WO2016205554A1 - Compositions and methods for directing proteins to specific loci in the genome - Google Patents
Compositions and methods for directing proteins to specific loci in the genome Download PDFInfo
- Publication number
- WO2016205554A1 WO2016205554A1 PCT/US2016/037922 US2016037922W WO2016205554A1 WO 2016205554 A1 WO2016205554 A1 WO 2016205554A1 US 2016037922 W US2016037922 W US 2016037922W WO 2016205554 A1 WO2016205554 A1 WO 2016205554A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- disclosure
- dna
- seq
- sequence
- cell
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y301/00—Hydrolases acting on ester bonds (3.1)
- C12Y301/21—Endodeoxyribonucleases producing 5'-phosphomonoesters (3.1.21)
- C12Y301/21004—Type II site-specific deoxyribonuclease (3.1.21.4)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/16—Hydrolases (3) acting on ester bonds (3.1)
- C12N9/22—Ribonucleases [RNase]; Deoxyribonucleases [DNase]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/10—Processes for the isolation, preparation or purification of DNA or RNA
- C12N15/102—Mutagenizing nucleic acids
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/113—Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/87—Introduction of foreign genetic material using processes not otherwise provided for, e.g. co-transformation
- C12N15/90—Stable introduction of foreign DNA into chromosome
- C12N15/902—Stable introduction of foreign DNA into chromosome using homologous recombination
- C12N15/907—Stable introduction of foreign DNA into chromosome using homologous recombination in mammalian cells
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/16—Hydrolases (3) acting on ester bonds (3.1)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/16—Hydrolases (3) acting on ester bonds (3.1)
- C12N9/22—Ribonucleases [RNase]; Deoxyribonucleases [DNase]
- C12N9/222—Clustered regularly interspaced short palindromic repeats [CRISPR]-associated [CAS] enzymes
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/80—Fusion polypeptide containing a DNA binding domain, e.g. Lacl or Tet-repressor
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2310/00—Structure or type of the nucleic acid
- C12N2310/10—Type of nucleic acid
- C12N2310/20—Type of nucleic acid involving clustered regularly interspaced short palindromic repeats [CRISPR]
Definitions
- the present invention is directed to compositions and methods for targeted gene modification.
- compositions and methods for directing a protein to a specific locus or loci in a genome of an organism Upon contact of the genome with a composition or polypeptide of the disclosure, one or more strand of the double-stranded DNA may be cut. If the cut is made in the presence of one or more DNA repair pathways or components thereof, may either interrupt gene expression or provide modification of the genomic sequence by insertion, deletion, or substitution of one or more base pairs.
- compositions and methods of the disclosure provide superior and unexpectedly efficient nuclease activity at a target locus or loci in a genome.
- the disclosure provides a fusion protein comprising, consisting essentially of or consisting of a DNA localization component and an effector molecule.
- the localization component may comprise, consist essentially of or consist of, at least one guide RNA (gRNA).
- the DNA localization component may comprise, consist essentially of or consist of, two guide RNAs (gRNAs), wherein a first gRNA specifically binds to a first strand of a double-stranded DNA target sequence and a second gRNA specifically binds to a second strand of the double-stranded DNA target sequence.
- the DNA localization component may comprise, consist essentially of or consist of, at least one guide RNA (gRNA) and the effector molecule may comprise, consist essentially of or consist of a Cas9, a Cas9 nuclease domain or a fragment thereof.
- the DNA localization component may comprise, consist essentially of or consist of, at least one guide RNA (gRNA) and the effector molecule may comprise, consist essentially of or consist of an inactivated Cas9 (dCas9) or an inactivated nuclease domain.
- the DNA localization component may comprise, consist essentially of or consist of, at least one guide RNA (gRNA) and the effector molecule may comprise, consist essentially of or consist of an inactivated small Cas9 (dSaCas9).
- gRNA guide RNA
- dSaCas9 inactivated small Cas9
- the effector molecule may comprise, consist essentially of or consist of a Cas9, dCas9, dSaCas9, or nuclease domain thereof and a second endonuclease.
- the second endonuclease may comprise, consist essentially of or consist of a Type IIS endonuclease.
