on position 555, 556 and/or 558 is proline.
- the present invention provides a stable pre-fusion HIV-1 envelope protein comprising the amino acid sequence of SEQ ID NO: 9, wherein the amino acid residue on position 555, 556 and/or 558 is proline.
- the stable pre-fusion HIV-1 envelope protein further comprises a proline on position 559.
- the retroviral envelope protein is a HIV-2 envelope protein.
- the hinge loop (underlined) is comprised within the amino acid sequence:
- the stable HIV-2 envelope protein according to the invention comprises a mutation in the hinge loop of the amino acid residue Leu on position 553 and/or a mutation of amino acid residue Leu on position 554, a mutation of amino acid residue Ala at position 556, and/or a mutation of amino acid residue Val at position 557.
- the stable HIV-2 envelope protein according to the invention comprise a mutation in the hinge loop of the amino acid residue Leu on position 553 into Pro, a mutation of amino acid residue Leu on position 554 into Pro, a mutation of amino acid residue Ala at position 556 into Pro, and/or a mutation of amino acid residue Val at position 557 into Pro.
- the stable pre-fusion HIV-2 envelope protein according to the invention comprises an amino acid sequence selected from the group consisting of:
- the present invention thus provides a stable pre-fusion HIV-2 envelope protein comprising an amino acid sequence, wherein the amino acid residue on position 553, 554, 556 and/or 557 is proline.
- the present invention provides a stable pre-fusion HIV-2 envelope protein comprising the amino acid sequence of SEQ ID NO: 35, wherein the amino acid residue on position 553, 554, 556 and/or 557 is proline.
- the class I fusion protein is a filo virus fusion protein (GP).
- the filovirus GP protein is an Ebola virus GP protein.
- the hinge loop (underlined) is comprised within the amino acid sequence 553 GLICGLRQLANETTQALQLFLRATTELRTFSILNRKAIDFLLQR 596 (SEQ ID NO: 10).
- the stable Ebolavirus GP protein according to the invention comprises a mutation in the hinge loop of the amino acid residue Thr at position 577, and/or a mutation of the amino acid residue Leu at position 579. In certain embodiments, the stable Ebolavirus GP protein according to the invention comprises a mutation in the hinge loop of the amino acid residue Thr at position 577 into Pro, and/or a mutation of the amino acid residue Leu at position 579 into Pro.
- the stable Ebolavirus GP protein according to the invention comprises an amino acid sequence selected from the group consisting of:
- the present invention thus provides a stable pre-fusion
- Ebolavirus GP protein wherein the amino acid residue on position 577 and/or 579 is proline.
- the present invention provides a stable pre-fusion Ebolavirus GP protein comprising the amino acid sequence of SEQ ID NO: 13, wherein the amino acid residue on position 577 and/or 579 is proline.
- the filovirus GP protein is a Marburg virus GP protein.
- the hinge loop (underlined) is comprised within the amino acid sequence 554 NLVCRLRRLANQTAKSLELLLRVTTEERTFSLINRHAIDFLLAR 597 (SEQ ID NO: 14).
- the Marburg virus GP protein according to the invention comprise a mutation in the hinge loop of the amino acid residue Thr at position 578, and/or a mutation of the amino acid residue Glu at position 580.
- the Marburg virus GP protein according to the invention comprise a mutation in the hinge loop of the amino acid residue Thr at position 578 into Pro, and/or a mutation of the amino acid residue Glu at position 580 into Pro.
- the stable Marburg virus GP protein according to the invention comprises an amino acid sequence selected from the group consisting of:
- the present invention thus provides a stable pre-fusion Marburg virus GP protein, wherein the amino acid residue on position 578 and/or 580 is proline.
- the present invention provides a stable pre-fusion Marburg GP protein comprising the amino acid sequence of SEQ ID NO: 17, wherein the amino acid residue on position 578 and/or 580 is proline.
- the class I fusion protein is an influenza hemagglutinin (HA) protein of an influenza A virus.
- the influenza hemagglutinin (HA) protein is a HA protein of an influenza A virus of phylogenetic group 1.
- the influenza hemagglutinin (HA) protein is a HI HA protein.
- the influenza HA protein is typically composed of a HA1 domain (comprising about
- the hinge loop (underlined) is comprised within the amino acid sequence 38
- the HA protein comprises a mutation in the hinge loop (B- loop) of HA2 of the amino acid residue Phe at position 63 (HA2 numbering) and/or a mutation of the amino acid residue Leu at position 73.
- the HA protein comprises a mutation in the hinge loop of the amino acid residue Phe at position 63 into Pro, and/or a mutation of the amino acid residue Leu at position 73 into Pro.
- the stable pre-fusion HI HA protein according to the invention comprises an amino acid sequence selected from the group consisting of:
- the numbering of the amino acid residues relates to the numbering of the amino acid residues in the HA2 domain.
- the present invention thus provides a stable pre-fusion HA protein, wherein the amino acid residue in the HA2 domain on position 63 and/or 73 is proline.
- the present invention provides a stable pre-fusion HA protein comprising the amino acid sequence of SEQ ID NO: 21, wherein the amino acid residue in the HA2 domain on position 63 and/or 73 is proline.
- influenza hemagglutinin (HA) protein is a HA protein of an influenza A virus of phylogenetic group 2. In certain embodiments, the influenza hemagglutinin (HA) protein is a H3 HA protein.
- the hinge loop (underlined) is comprised within the amino acid sequence
- the stable influenza HA protein comprises a mutation in the hinge loop (B-loop) of HA2 of the amino acid residue Phe at position 72 and/or a mutation of the amino acid residue Val at position 82.
- the stable influenza HA protein comprises a mutation in the hinge loop (B-loop) of HA2 of the amino acid residue Phe at position 72 into Pro and/or a mutation of the amino acid residue Val at position 82 into Pro.
- the stable pre-fusion H3 HA protein according to the invention comprises an amino acid sequence selected from the group consisting of:
- the present invention thus provides a stable pre-fusion HA protein, wherein the amino acid residue in the HA2 domain on position 72 and/or 82 is proline.
- the present invention provides a stable pre-fusion HA protein comprising the amino acid sequence of SEQ ID NO: 25, wherein the amino acid residue on position 72 and/or 82 is proline.
- the class I fusion polypeptide is an influenza hemagglutinin (HA) polypeptide of an influenza B virus.
- HA hemagglutinin
- the hinge loop is comprised within the amino acid sequence
- the stable HA polypeptides comprise a mutation in the hinge loop (B-loop) of HA2 of the amino acid residue Leu at position 62 and/or a mutation of the amino acid Leu at position 72.
- the stable HA polypeptides comprise a mutation in the hinge loop (B-loop) of HA2 of the amino acid residue Leu at position 62 into Pro and/or a mutation of the amino acid Leu at position 72 into Pro.
- the stable pre-fusion B HA protein according to the invention comprises an amino acid sequence selected from the group consisting of:
- the present invention thus provides a stable pre-fusion HA protein, wherein the amino acid residue on position 62 and/or 72 of HA2 is proline.