- the second endonuclease may comprise, consist essentially of or consist of a Type IIS endonuclease, including, but not limited to, one or more of Acil, Mnll, Alwl, Bbvl, Bed, BceAI, BsmAI, BsmFI, BspCNI, Bsrl, BtsCI, Hgal, Hphl, HpyAV, Mboll, Myll, Plel, SfaNI, Acul, BciVI, BfuAI, BmgBI, Bmrl, Bpml, BpuEI, Bsal, BseRI, Bsgl, Bsml, BspMI, BsrBI, BsrBI, BsrDI, BtgZI, Btsl, Earl, Ecil, Mmel, NmeAIII, BbvCI, BpulOI, BspQI, Sapl, Bael, BsaXI, CspCI, Bfil, Mbol
- the effector molecule may comprise, consist essentially of or consist of dCas9 or a nuclease domain thereof and a Type IIS endonuclease.
- the second endonuclease may comprise, consist essentially of or consist of a Type IIS endonuclease, including, but not limited to, one or more of Acil, Mnll, Alwl, Bbvl, Bed, BceAI, BsmAI, BsmFI, BspCNI, Bsrl, BtsCI, Hgal, HphI, HpyAV, Mboll, Myll, Plel, SfaNI, Acul, BciVI, BfuAI, BmgBI, Bmrl, Bpml, BpuEI, Bsal, BseRI, Bsgl, Bsml, BspMI, BsrBI, BsrBI, BsrDI, BtgZI, Btsl, Earl, Ec
- the effector molecule may comprise, consist essentially of or consist of dCas9 or a nuclease domain thereof and not comprise, consist essentially of or consist of Fokl.
- the effector molecule may comprise, consist essentially of or consist of a homodimer of a type IIS endonuclease, including, but not limited to, Acil, Mnll, Alwl, Bbvl, Bed, BceAI, BsmAI, BsmFI, BspCNI, Bsrl, BtsCI, Hgal, HphI, HpyAV, Mboll, Myll, Plel, SfaNI, Acul, BciVI, BfuAI, BmgBI, Bmrl, Bpml, BpuEI, Bsal, BseRI, Bsgl, Bsml, BspMI, BsrBI, BsrBI, BsrDI, BtgZI, Bts
- the effector molecule may comprise, consist essentially of or consist of a heterodimer of a type IIS endonuclease, including, but not limited to, one or more of Acil, Mnll, Alwl, Bbvl, Bed, BceAI, BsmAI, BsmFI, BspCNI, Bsrl, BtsCI, Hgal, HphI, HpyAV, Mboll, Myll, Plel, SfaNI, Acul, BciVI, BfuAI, BmgBI, Bmrl, Bpml, BpuEI, Bsal, BseRI, Bsgl, Bsml, BspMI, BsrBI, BsrBI, BsrDI, BtgZI, Btsl, Earl, Ecil, Mmel, NmeAIII, BbvCI, BpulOI, BspQI, Sapl, Bael, BsaXI, Csp
- the localization component may comprise, consist essentially of or consist of, a DNA-binding domain of a transcription activator-like effector nuclease (TALEN).
- the DNA localization component may comprise, consist essentially of or consist of, a DNA-binding domain of a TALEN (also referred to as a TAL protein) and the effector molecule may comprise an endonuclease.
- the DNA binding domain, or TAL protein may be derived from Xanthomonas.
- the DNA binding domain, or TAL protein may be derived from Ralstonia.
- localization component may comprise, consist essentially of or consist of, a DNA-binding domain of a TALEN, or TAL protein, derived from Xanthomonas and the effector molecule may comprise, consist essentially of or consist of, a Type IIS endonuclease.