- the present invention provides a stable pre-fusion HA protein comprising the amino acid sequence of SEQ ID NO: 29, wherein the amino acid residue on position 62 and/or 72 of HA2 is proline.
- the stable pre-fusion class I proteins thus comprise at least one stabilizing mutation in the hinge loop as compared to the wild-type class I fusion.
- the amino acid positions are given in reference to the sequence of the full length class I fusion protein (or in reference to the HA2 domain for the influenza HA proteins). Sequence alignments can be done using methods well known in the art, e.g. by CLUSTALW, Bioedit or CLC Workbench.
- amino acid according to the invention can be any of the twenty naturally occurring amino acid
- the standard amino acids can be divided into several groups based on their properties. Important factors are charge, hydrophilicity or hydrophobicity, size and functional groups. These properties are important for protein structure and protein-protein interactions. Some amino acids have special properties such as cysteine, that can form covalent disulfide bonds (or disulfide bridges) to other cysteine residues, proline that induces turns of the polypeptide backbone, and glycine that is more flexible than other amino acids. Table 1 shows the abbreviations and properties of the standard amino acids.
- the stable pre-fusion class I proteins are full length. In certain embodiments, the stable pre-fusion class I proteins are soluble proteins, for example soluble proteins based on the ectodomain or subdomains of the ectodomain.
- the mutations can be made to the protein by routine molecular biology procedures.
- the mutations according to the invention preferably result in increased expression levels and/or increased stabilization of the pre-fusion class I polypeptides as compared to the class I fusion polypeptides that do not comprise these mutation(s).
- the pre-fusion class I fusion protein polypeptides according to the invention are stable, i.e. do not readily change into the post-fusion conformation upon processing of the polypeptides, such as e.g. purification, freeze-thaw cycles, and/or storage etc.
- the pre-fusion class I fusion protein polypeptides according to the invention have an increased stability upon storage a 4°C as compared to a class I fusion protein polypeptide without the mutation(s).
- the polypeptides are stable upon storage at 4°C for at least 30 days, preferably at least 60 days, preferably at least 6 months, even more preferably at least 1 year.
- the class I fusion protein polypeptides according to the invention have an increased stability when subjected to heat, as compared to class I fusion protein polypeptides without said mutation(s).
- the pre-fusion conformation of the class I fusion protein polypeptides are heat stable for at least 30 minutes at a temperature of 55° C, preferably at 58° C, more preferably at 60° C
- heat stable it is meant that the polypeptides still display the at least one pre-fusion specific epitope after having been subjected for at least 30 minutes to an increased temperature (i.e. a temperature of 55°C or above.
- the proteins display the at least one pre-fusion specific epitope after being subjected to 1 to 6 freeze-thaw cycles in an appropriate formulation buffer.
- nucleotide sequences are provided from 5 ' to 3' direction, and amino acid sequences from N-terminus to C-terminus, as custom in the art.
- the present invention further provides nucleic acid molecules encoding the pre-fusion class I proteins according to the invention.
- the nucleic acid molecules encoding the proteins according to the invention are co don-optimized for expression in mammalian cells, preferably human cells.
- Methods of codon-optimization are known and have been described previously (e.g. WO 96/09378).
- a sequence is considered codon-optimized if at least one non-preferred codon as compared to a wild type sequence is replaced by a codon that is more preferred.
- a non-preferred codon is a codon that is used less frequently in an organism than another codon coding for the same amino acid
- a codon that is more preferred is a codon that is used more frequently in an organism than a non-preferred codon.
- the frequency of codon usage for a specific organism can be found in codon frequency tables, such as in http://www.kazusa.or.jp/codon.
- nucleic acid molecules can encode the same polypeptide as a result of the degeneracy of the genetic code. It is also understood that skilled persons may, using routine techniques, make nucleotide substitutions that do not affect the polypeptide sequence encoded by the nucleic acid molecules to reflect the codon usage of any particular host organism in which the polypeptides are to be expressed. Therefore, unless otherwise specified, a "nucleotide sequence encoding an amino acid sequence" includes all nucleotide sequences that are degenerate versions of each other and that encode the same amino acid sequence. Nucleotide sequences that encode proteins and R A may or may not include introns.
- Nucleic acid sequences can be cloned using routine molecular biology techniques, or generated de novo by DNA synthesis, which can be performed using routine procedures by service companies having business in the field of DNA synthesis and/or molecular cloning (e.g. GeneArt, GenScripts, Invitrogen, Eurof ns).
- routine molecular biology techniques or generated de novo by DNA synthesis, which can be performed using routine procedures by service companies having business in the field of DNA synthesis and/or molecular cloning (e.g. GeneArt, GenScripts, Invitrogen, Eurof ns).
- the invention also provides vectors comprising a nucleic acid molecule as described above.
- a nucleic acid molecule according to the invention thus is part of a vector.
- Such vectors can easily be manipulated by methods well known to the person skilled in the art, and can for instance be designed for being capable of replication in prokaryotic and/or eukaryotic cells.
- many vectors can be used for transformation of eukaryotic cells and will integrate in whole or in part into the genome of such cells, resulting in stable host cells comprising the desired nucleic acid in their genome.
- the vector used can be any vector that is suitable for cloning DNA and that can be used for transcription of a nucleic acid of interest. Suitable vectors according to the invention are e.g.
- adenovectors such as e.g. Ad26 or Ad35, alphavirus, paramyxovirus, vaccinia virus, herpes virus, retroviral vectors etc.
- Ad26 or Ad35 alphavirus
- paramyxovirus paramyxovirus
- vaccinia virus vaccinia virus
- herpes virus retroviral vectors etc.
- retroviral vectors etc.
- the person skilled in the art is capable of choosing suitable expression vectors, and inserting the nucleic acid sequences of the invention in a functional manner.
- Host cells comprising the nucleic acid molecules encoding the pre-fusion class I proteins form also part of the invention.
- the pre-fusion class I proteins may be produced through recombinant DNA technology involving expression of the molecules in host cells, e.g. Chinese hamster ovary (CHO) cells, tumor cell lines, BHK cells, human cell lines such as HEK293 cells, PER.C6 cells, or yeast, fungi, insect cells, and the like, or transgenic animals or plants.
- the cells are from a multicellular organism, in certain embodiments they are of vertebrate or invertebrate origin.
- the cells are mammalian cells.
- the cells are human cells.
- the production of a recombinant proteins, such the pre-fusion class I proteins of the invention, in a host cell comprises the introduction of a heterologous nucleic acid molecule encoding the class I proteins in expressible format into the host cell, culturing the cells under conditions conducive to expression of the nucleic acid molecule and allowing expression of the polypeptide in said cell.
- the nucleic acid molecule encoding a protein in expressible format may be in the form of an expression cassette, and usually requires sequences capable of bringing about expression of the nucleic acid, such as enhancer(s), promoter, polyadenylation signal, and the like.
- promoters can be used to obtain expression of a gene in host cells. Promoters can be constitutive or regulated, and can be obtained from various sources, including viruses, prokaryotic, or eukaryotic sources, or artificially designed.