- the effector molecule may comprise, consist essentially of or consist of a Type IIS endonuclease, including, but not limited to, one or more of Acil, Mnll, Alwl, Bbvl, Bed, BceAI, BsmAI, BsmFI, BspCNI, Bsrl, BtsCI, Hgal, Hphl, HpyAV, Mboll, My ll, Plel, SfaNI, Acul, BciVI, BfuAI, BmgBI, Bmrl, Bpml, BpuEI, Bsal, BseRI, Bsgl, Bsml, BspMI, BsrBI, BsrBI, BsrDI, BtgZI, Btsl, Earl, Ecil, Mmel, NmeAIII, BbvCI, Bpul OI, BspQI, Sapl, Bael, BsaXI, CspCI, Bfil, Mboll,
- the DNA localization component may comprise, consist essentially of or consist of, a DNA-binding domain of a TALEN, or TAL protein, derived from Xanthomonas and the effector molecule may not comprise, consist essentially of or consist of Fokl. In certain embodiments of the fusion proteins of the disclosure, the DNA localization component may comprise, consist essentially of or consist of, a DNA-binding domain of a TALEN, or TAL protein, derived from Xanthomonas and the effector molecule may not comprise, consist essentially of or consist of Clo051.
- the effector molecule may comprise, consist essentially of or consist of a homodimer of a type IIS endonuclease, including, but not limited to, Acil, Mnll, Alwl, Bbvl, Bed, BceAI, BsmAI, BsmFI, BspCNI, Bsrl, BtsCI, Hgal, Hphl, HpyAV, Mboll, My ll, Plel, SfaNI, Acul, BciVI, BfuAI, BmgBI, Bmrl, Bpml, BpuEI, Bsal, BseRI, Bsgl, Bsml, BspMI, BsrBI, BsrBI, BsrDI, BtgZI, Btsl, Earl, Ecil, Mmel, NmeAIII, BbvCI, Bpul OI, BspQI, Sapl, Bael, BsaXI, CspCI, B
- the effector molecule may comprise, consist essentially of or consist of a heterodimer of a type IIS endonuclease, including, but not limited to, one or more of Acil, Mnll, Alwl, Bbvl, Bed, BceAI, BsmAI, BsmFI, BspCNI, Bsrl, BtsCI, Hgal, Hphl, HpyAV, Mboll, My ll, Plel, SfaNI, Acul, BciVI, BfuAI, BmgBI, Bmrl, Bpml, BpuEI, Bsal, BseRI, Bsgl, Bsml, BspMI, BsrBI, BsrBI, BsrDI, BtgZI, Btsl, Earl, Ecil, Mmel, NmeAIII, BbvCI, Bpul OI, BspQI, Sapl, Bael, BsaXI, Cs
- localization component may comprise, consist essentially of or consist of, a DNA-binding domain of a TALEN, or TAL protein, derived from Ralstonia and the effector molecule may comprise, consist essentially of or consist of, a Type IIS endonuclease.
- the effector molecule may comprise, consist essentially of or consist of a Type IIS endonuclease, including, but not limited to, one or more of Acil, Mnll, Alwl, Bbvl, Bed, BceAI, BsmAI, BsmFI, BspCNI, Bsrl, BtsCI, Hgal, Hphl, HpyAV, Mboll, My ll, Plel, SfaNI, Acul, BciVI, BfuAI, BmgBI, Bmrl, Bpml, BpuEI, Bsal, BseRI, Bsgl, Bsml, BspMI, BsrBI, BsrBI, BsrDI, BtgZI, Btsl, Earl, Ecil, Mmel, NmeAIII, BbvCI, Bpul OI, BspQI, Sapl, Bael, BsaXI, CspCI, Bfil, Mboll,
- the DNA localization component may comprise, consist essentially of or consist of, a DNA-binding domain of a TALEN, or TAL protein, derived from Ralstonia and the effector molecule may not comprise, consist essentially of or consist of Fokl.
- the effector molecule may comprise, consist essentially of or consist of a homodimer of a type IIS endonuclease, including, but not limited to, Acil, Mnll, Alwl, Bbvl, Bed, BceAI, BsmAI, BsmFI, BspCNI, Bsrl, BtsCI, Hgal, Hphl, HpyAV, Mboll, Myll, Plel, SfaNI, Acul, BciVI, BfuAI, BmgBI, Bmrl, Bpml, BpuEI, Bsal, BseRI, Bsgl, BsmI, BspMI, BsrBI, BsrBI, BsrDI, BtgZI, Btsl, Earl, Ecil, Mmel, NmeAIII, BbvCI, BpulOI, BspQI, Sapl, Bael, BsaXI, CspCI, Bfil
- the effector molecule may comprise, consist essentially of or consist of a heterodimer of a type IIS endonuclease, including, but not limited to, one or more of Acil, Mnll, Alwl, Bbvl, Bed, BceAI, BsmAI, BsmFI, BspCNI, Bsrl, BtsCI, Hgal, Hphl, HpyAV, Mboll, Myll, Plel, SfaNI, Acul, BciVI, BfuAI, BmgBI, Bmrl, Bpml, BpuEI, Bsal, BseRI, Bsgl, BsmI, BspMI, BsrBI, BsrBI, BsrDI, BtgZI, Btsl, Earl, Ecil, Mmel, NmeAIII, BbvCI, BpulOI, BspQI, Sapl, Bael, BsaXI, Csp
- the effector molecule may comprise, consist essentially of or consist of, a heterodimer.
- the effector molecule may comprise, consist essentially of or consist of, a homodimer. In certain embodiments of the fusion proteins of the disclosure, the effector molecule may comprise, consist essentially of or consist of, a homodimer of a type IIS endonuclease.
- Effector molecules of the disclosure may comprise, consist essentially of or consist of a nuclease or endonuclease. Effector molecules of the disclosure, including heterodimers and homodimers of the disclosure, may comprise, consist essentially of or consist of a Cas9, a Cas9 nuclease domain or a fragment thereof.
- the Cas9 may be or may comprise, consist essentially of or consist of an inactivated Cas9 (dCas9) or an inactivated nuclease domain.
- the Cas9 may be or may comprise, consist essentially of or consist of an inactivated small Cas9 (dSaCas9).
- the effector molecule may comprise, consist essentially of or consist of a dCas9 or an inactivated nuclease domain thereof and a type IIS endonuclease.
- the effector molecule may comprise, consist essentially of or consist of a dCas9 or an inactivated nuclease domain thereof and a type IIS endonuclease, including, but not limited to, Acil, Mnll, Alwl, Bbvl, Bed, BceAI, BsmAI, BsmFI, BspCNI, BsrI, BtsCI, Hgal, HphI, HpyAV, Mboll, Myll, Plel, SfaNI, Acul, BciVI, BfuAI, BmgBI, Bmrl, Bpml, BpuEI, Bsal, BseRI, Bsgl, Bsml, Bsp
- the effector molecule may comprise, consist essentially of or consist of a dSaCas9 or an inactivated nuclease domain thereof and a type IIS endonuclease.
- the effector molecule may comprise, consist essentially of or consist of a dSaCas9 or an inactivated nuclease domain thereof and a type IIS endonuclease, including, but not limited to, Acil, Mnll, Alwl, Bbvl, Bed, BceAI, BsmAI, BsmFI, BspCNI, BsrI, BtsCI, Hgal, HphI, HpyAV, Mboll, My ll, Plel, SfaNI, Acul, BciVI, BfuAI, BmgBI, Bmrl, Bpml, BpuEI, Bsal, BseRI, Bsgl, Bsm
- the effector molecule may comprise, consist essentially of or consist of a heterodimer of one or more type IIS endonucl eases.
- the effector molecule may comprise, consist essentially of or consist of a heterodimer of one or more type IIS endonucleases, including, but not limited to, Acil, Mnll, Alwl, Bbvl, Bed, BceAI, BsmAI, BsmFI, BspCNI, BsrI, BtsCI, Hgal, HphI, HpyAV, Mboll, My ll, Plel, SfaNI, Acul, BciVI, BfuAI, BmgBI, Bmrl, Bpml, BpuEI, Bsal, BseRI, Bsgl, Bsml, BspMI, BsrBI, BsrBI, BsrDI, BtgZI, Bt
- the effector molecule may comprise, consist essentially of or consist of, a homodimer of type IIS endonucleases.