- Cell culture media are available from various vendors, and a suitable medium can be routinely chosen for a host cell to express the protein of interest, here the pre-fusion class I proteins.
- the suitable medium may or may not contain serum.
- a "heterologous nucleic acid molecule” (also referred to herein as 'transgene') is a nucleic acid molecule that is not naturally present in the host cell. It is introduced into for instance a vector by standard molecular biology techniques.
- a transgene is generally operably linked to expression control sequences. This can for instance be done by placing the nucleic acid encoding the transgene(s) under the control of a promoter. Further regulatory sequences may be added. Many promoters can be used for expression of a transgene(s), and are known to the skilled person, e.g. these may comprise viral, mammalian, synthetic promoters, and the like.
- a non- limiting example of a suitable promoter for obtaining expression in eukaryotic cells is a CMV-promoter (US 5,385,839), e.g. the CMV immediate early promoter, for instance comprising nt. -73 to +95 from the CMV immediate early gene enhancer/promoter.
- a polyadenylation signal for example the bovine growth hormone polyA signal (US 5,122,458), may be present behind the transgene(s).
- several widely used expression vectors are available in the art and from commercial sources, e.g.
- pcDNA and pEF vector series of Invitrogen pMSCV and pTK-Hyg from BD Sciences, pCMV-Script from Stratagene, etc, which can be used to recombinantly express the protein of interest, or to obtain suitable promoters and/or transcription terminator sequences, polyA sequences, and the like.
- the cell culture can be any type of cell culture, including adherent cell culture, e.g. cells attached to the surface of a culture vessel or to microcarriers, as well as suspension culture.
- adherent cell culture e.g. cells attached to the surface of a culture vessel or to microcarriers
- suspension culture Most large-scale suspension cultures are operated as batch or fed-batch processes because they are the most straightforward to operate and scale up.
- continuous processes based on perfusion principles are becoming more common and are also suitable.
- Suitable culture media are also well known to the skilled person and can generally be obtained from commercial sources in large quantities, or custom-made according to standard protocols. Culturing can be done for instance in dishes, roller bottles or in bioreactors, using batch, fed-batch, continuous systems and the like. Suitable conditions for culturing cells are known (see e.g. Tissue Culture, Academic Press, Kruse and Paterson, editors (1973), and R.I. Freshney, Culture of animal cells: A manual of basic technique, fourth edition (W
- the invention further provides compositions comprising a pre-fusion class I protein and/or a nucleic acid molecule, and/or a vector, as described above.
- the invention thus provides compositions comprising a pre-fusion class I protein that displays an epitope that is present in a pre-fusion conformation of the class I protein but is absent in the post- fusion conformation.
- the invention also provides compositions comprising a nucleic acid molecule and/or a vector, encoding such pre-fusion class I protein.
- the invention further provides immunogenic compositions comprising a pre-fusion class I protein, and/or a nucleic acid molecule, and/or a vector, as described above.
- the invention also provides the use of a stabilized pre-fusion class I protein, a nucleic acid molecule, and/or a vector, according to the invention, for inducing an immune response against said class I proteins in a subject. Further provided are methods for inducing an immune response against a class I fusion protein in a subject, comprising administering to the subject a pre-fusion class I fusion protein, and/or a nucleic acid molecule, and/or a vector, according to the invention. Also provided are pre- fusion class I fusion proteins, nucleic acid molecules, and/or vectors, according to the invention for use in inducing an immune response against said class I fusion protein in a subject. Further provided is the use of the pre-fusion class I fusion protein, and/or nucleic acid molecules, and/or vectors according to the invention for the manufacture of a
- the pre-fusion class I proteins according to the invention are for use as a vaccine.
- pre-fusion class I fusion proteins, nucleic acid molecules and/or vectors according to the invention may be used e.g. in stand-alone treatment and/or prophylaxis of a disease or condition caused by the virus comprising said class I fusion protein, or in combination with other prophylactic and/or therapeutic treatments, such as (existing or future) vaccines, antiviral agents and/or monoclonal antibodies.
- the invention further provides methods for preventing and/or treating virus infection in a subject utilizing the pre-fusion class I fusion proteins, nucleic acid molecules and/or vectors according to the invention.
- a method for preventing and/or treating a virus infection in a subject comprises administering to a subject in need thereof an effective amount of a pre-fusion class I fusion protein, nucleic acid molecule and/or a vector, as described above.
- a therapeutically effective amount refers to an amount of a class I fusion protein, nucleic acid molecule or vector that is effective for preventing, ameliorating and/or treating a disease or condition resulting from infection by a virus comprising said class I fusion protein.
- Prevention encompasses inhibiting or reducing the spread of virus or inhibiting or reducing the onset, development or progression of one or more of the symptoms associated with infection by said virus.
- Amelioration as used in herein may refer to the reduction of visible or perceptible disease symptoms, viremia, or any other measurable manifestation of a viral infection.
- the invention may employ
- compositions comprising a pre-fusion class I fusion protein, a nucleic acid molecule and/or a vector as described herein, and a pharmaceutically acceptable carrier or excipient.
- pharmaceutically acceptable means that the carrier or excipient, at the dosages and concentrations employed, will not cause any unwanted or harmful effects in the subjects to which they are administered.
- Such pharmaceutically acceptable carriers and excipients are well known in the art (see Remington's Pharmaceutical Sciences, 18th edition, A. R. Gennaro, Ed., Mack Publishing Company [1990]; Pharmaceutical Formulation Development of Peptides and Proteins, S. Frokjaer and L.
- the pre-fusion class I polypeptides, or nucleic acid molecules preferably are formulated and administered as a sterile solution although it may also be possible to utilize lyophilized preparations.
- Sterile solutions are prepared by sterile filtration or by other methods known per se in the art. The solutions are then lyophilized or filled into pharmaceutical dosage containers.
- the pH of the solution generally is in the range of pH 3.0 to 9.5, e.g. pH 5.0 to 7.5.
- a composition according to the invention further comprises one or more adjuvants.
- Adjuvants are known in the art to further increase the immune response to an applied antigenic determinant.
- the terms "adjuvant” and “immune stimulant” are used interchangeably herein, and are defined as one or more substances that cause stimulation of the immune system.
- an adjuvant is used to enhance an immune response to the class I fusion protein of the invention.
- suitable adjuvants include aluminium salts such as aluminium hydroxide and/or aluminium phosphate; oil-emulsion compositions (or oil-in-water compositions), including squalene-water emulsions, such as MF59 (see e.g. WO 90/14837); saponin formulations, such as for example QS21 and
- Immunostimulating Complexes (ISCOMS) (see e.g. US 5,057,540; WO 90/03184, WO 96/11711, WO 2004/004762, WO 2005/002620); bacterial or microbial derivatives, examples of which are monophosphoryl lipid A (MPL), 3-O-deacylated MPL (3dMPL), CpG-motif containing oligonucleotides, ADP-ribosylating bacterial toxins or mutants thereof, such as E. coli heat labile enterotoxin LT, cholera toxin CT, and the like; eukaryotic proteins (e.g.