- the effector molecule may comprise, consist essentially of or consist of a homodimer of type IIS endonucleases, including, but not limited to, Acil, Mnll, Alwl, Bbvl, Bed, BceAI, BsmAI, BsmFI, BspCNI, BsrI, BtsCI, Hgal, HphI, HpyAV, Mboll, My ll, Plel, SfaNI, Acul, BciVI, BfuAI, BmgBI, Bmrl, Bpml, BpuEI, Bsal, BseRI, Bsgl, Bsml, BspMI, BsrBI, BsrBI, BsrDI, BtgZI, Bts
- Effector molecules of the disclosure may comprise, consist essentially of or consist of a DNA cleavage domain of a TALEN.
- the TALEN may be derived from Xanthomonas or Ralstonia.
- the effector molecule may comprise, consist essentially of or consist of a DNA cleavage domain of a TALEN, wherein the TALEN is derived from Xanthomonus, and a type IIS endonuclease.
- the effector molecule may comprise, consist essentially of or consist of a DNA cleavage domain of a TALEN, wherein the TALEN is derived from Xanthomonus, and a type IIS endonuclease, including, but not limited to, Acil, Mnll, Alwl, Bbvl, Bed, BceAI, BsmAI, BsmFI, BspCNI, Bsrl, BtsCI, Hgal, Hphl, HpyAV, MboII, My II, Plel, SfaNI, Acul, BciVI, BfuAI, BmgBI, Bmrl, Bpml, BpuEI, Bsal, BseRI, Bsgl, Bsml, BspMI, BsrBI, BsrBI, BsrDI, BtgZI, Btsl, Earl, Ecil, Mmel, NmeAIII, BbvCI,
- the effector molecule may comprise, consist essentially of or consist of a DNA cleavage domain of a TALEN, wherein the TALEN is derived from Xanthomonus, and not may not comprise, consist essentially of or consist of Fokl. In certain embodiments of the disclosure, the effector molecule may comprise, consist essentially of or consist of a DNA cleavage domain of a TALEN, wherein the TALEN is derived from Xanthomonus, and not may not comprise, consist essentially of or consist of Clo051.
- the effector molecule may comprise, consist essentially of or consist of a DNA cleavage domain of a TALEN, wherein the TALEN is derived from Ralstonia, and a type IIS endonuclease.
- the effector molecule may comprise, consist essentially of or consist of a DNA cleavage domain of a TALEN, wherein the TALEN is derived from Ralstonia, and a type IIS endonuclease, including but not limited to, Acil, Mnll, Alwl, Bbvl, Bed, BceAI, BsmAI, BsmFI, BspCNI, Bsrl, BtsCI, Hgal, Hphl, HpyAV, MboII, My II, Plel, SfaNI, Acul, BciVI, BfuAI, BmgBI, Bmrl, Bpml, BpuEI, Bsal, BseRI, Bsgl, Bsml, BspMI, BsrBI, BsrBI, BsrDI, BtgZI, Btsl, Earl, Ecil, Mmel, NmeAIII, BbvCI, Bpul O
- Effector molecules of the disclosure may comprise, consist essentially of or consist of Acil, Mnll, Alwl, Bbvl, Bed, BceAI, BsmAI, BsmFI, BspCNI, Bsrl, BtsCI, Hgal, Hphl, HpyAV, Mboll, My II, Plel, SfaNI, Acul, BciVI, BfuAI, BmgBI, Bmrl, Bpml, BpuEI, Bsal, BseRI, Bsgl, Bsml, BspMI, BsrBI, BsrBI, BsrDI, BtgZI, Btsl, Earl, Ecil, Mmel, NmeAIII, BbvCI, Bpul OI, BspQI, Sapl, Bael, BsaXI, CspCI, Bfil, Mboll, Acc36I or Clo05
- the disclosure provides a nucleic acid encoding a fusion protein of the disclosure.
- the disclosure provides a vector comprising, consisting essentially of or consisting of, a nucleic acid of the disclosure.
- the disclosure provides a vector comprising, consisting essentially of or consisting of, a nucleic acid encoding a fusion protein of the disclosure.
- the disclosure provides a cell comprising a fusion protein, a nucleic acid, a vector or a composition of the disclosure.
- the cell may be in vivo, ex vivo or in vitro.