- compositions of the invention comprise aluminium as an adjuvant, e.g. in the form of aluminium hydroxide, aluminium phosphate, aluminium potassium phosphate, or combinations thereof, in concentrations of 0.05 - 5 mg, e.g. from 0.075-1.0 mg, of aluminium content per dose.
- compositions do not comprise adjuvants.
- HIV-1 Env sequence was based on a consensus sequence based on clade C. Therefore an alignment was downloaded (HIV Sequence Alignments. 3,434 sequences in total) from the Los Alamos database (http://www.hiv.lanl.gov/content/index). Only the C- clade ENVs (1,252 sequences) were used in the consensus maker in the Los Alamos HIV database website.
- Env proteins used in ELISA contained a C-terminal C-tag and additional I201C-A433C mutations ( won et al. Nat Struct Mol Biol, (2015), 22(7):522-531).
- Env proteins used in AlphaLISA and SEC-MALS contained a C-terminal SortA-Flag-35GS-His-tag.
- the cells were transiently transfected using ExpiFectamine293 (Life Technologies) according to the manufacturer's instructions and cultured in a shaking incubator at 37 °C and 8% C02. The culture supernatants containing HIV envelope protein (Env) were harvested on day 3 (for
- C- tagged Env was purified using C-tag affinity chromatography and the SortA-Flag-35GS-His- tagged Env was purified using Galanthus nivalus lectin chromatography, followed by SEC- MALS.
- the recombinant HIV env proteins were purified by a 2-step purification protocol applying a Galantus nivalis-lectin column (Vectorlabs, AL-1243, lot Z0325) for the initial purification and subsequently a superdex200 Increase column (GE) for the polishing step to remove residual contaminants.
- the culture supernatant was diluted with 40 mM Tris, 500 mM NaCl pH7.5 and passed over a 4 ml CV Tricorn 10-50 Lectin Agarose Column at 4 ml per minute. Subsequently the column was washed with 4 column volumes (CV) of 40 mM Tris, 500 mM NaCl pH7.5 and eluted 4 CV of 40 mM Tris, 500 mM NaCl, 1M Mannopyronoside pH7.5 with an upflow of 1.6 mL/min.
- CV column volumes
- the eluate was concentrated using a spin concentrator (5 OK, Amicon Ultra, Millipore) and the protein was further purified using a superdex200 column using 50 mM Tris, 150 mM NaCl pH 7.4 as running buffer.
- the second peak contained the HIV gpl40 trimer.
- the fractions containing this peak were again pooled and the protein concentration was determined using OD280 and stored a 4°C until use.
- the identity of the band was verified using Western blotting (not shown) SDS-PAGE analysis and Western blot.
- Cell culture supernatants or purified protein samples were analyzed on 4-12% (w/v) Bis-Tris NuPAGE gels, IX MOPS (Life).
- trimer percentage was calculated by multiplying the trimer percentage with the total Env expression level and normalized to I559P, which was set at 1 ( Figure 3B). All substitutions show higher trimer percentage and yield compared to the protein without proline substitutions in the hinge- loop. All double substitutions increase trimer percentage and in particular trimer yield compared to I559P variant. Based on these finding a triple mutant L556P, A558P, I559P was constructed and compared to I559P and double mutants L556P, I559P and A558P, I559P. These variants were analyzed in cell- free supernatant using AlphaLISA.
- AlphaLISA is a bead-based proximity assay in which singlet oxygen molecules, generated by high energy irradiation of Donor beads, transfer to Acceptor beads, which are within a distance of approximately 200 nm. Subsequently, a cascading series of chemical reactions results in a chemiluminescent signal (Eglen et al. Curr Chem Genomics (2008), 1 : 2-10).
- the constructs were equipped with a Flag-His tag (with a 35GS linker in between). The HIV constructs were expressed in Expi293 cells, which were cultured for 3 days in 96 well plates (200 ⁇ /well).
- Neo BioTek
- the donor beads were conjugated to ProtA (Cat#: AS102M, Lot# 1831829, Perkin Elmer), which could bind to the mAb.
- the acceptor beads were conjugated to an anti-His antibody (Cat#: AL112R, Lot# 2036860, Perkin Elmer) to detect the His-tag of the protein.
- an anti-His antibody Cat#: AL112R, Lot# 2036860, Perkin Elmer
- FIG. 5 shows the NativePAGE analysis of supernatants from ebola GP variants with proline substitutions at position 575, 576, 577, 579, 581 and 583. As shown in Figure 5 A, only variants with substitutions at positions 577 and 579 showed high expression and had higher trimer content compared to the wt sequence.
- the trimer and monomer bands of the WT, T577P and L579P mutants were determined (Fig 5B) and their relative percentages calculated (Fig 5C).
- NativePAGE Bis-Tris gels system (Life technologies) was used to analyse the supernatants from transiently transfected cells. Subsequently the gels were stained by Coomassie.
- the Native PAGE gel was scanned using Biorad ChemiDoc MP. The quantification was done using Biorads Image Lab software, using the "Lane and band" analysis tool. Therefore the protein lanes are highlighted and the protein bands of interest are selected. The software calculates the intensity of the highlighted bands and their relative amounts were calculated.
- HIS-tag purified GP variants were tested for temperature stability by DSF.
- Protein was mixed with SYPRO orange fluorescent dye (Life Technologies S6650) in a 96- well optical qPCR plate. The optimal dye and protein concentration was determined experimentally. All protein dilutions were performed in PBS, and a negative control sample containing the dye only was used as a reference subtraction. The measurement was performed in a qPCR instrument (Applied Biosystems ViiA 7) using the following parameters: a temperature ramp from 25-85 °C with a rate of 0.015 °C per second. Data was collected continuously. The negative first derivative of the Sypro Orange signal measured at several intervals during a temperature ramp up to 85 degrees.
- Raw data from the Sypro Orange assay was analyzed using an R script which parses ViiA7 output (machine used for the Sypro assay) and merges the sample information with the melt curve data.
- Spotfire software was used to subtract the controls from the data (buffer with Sypro Orange). Then it determines top and bottom of the melt curves and normalizes the curves for values between 0 and 100. Duplicates are averaged from duplicate runs and Tm determined at half maximal value.
- the fusion domain of Influenza is sequestered in the Hemagglutinin protein that has a head domain (mostly HA1) that is responsible for binding to sialic acid (hemagglutination functionality) and a stem domain (mostly HA2) that contains the fusion domain.
- head domain mostly HA1
- stem domain mostly HA2
- HA2 Ser73 was substituted to Leu or Pro to remove the glycan at position 71 and study the effect of the hydrophobic rigidifying Proline residue versus the hydrophobic Leucine residue in the hinge loop (B-loop). Because the mini-Hemagglutinin did not contain the head domain, a variant was made in which Lys68 was substituted to Gln68 because the Lysine is originally involved in a conserved salt-bridge between the B-loop and the head domain. Because the head was deleted, the salt-bridge was gone and Lysine could be changed to the neutral Glutamine.