- the cell may be a unicellular or single-celled organism, including, for example, bacteria, archaea, protozoa, unicellular algae and/or unicellular fungi.
- compositions of the disclosure may further comprise, consist essentially of or consist of pharmaceutically-acceptable carrier.
- the disclosure provides a multicellular organism comprising, consisting essentially of or consisting of, a fusion protein, a nucleic acid, a vector, a cell, or a composition of the disclosure.
- the multicellular organism may be a plant.
- the multicellular organism may be an animal. In certain embodiments, the animal is not a human or a human embryo or is not derived from either a human or a human embryo.
- the disclosure provides a method for directing proteins to specific loci in a genome of an organism comprising providing to a genomic DNA sequence a fusion protein, a nucleic acid, a vector, a cell or a composition of the disclosure.
- the fusion protein, the nucleic acid, the vector, the cell or the composition contacts the genomic DNA sequence in vivo, ex vivo, or in vitro.
- the genomic DNA sequence is not a human genomic DNA sequence.
- composition comprising, consisting essentially of or consisting of, a DNA localization component and an effector molecule, wherein the DNA localization component and the effector molecule are capable of operatively linking via a non-covalent linkage.
- DNA localization components of the disclosure may comprise, consist essentially of or consist of, at least one guide RNA (gRNA).
- DNA localization components may comprise, consist essentially of or consist of, two (2) guide RNAs (gRNAs), wherein a first gRNA specifically binds to a first strand of a double-stranded DNA target sequence and a second gRNA specifically binds to a second strand of the double-stranded DNA target sequence.
- DNA localization components of the disclosure may comprise a DNA binding domain of a transcription activator-like effector nuclease (TALEN).
- TALEN transcription activator-like effector nuclease
- Exemplary DNA binding domains of TALEN of the disclosure may be derived from Xanthomonas or Ralstonia.
- Effector molecules of the disclosure may comprise, consist essentially of or consist of, a homodimer or a heterodimer. Effector molecules, including those effector molecules comprising a homodimer or a heterodimer, may comprise, consist essentially of or consist of, a nuclease. In preferred embodiments, the nuclease is an endonuclease. Effector molecules, including those effector molecules comprising a homodimer or a heterodimer, may comprise, consist essentially of or consist of, a Cas9, a Cas9 nuclease domain or a fragment thereof.
- the Cas9 is a catalytically inactive or "inactivated” Cas9 (dCas9).
- the Cas9 is a catalytically inactive or "inactivated” nuclease domain of Cas9.
- the dCas9 is encoded by a shorter sequence that is derived from a full length, catalytically inactivated, Cas9, referred to herein as a "small” dCas9 or dSaCas9.
- Effector molecules including those effector molecules comprising a homodimer or a heterodimer, may comprise, consist essentially of or consist of Clo051, Bfil or Bmrl. In preferred embodiments, effector molecules, including those effector molecules comprising a homodimer or a heterodimer, may comprise, consist essentially of or consist of Clo051.
- Effector molecules including those effector molecules comprising a heterodimer, may comprise, consist essentially of or consist of a Cas9, a Cas9 nuclease domain or a fragment thereof that forms a heterodimer with Clo051, Bfil or Bmrl.
- effector molecules may comprise, consist essentially of or consist of a Cas9, a Cas9 nuclease domain or a fragment thereof that forms a heterodimer with Clo051.
- Effector molecules, including those effector molecules comprising a heterodimer may comprise, consist essentially of or consist of a dCas9 or inactivated nuclease domain thereof that forms a heterodimer with Clo051, Bfil or Bmrl.
- effector molecules including those effector molecules comprising a heterodimer, may comprise, consist essentially of or consist of a dCas9 or inactivated nuclease domain thereof that forms a heterodimer with Clo051.
- Effector molecules including those effector molecules comprising a heterodimer, may comprise, consist essentially of or consist of a dSaCas9 that forms a heterodimer with Clo051, Bfil or Bmrl.
- effector molecules, including those effector molecules comprising a heterodimer may comprise, consist essentially of or consist of a dSaCas9 that forms a heterodimer with Clo051.
- Effector molecules may comprise, consist essentially of or consist of a catalytically -inactive form of Cas9 (e.g. dCas9 or dSaCas9) or a fragment thereof and a homodimer comprising, consisting essentially of or consisting of Clo051, Bfil or Bmrl.
- effector molecules including those effector molecules comprising a homodimer, may comprise, consist essentially of or consist of a catalytically-inactive form of Cas9 (e.g. dCas9 or dSaCas9) or a fragment thereof and a homodimer comprising, consisting essentially of or consisting of Clo051.
- Effector molecules including those effector molecules comprising a homodimer or a heterodimer, may comprise, consist essentially of or consist of a DNA cleavage domain of a TALEN.
- Exemplary DNA cleavage domains of TALENs of the disclosure may be derived from Xanthomonas or Ralstonia.
- Effector molecules may comprise, consist essentially of or consist of a DNA cleavage domain of a Xanthomonas TALEN that forms a heterodimer with Clo051, Bfil or Bmrl.
- effector molecules, including those effector molecules comprising a heterodimer may comprise, consist essentially of or consist of a DNA cleavage domain of a Xanthomonas TALEN that forms a heterodimer with Clo051.
- Effector molecules may comprise, consist essentially of or consist of a DNA cleavage domain of a Xanthomonas TALEN and a homodimer comprising, consisting essentially of or consisting of Clo051, Bfil or Bmrl.
- effector molecules, including those effector molecules comprising a homodimer may comprise, consist essentially of or consist of a DNA cleavage domain of a Xanthomonas TALEN and a homodimer comprising, consisting essentially of or consisting of Clo051.
- Effector molecules may comprise, consist essentially of or consist of a DNA cleavage domain of a Ralstonia TALEN that forms a heterodimer with Clo051 , Bfil or Bmrl.
- effector molecules, including those effector molecules comprising a heterodimer may comprise, consist essentially of or consist of a DNA cleavage domain of a Ralstonia TALEN that forms a heterodimer with Clo051.
- Effector molecules may comprise, consist essentially of or consist of a DNA cleavage domain of a Ralstonia TALEN and a homodimer comprising, consisting essentially of or consisting of Clo051 , Bfil or Bmrl.
- effector molecules, including those effector molecules comprising a homodimer may comprise, consist essentially of or consist of a DNA cleavage domain of a Ralstonia TALEN and a homodimer comprising, consisting essentially of or consisting of Clo051.
- Non-covalent linkages of the disclosure may comprise, consist essentially of or consist of an antibody fragment covalently attached to the effector molecule and which non- covalently binds directly to the DNA localization component.
- Non-covalent linkages of the disclosure may comprise, consist essentially of or consist of an antibody fragment covalently attached to the DNA localization component and which non-covalently binds directly to the effector component.
- Non-covalent linkages of the disclosure may comprise, consist essentially of or consist of an antibody fragment covalently attached to either the effector molecule or the DNA localization component and which non-covalently binds to an epitope tag covalently attached to the opposite component.
- Antibody fragments of the disclosure may comprise or consist of a single-chain variable fragment (scFv), a single domain antibody (sdAB), a small modular immunopharmaceutical (SMIP) molecule, or a nanobody.
- Non-covalent linkages of the disclosure may comprise, consist essentially of or consist of a protein binding domain covalently attached to either the effector molecule or the DNA localization component and which non-covalently binds to the opposite component.
- Non-covalent linkages of the disclosure may comprise, consist essentially of or consist of a protein covalently attached to either the effector molecule or the DNA localization component capable of binding to a protein covalently attached to the opposite component.
- Non-covalent linkages of the disclosure may comprise, consist essentially of or consist of a small molecule covalently attached either to the effector molecule or the DNA localization component and which non-covalently binds to a protein or other small molecule covalently attached to the opposite component.
- Non-covalent linkages of the disclosure may comprise, consist essentially of or consist of an antibody mimetic.
- Exemplary antibody mimetics of the disclosure comprise or consist of an organic compound that specifically binds a target sequence and has a structure distinct from a naturally-occurring antibody.
- Antibody mimetics may comprise or consist of a protein, a nucleic acid, or a small molecule.