- Recombinant proteins were expressed in 293 Freestyle cells (as described below). Stability of the mini-hemagglutinin variants was accessed by an ELISA in which the multimer content of the protein is measured. Supernatants of transfected cell were tested in multimer ELISA. Plates were coated with the stem-specific broadly neutralizing MAb CR9114 (Dreyfus et. al, Science (2012), 337(6100):1343-8). Supematants were titrated and incubated with the coated plates. After washing, the captured multimers were incubated with biotinylated CR9114. Next the wells were incubated with HRP- conjugated streptavidin followed by addition of HRP substrate (Impagliazzo et.
- Figure 8 shows that variants with P73 in the hinge loop (B-loop) showed higher multimer expression than variants with L73. Additionally, a substitution of Tyr to Pro at position 63 of mini-HA #4650 also resulted in an almost 2-fold higher multimer expression (Fig 8C). These results show that hinge stabilization is also successful for the class I fusion protein of the orthomyxovirus Influenza HA.
- constructs were synthesized and codon-optimized at GenScript (Piscataway, NJ 08854) or at Gene Art (Life Technologies, Carlsbad, CA).
- GenScript Procataway, NJ 08854
- Gene Art Gene Art (Life Technologies, Carlsbad, CA).
- the constructs were cloned into pCDNA2004 or generated by standard methods involving site-directed mutagenesis and
- HEK-Expi293 cells or HEK293F cells were transiently transfected with pCDNA2004 plasmid with the protein insert (and in case of HIV Env 90% env and 10% Furin-pCDNA2004), according to the manufacturer's instructions and cultured for 5 days at 37°C and 10% C02. The culture supernatant was harvested and spun for 5 minutes at 300 g to remove cells and cellular debris. The spun supernatant was subsequently sterile filtered using a 0.22 ⁇ vacuum filter and stored at 4°C until use. Table 1. Standard amino acids, abbreviations and properties
- HIV-l HXB2 540 QARQLLSGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARI 580 (SEQ ID NO : 1 )
- HIV-1 ConC 539 QARQLLSGIVQQQSNLLRAIEAQQHMLQLTV GIKQLQTRV 579 (SEQ ID NO : 2 )
- HIV-2 BAH97710.1 538 QSRTLLAGIVQQQQQLLDAVKRQQELLRLTV GTKNLQSRV 578 (SEQ ID NO:30)
- Ebola mayinga 553 GLICGLRQLANETTQALQLFLRATTELRTFSILNRKAIDFLLQR 596 (SEQ ID NO:10) Marburg 554 NLVCRLRRLANQTAKSLELLLRVTTEERTFSLINRHAI DFLLAR 597 (SEQ ID NO: 14)
- HIV150400 ConC_SOS LLSG IVQQQSN LLRAI EAQQH MLQLT VWG
- H IV150399 I559P LLSG I QQQS NLLRAP EAQQH M LQLTVWG H IV150401: A 558 P LLSG IVQQQSN LLRPI EAQQH M LQLTVWG HIV150402: L 556 P IVQQQSNLPRAI EAQQH M LQLTVWG H IV150403; L555P LLSG IVQQQSNPLRAI EAQQH MLQLTVWG HIV150404: 558P559P LLSG IVQQQSNLLRPPEAQQH IV!
- LQLTVWG H IV150405 556P559P LLSG IVQQQSN LP RAP EAQQH M LQLTVWG H IV160114: P558 559 LLSGIVQQQSNLPRPPEAQQH MLQLTVWG
- HIV-1 HXB2 g l60 with signal peptide SEQ ID NO: 9).
- HIV-2 Envelope protein SEQ ID NO: 35.
- MARBURG GP (SEQ ID NO: 17) MKTTCLLISLILIQGVKTLPILEIASNIQPQNVDSVCSGTLQKTEDVHLMGFTLSGQKVADSPLEASK RWAFRAGVPPKNVEYTEGEEAKTCYNISVTDPSGKSLLLDPPTNIRDYPKCKTIHHIQGQNPHAQGIA LHLWGAFFLYDRIASTTMYRGKVFTEGNIAAMIVNKTVHKMIFSRQGQGYRHMNLTSTNKY TSSNGT QTNDTGCFGTLQEYNSTKNQTCAPSKKPLPLPTAHPEVKLTSTSTDATKLNTTDPNSDDEDLTTSGSGSGEQEPYTTSDAATKQGLSSTMPPTPSPQPSTPQQGGNNTNHSQGVVTEPGKTNTTAQPSMPPHNTTT I STNNTSKHNLSTPSVPIQNATNYNTQSTAPENEQ SAPSKTTLLPTENPT AKSTNSTKSPTT VPN TTNKYSTSPTPNSTAQHL
- Hemagglutinin Influenza A virus (group l)(A/Brisbane/59/2007(HlNl) (SEQ ID NO: 21).
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Virology (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Molecular Biology (AREA)
- Public Health (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Veterinary Medicine (AREA)
- Oncology (AREA)
- Communicable Diseases (AREA)
- Immunology (AREA)
- Biochemistry (AREA)
- Gastroenterology & Hepatology (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Engineering & Computer Science (AREA)
- Pulmonology (AREA)
- Biotechnology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- AIDS & HIV (AREA)
- Tropical Medicine & Parasitology (AREA)
- Peptides Or Proteins (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
Priority Applications (9)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| JP2018511416A JP6975709B2 (ja) | 2015-09-02 | 2016-09-01 | 安定化したウイルスクラスi融合タンパク質 |
| US15/756,800 US10538557B2 (en) | 2015-09-02 | 2016-09-01 | Stabilized viral class I fusion proteins |
| EP21200796.7A EP4019044A3 (en) | 2015-09-02 | 2016-09-01 | Stabilized viral class i fusion proteins |
| AU2016316723A AU2016316723B2 (en) | 2015-09-02 | 2016-09-01 | Stabilized viral class I fusion proteins |
| CN201680051120.1A CN108025057B (zh) | 2015-09-02 | 2016-09-01 | 稳定化的病毒i类融合蛋白 |
| EP16760463.6A EP3344288A1 (en) | 2015-09-02 | 2016-09-01 | Stabilized viral class i fusion proteins |
| CA2997181A CA2997181A1 (en) | 2015-09-02 | 2016-09-01 | Stabilized viral class i fusion proteins |
| US16/701,429 US10711042B2 (en) | 2015-09-02 | 2019-12-03 | Stabilized viral class I fusion proteins |
| AU2021201330A AU2021201330A1 (en) | 2015-09-02 | 2021-03-02 | Stabilized viral class I fusion proteins |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201562213466P | 2015-09-02 | 2015-09-02 | |
| US62/213,466 | 2015-09-02 |
Related Child Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US15/756,800 A-371-Of-International US10538557B2 (en) | 2015-09-02 | 2016-09-01 | Stabilized viral class I fusion proteins |
| US16/701,429 Continuation US10711042B2 (en) | 2015-09-02 | 2019-12-03 | Stabilized viral class I fusion proteins |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2017037196A1 true WO2017037196A1 (en) | 2017-03-09 |
Family
ID=56855456
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/EP2016/070654 Ceased WO2017037196A1 (en) | 2015-09-02 | 2016-09-01 | Stabilized viral class i fusion proteins |
Country Status (7)
| Country | Link |
|---|---|
| US (2) | US10538557B2 (https=) |
| EP (2) | EP4019044A3 (https=) |
| JP (2) | JP6975709B2 (https=) |
| CN (1) | CN108025057B (https=) |
| AU (2) | AU2016316723B2 (https=) |
| CA (1) | CA2997181A1 (https=) |
| WO (1) | WO2017037196A1 (https=) |
Cited By (12)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2020035497A1 (en) | 2018-08-13 | 2020-02-20 | Janssen Vaccines & Prevention B.V. | Stabilized filovirus glycoprotein trimers |
| WO2021228842A1 (en) | 2020-05-11 | 2021-11-18 | Janssen Pharmaceuticals, Inc. | Stabilized coronavirus spike protein fusion proteins |
| WO2021229450A1 (en) | 2020-05-11 | 2021-11-18 | Janssen Pharmaceuticals, Inc. | Sars-cov-2 vaccines |
| WO2021229448A1 (en) | 2020-05-11 | 2021-11-18 | Janssen Pharmaceuticals, Inc. | Rna replicon encoding a stabilized corona virus spike protein |
| WO2022008438A1 (en) | 2020-07-06 | 2022-01-13 | Janssen Pharmaceuticals, Inc. | Stabilized corona virus spike protein fusion proteins |
| WO2022032274A1 (en) * | 2020-08-02 | 2022-02-10 | Richard Ascione | Vaccine compositions for influenza viruses and methods of use |
| WO2023047349A1 (en) | 2021-09-24 | 2023-03-30 | Janssen Pharmaceuticals, Inc. | Stabilized coronavirus spike protein fusion proteins |
| WO2023047348A1 (en) | 2021-09-24 | 2023-03-30 | Janssen Pharmaceuticals, Inc. | Stabilized corona virus spike protein fusion proteins |
| JP2023527556A (ja) * | 2020-05-29 | 2023-06-29 | ボード オブ リージェンツ,ザ ユニバーシティ オブ テキサス システム | 操作されたコロナウイルススパイク(s)タンパク質およびその使用方法 |
| WO2024061759A1 (en) | 2022-09-23 | 2024-03-28 | Janssen Vaccines & Prevention B.V. | Stabilized coronavirus s proteins |
| WO2025051975A1 (en) * | 2023-09-06 | 2025-03-13 | Sanofi | Modified influenza b hemagglutinin polypeptides and nucleic acids and uses thereof |
| EP4314018A4 (en) * | 2021-03-30 | 2025-04-30 | Baylor College of Medicine | Polypeptide-based protein inhibition methods and compositions with high sweetness |
Families Citing this family (8)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP4494650A3 (en) | 2015-09-03 | 2025-03-26 | Novavax, Inc. | Vaccine compositions having improved stability and immunogenicity |
| EP4599847A3 (en) | 2016-10-25 | 2025-11-12 | Trustees of Dartmouth College | Prefusion coronavirus spike proteins and their use |
| WO2019023196A1 (en) | 2017-07-24 | 2019-01-31 | Novavax, Inc. | METHODS AND COMPOSITIONS FOR TREATING RESPIRATORY DISEASE |
| EP3768308A4 (en) | 2018-03-19 | 2022-01-26 | Novavax, Inc. | MULTIVALENT INFLUENZA NANOPARTICLE VACCINES |
| CN109142723B (zh) * | 2018-08-21 | 2021-07-13 | 苏州华益美生物科技有限公司 | 人类免疫缺陷病毒快速检测测试卡及其应用 |
| US10953089B1 (en) | 2020-01-27 | 2021-03-23 | Novavax, Inc. | Coronavirus vaccine formulations |
| CN111704657B (zh) * | 2020-06-16 | 2021-11-09 | 四川安可瑞新材料技术有限公司 | Hiv-2重组抗原及其制备方法、用途 |
| CN116947982B (zh) * | 2023-07-12 | 2024-05-14 | 吉林大学 | 三条优势表位肽序列及其在流感病毒疫苗的应用 |
Citations (13)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO1990003184A1 (en) | 1988-09-30 | 1990-04-05 | Bror Morein | Matrix with immunomodulating activity |
| WO1990014837A1 (en) | 1989-05-25 | 1990-12-13 | Chiron Corporation | Adjuvant formulation comprising a submicron oil droplet emulsion |
| US5057540A (en) | 1987-05-29 | 1991-10-15 | Cambridge Biotech Corporation | Saponin adjuvant |
| US5122458A (en) | 1984-08-24 | 1992-06-16 | The Upjohn Company | Use of a bgh gdna polyadenylation signal in expression of non-bgh polypeptides in higher eukaryotic cells |
| US5385839A (en) | 1985-01-30 | 1995-01-31 | University Of Iowa Research Foundation | Transfer vectors and microorganisms containing human cytomegalovirus immediate-early promoter regulatory DNA sequence |
| WO1996009378A1 (en) | 1994-09-19 | 1996-03-28 | The General Hospital Corporation | Overexpression of mammalian and viral proteins |
| WO1996011711A1 (en) | 1994-10-12 | 1996-04-25 | Iscotec Ab | Saponin preparations and use thereof in iscoms |
| WO2004004762A1 (en) | 2002-07-05 | 2004-01-15 | Isconova Ab | Iscom preparation and use thereof |
| WO2005002620A1 (en) | 2003-07-07 | 2005-01-13 | Isconova Ab | Quil a fraction with low toxicity and use thereof |
| WO2013079473A1 (en) * | 2011-11-28 | 2013-06-06 | Crucell Holland B.V. | Influenza virus vaccines and uses thereof |
| WO2014174018A1 (en) * | 2013-04-25 | 2014-10-30 | Crucell Holland B.V. | Stabilized soluble prefusion rsv f polypeptides |
| EP2873423A2 (en) * | 2013-10-07 | 2015-05-20 | International Aids Vaccine Initiative | Soluble hiv-1 envelope glycoprotein trimers |
| EP3072901A1 (en) * | 2015-03-23 | 2016-09-28 | International Aids Vaccine Initiative | Soluble hiv-1 envelope glycoprotein trimers |
Family Cites Families (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| AU2009254501B2 (en) * | 2008-06-05 | 2014-07-31 | Ablynx N.V. | Amino acid sequences directed against envelope proteins of a virus and polypeptides comprising the same for the treatment of viral diseases |
| DK2707385T3 (da) * | 2011-05-13 | 2017-11-20 | Glaxosmithkline Biologicals Sa | RSV-F-præfusionsantigener |
| US20130122032A1 (en) * | 2011-09-30 | 2013-05-16 | Gale Smith | Recombinant nanoparticle rsv f vaccine for respiratory syncytial virus |
-
2016
- 2016-09-01 US US15/756,800 patent/US10538557B2/en active Active
- 2016-09-01 CN CN201680051120.1A patent/CN108025057B/zh active Active
- 2016-09-01 JP JP2018511416A patent/JP6975709B2/ja active Active
- 2016-09-01 EP EP21200796.7A patent/EP4019044A3/en not_active Withdrawn
- 2016-09-01 CA CA2997181A patent/CA2997181A1/en active Pending
- 2016-09-01 AU AU2016316723A patent/AU2016316723B2/en active Active
- 2016-09-01 EP EP16760463.6A patent/EP3344288A1/en not_active Withdrawn
- 2016-09-01 WO PCT/EP2016/070654 patent/WO2017037196A1/en not_active Ceased
-
2019
- 2019-12-03 US US16/701,429 patent/US10711042B2/en active Active
-
2020
- 2020-11-12 JP JP2020188363A patent/JP2021045138A/ja active Pending
-
2021
- 2021-03-02 AU AU2021201330A patent/AU2021201330A1/en not_active Abandoned
Patent Citations (13)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5122458A (en) | 1984-08-24 | 1992-06-16 | The Upjohn Company | Use of a bgh gdna polyadenylation signal in expression of non-bgh polypeptides in higher eukaryotic cells |
| US5385839A (en) | 1985-01-30 | 1995-01-31 | University Of Iowa Research Foundation | Transfer vectors and microorganisms containing human cytomegalovirus immediate-early promoter regulatory DNA sequence |
| US5057540A (en) | 1987-05-29 | 1991-10-15 | Cambridge Biotech Corporation | Saponin adjuvant |
| WO1990003184A1 (en) | 1988-09-30 | 1990-04-05 | Bror Morein | Matrix with immunomodulating activity |
| WO1990014837A1 (en) | 1989-05-25 | 1990-12-13 | Chiron Corporation | Adjuvant formulation comprising a submicron oil droplet emulsion |
| WO1996009378A1 (en) | 1994-09-19 | 1996-03-28 | The General Hospital Corporation | Overexpression of mammalian and viral proteins |
| WO1996011711A1 (en) | 1994-10-12 | 1996-04-25 | Iscotec Ab | Saponin preparations and use thereof in iscoms |
| WO2004004762A1 (en) | 2002-07-05 | 2004-01-15 | Isconova Ab | Iscom preparation and use thereof |
| WO2005002620A1 (en) | 2003-07-07 | 2005-01-13 | Isconova Ab | Quil a fraction with low toxicity and use thereof |
| WO2013079473A1 (en) * | 2011-11-28 | 2013-06-06 | Crucell Holland B.V. | Influenza virus vaccines and uses thereof |
| WO2014174018A1 (en) * | 2013-04-25 | 2014-10-30 | Crucell Holland B.V. | Stabilized soluble prefusion rsv f polypeptides |
| EP2873423A2 (en) * | 2013-10-07 | 2015-05-20 | International Aids Vaccine Initiative | Soluble hiv-1 envelope glycoprotein trimers |
| EP3072901A1 (en) * | 2015-03-23 | 2016-09-28 | International Aids Vaccine Initiative | Soluble hiv-1 envelope glycoprotein trimers |
Non-Patent Citations (27)
| Title |
|---|
| "Handbook of Pharmaceutical Excipients", 2000, PHARMACEUTICAL PRESS |
| "Pharmaceutical Formulation Development of Peptides and Proteins", 2000, TAYLOR & FRANCIS |
| "Remington's Pharmaceutical Sciences", 1990, MACK PUBLISHING COMPANY |
| "Tissue Culture", 1973, ACADEMIC PRESS |
| BEDDOWS SIMON ET AL: "Construction and characterization of soluble, cleaved, and stabilized trimeric Env proteins based on HIV type 1 Env subtype A", AIDS RESEARCH AND HUMAN RETROVIRUSES, MARY ANN LIEBERT, US, vol. 22, no. 6, 1 June 2006 (2006-06-01), pages 569 - 579, XP009135800, ISSN: 0889-2229 * |
| CATHERINE L. HUNT ET AL: "Filovirus Entry: A Novelty in the Viral Fusion World", VIRUSES, vol. 4, no. 12, 7 February 2012 (2012-02-07), pages 258 - 275, XP055308711, DOI: 10.3390/v4020258 * |
| DREYFUS, SCIENCE, vol. 337, no. 6100, 2012, pages 1343 - 8 |
| EARP ET AL., CURRENT TOPICS IN MICROBIOLOGY AND IMMUNOLOGY, vol. 185, 2005, pages 26 - 66 |
| EGLEN ET AL., CURR CHEM GENOMICS, vol. 1, 2008, pages 2 - 10 |
| GOMARA M J ET AL: "Roles of a conserved proline in the internal fusion peptide of Ebola glycoprotein", FEBS LETTERS, ELSEVIER, AMSTERDAM, NL, vol. 569, no. 1-3, 2 July 2004 (2004-07-02), pages 261 - 266, XP004517496, ISSN: 0014-5793, DOI: 10.1016/J.FEBSLET.2004.06.006 * |
| HUI QIAO ET AL: "Specific Single or Double Proline Substitutions in the "Spring-loaded" Coiled-Coil Region of the Influenza Hemagglutinin Impair or Abolish Membrane Fusion Activity", THE JOURNAL OF CELL BIOLOGY, vol. 141, no. 6, 15 June 1998 (1998-06-15), pages 1335 - 1347, XP055292514 * |
| IMPAGLIAZZO, SCIENCE, 2015 |
| IMPAGLIAZZO, SCIENCE, 24 August 2015 (2015-08-24) |
| J TIMMINS: "Structural studies on the Ebola virus matrix protein VP40 indicate that matrix proteins of enveloped RNA viruses are analogues but not homologues", FEMS MICROBIOLOGY LETTERS, vol. 233, no. 2, 15 April 2004 (2004-04-15), GB, pages 179 - 186, XP055323702, ISSN: 0378-1097, DOI: 10.1016/j.femsle.2004.03.002 * |
| J. A. GRUENKE ET AL: "New Insights into the Spring-Loaded Conformational Change of Influenza Virus Hemagglutinin", JOURNAL OF VIROLOGY., vol. 76, no. 9, 1 May 2002 (2002-05-01), US, pages 4456 - 4466, XP055322806, ISSN: 0022-538X, DOI: 10.1128/JVI.76.9.4456-4466.2002 * |
| JARDETZKY ET AL., CURRENT OPINION IN VIROLOGY, vol. 5, 2014, pages 24 - 33 |
| KANG Y ( ET AL: "Structural and immunogenicity studies of a cleaved, stabilized envelope trimer derived from subtype A HIV-1", VACCINE, ELSEVIER, AMSTERDAM, NL, vol. 27, no. 37, 13 August 2009 (2009-08-13), pages 5120 - 5132, XP026351749, ISSN: 0264-410X, [retrieved on 20090628] * |
| KRARUP A ET AL: "A highly stable prefusion RSV F vaccine derived from structural analysis of the fusion mechanism", NATURE COMMUNICATIONS, NATURE PUBLISHING GROUP, UNITED KINGDOM, vol. 6, 3 September 2015 (2015-09-03), pages 8143 - 1, XP002755858, ISSN: 2041-1723, [retrieved on 20150903], DOI: 10.1038/NCOMMS9143 * |
| KRARUP ET AL., NATURE COMMUNICATIONS, 2015, pages 8143 |
| KWON ET AL., NAT STRUCT MOL BIOL, vol. 22, no. 7, 2015, pages 522 - 531 |
| MARIE PANCERA ET AL: "Structure and immune recognition of trimeric pre-fusion HIV-1 Env", NATURE, vol. 514, no. 7523, 8 October 2014 (2014-10-08), pages 455 - 461, XP055178485, ISSN: 0028-0836, DOI: 10.1038/nature13808 * |
| PANCERA ET AL., NATURE, vol. 514, 2014, pages 455 - 461 |
| R.I. FRESHNEY: "Culture of animal cells: A manual of basic technique", 2000, WILEY-LISS INC. |
| SANDERS ET AL., JOURNAL OF VIROLOGY, vol. 76, 2002, pages 8875 - 8889 |
| SANDERS R W ET AL: "Stabilization of the soluble, cleaved, trimeric form of the envelope glycoprotein complex of human immunodeficiency virus type 1", JOURNAL OF VIROLOGY, THE AMERICAN SOCIETY FOR MICROBIOLOGY, US, vol. 76, no. 17, 1 September 2002 (2002-09-01), pages 8875 - 8889, XP002393505, ISSN: 0022-538X, DOI: 10.1128/JVI.76.17.8875-8889.2002 * |
| SANDERS, J VIROL, 2002 |
| SINGH M ET AL: "LearnCoil-VMF: computational evidence for coiled-coil-like motifs in many viral membrane-fusion proteins", JOURNAL OF MOLECULAR BIOLOGY, ACADEMIC PRESS, UNITED KINGDOM, vol. 290, no. 5, 30 July 1999 (1999-07-30), pages 1031 - 1041, XP004461983, ISSN: 0022-2836, DOI: 10.1006/JMBI.1999.2796 * |
Cited By (16)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2020035497A1 (en) | 2018-08-13 | 2020-02-20 | Janssen Vaccines & Prevention B.V. | Stabilized filovirus glycoprotein trimers |
| CN112823021A (zh) * | 2018-08-13 | 2021-05-18 | 扬森疫苗与预防公司 | 稳定化的丝状病毒糖蛋白三聚体 |
| US11603390B2 (en) | 2018-08-13 | 2023-03-14 | Janssen Vaccines & Prevention B.V. | Stabilized Filovirus glycoprotein trimers |
| JP2021533772A (ja) * | 2018-08-13 | 2021-12-09 | ヤンセン ファッシンズ アンド プリベンション ベーフェーJanssen Vaccines & Prevention B.V. | フィロウイルス糖タンパク質の安定化された三量体 |
| WO2021229448A1 (en) | 2020-05-11 | 2021-11-18 | Janssen Pharmaceuticals, Inc. | Rna replicon encoding a stabilized corona virus spike protein |
| WO2021229450A1 (en) | 2020-05-11 | 2021-11-18 | Janssen Pharmaceuticals, Inc. | Sars-cov-2 vaccines |
| WO2021228842A1 (en) | 2020-05-11 | 2021-11-18 | Janssen Pharmaceuticals, Inc. | Stabilized coronavirus spike protein fusion proteins |
| JP2023527556A (ja) * | 2020-05-29 | 2023-06-29 | ボード オブ リージェンツ,ザ ユニバーシティ オブ テキサス システム | 操作されたコロナウイルススパイク(s)タンパク質およびその使用方法 |
| EP4157345A4 (en) * | 2020-05-29 | 2024-09-11 | Board of Regents, The University of Texas System | GENETICALLY MODIFIED CORONAVIRUS SPIKE(S) PROTEIN AND METHODS OF USE THEREOF |
| WO2022008438A1 (en) | 2020-07-06 | 2022-01-13 | Janssen Pharmaceuticals, Inc. | Stabilized corona virus spike protein fusion proteins |
| WO2022032274A1 (en) * | 2020-08-02 | 2022-02-10 | Richard Ascione | Vaccine compositions for influenza viruses and methods of use |
| EP4314018A4 (en) * | 2021-03-30 | 2025-04-30 | Baylor College of Medicine | Polypeptide-based protein inhibition methods and compositions with high sweetness |
| WO2023047349A1 (en) | 2021-09-24 | 2023-03-30 | Janssen Pharmaceuticals, Inc. | Stabilized coronavirus spike protein fusion proteins |
| WO2023047348A1 (en) | 2021-09-24 | 2023-03-30 | Janssen Pharmaceuticals, Inc. | Stabilized corona virus spike protein fusion proteins |
| WO2024061759A1 (en) | 2022-09-23 | 2024-03-28 | Janssen Vaccines & Prevention B.V. | Stabilized coronavirus s proteins |
| WO2025051975A1 (en) * | 2023-09-06 | 2025-03-13 | Sanofi | Modified influenza b hemagglutinin polypeptides and nucleic acids and uses thereof |
Also Published As
| Publication number | Publication date |
|---|---|
| EP3344288A1 (en) | 2018-07-11 |
| EP4019044A2 (en) | 2022-06-29 |
| CA2997181A1 (en) | 2017-03-09 |
| AU2016316723A1 (en) | 2018-02-22 |
| CN108025057A (zh) | 2018-05-11 |
| AU2021201330A1 (en) | 2021-03-18 |
| US20200115421A1 (en) | 2020-04-16 |
| US10711042B2 (en) | 2020-07-14 |
| CN108025057B (zh) | 2023-04-18 |
| US20180346521A1 (en) | 2018-12-06 |
| EP4019044A3 (en) | 2022-08-24 |
| JP2018529331A (ja) | 2018-10-11 |
| JP2021045138A (ja) | 2021-03-25 |
| US10538557B2 (en) | 2020-01-21 |
| AU2016316723B2 (en) | 2021-03-25 |
| JP6975709B2 (ja) | 2021-12-01 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US10711042B2 (en) | Stabilized viral class I fusion proteins | |
| US11998597B2 (en) | Vaccine against RSV | |
| AU2021232702B2 (en) | Stabilized pre-fusion RSV F proteins | |
| WO2017207477A1 (en) | Stabilized pre-fusion rsv f proteins | |
| HK40051815A (en) | Vaccine against rsv comprising modified f polypeptide | |
| EA046012B1 (ru) | Вакцины против вируса гриппа и пути их применения | |
| OA19273A (en) | Stabilized pre-fusion RSV F proteins. |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 16760463 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 2016316723 Country of ref document: AU Date of ref document: 20160901 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2997181 Country of ref document: CA Ref document number: 2018511416 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2016760463 Country of ref document: EP |