- Antibody mimetics may comprise or consist of an affibody, an afflilin, an affimer, an affitin, an alphabody, an anticalin, and avimer, a DARPin, a Fynomer, a Kunitz domain peptide, or a monobody.
- the disclosure provides a vector comprising a nucleic acid sequence that encodes for a DNA localization component, an effector molecule, and/or noncovalent-linkage of the disclosure.
- the disclosure provides a polypeptide encoded by a vector of the disclosure.
- the disclosure provides a composition comprising a polypeptide encoded by a vector of the disclosure.
- the disclosure provides a polypeptide comprising a DNA localization component and an effector molecule, wherein the DNA localization component and the effector molecule are capable of operatively linking via a non-covalent linkage.
- the disclosure provides a composition comprising a DNA localization component and an effector molecule, wherein the DNA localization component and the effector molecule are capable of operatively linking via a non-covalent linkage.
- compositions of the disclosure may comprise a pharmaceutically-acceptable carrier.
- the disclosure provides a cell comprising a nucleic acid, a vector, a polypeptide, or a composition of the disclosure.
- the cell may be in situ, in vivo, ex vivo, or in vitro.
- Cells comprising a vector of the disclosure include single-celled organisms, including bacteria and archaea.
- the disclosure provides a multicellular organism comprising a cell comprising a vector, polypeptide or composition of the disclosure.
- Exemplary multicellular organisms include, but are not limited to, a plant or an animal.
- an animal comprising a cell comprising a vector, polypeptide or composition of the disclosure is not a human.
- an animal comprising a cell comprising a vector, polypeptide or composition of the disclosure is not a human embryo.
- the disclosure provides a method for directing proteins to specific loci in a genome of an organism comprising providing a composition, a nucleic acid, a vector, or a polypeptide of the disclosure to the genome.
- composition, the nucleic acid, the vector, or the polypeptide are contact a genomic DNA sequence in vivo, ex vivo, or in vitro.
- the genome is not a human genome.
- the disclosure provides a method for modifying a genome of an organism comprising providing to a genomic DNA sequence or base pair a fusion protein, a nucleic acid, a vector, a cell or a composition according to the disclosure.
- the step of providing comprises bringing into contact a genomic sequence or base pair and at least one of the fusion protein, the nucleic acid, the vector, the cell or the composition.
- contact between a genomic sequence or base pair and at least one of the fusion protein, the nucleic acid, the vector, the cell or the composition may be achieved through fluid communication.
- the modification of the genomic sequence or base pair may comprise a separation of a sequence and/or base pairs by an activity of an endonuclease.
- the modification of the genomic sequence or base pair may comprise, consist essentially of or consist of a deletion, an insertion, a substitution, an inversion, and/or a relocation of a sequence or base pair.
- a DNA repair mechanism induces the deletion, insertion, substitution, inversion, and/or relocation.
- the DNA repair mechanism when the DNA repair mechanism includes the Non-Homologous End Joining (NHEJ) DNA repair pathway, the NHEJ pathway may induce an insertions or deletions (InDels) at the target site, resulting in frameshifts and/or premature stop codons.
- NHEJ Non-Homologous End Joining
- the NHEJ pathway may disrupt the open reading frame (ORF) of a target gene or genomic sequence. Disruption of the ORF of the target gene or genomic sequence may silence expression of the target gene or genomic sequence.
- HDR Homology Directed Repair
- a repair template may be used to reconnect a single or double strand break in the genomic sequence.
- Repair templates of the disclosure may be used to insert desired sequences into the genome at the site of endonuclease activity.
- Exemplary repair templates of the disclosure may comprise an exogenous, artificial, and/or heterologous sequence.
- inserted sequences of the disclosure may comprise an exogenous, artificial, and/or heterologous sequence.
- the genomic sequence comprising the insertion is non-naturally occurring.
- the resultant genomic sequence is non-naturally occurring.
- the disclosure provides a genomic sequence modified according to a method of the disclosure.
- the disclosure provides a cell comprising the genomic sequence of claim 47.
- the disclosure provides a cell comprising a modification resulting from a method of the disclosure.
- Modification of the cell or a genomic sequence thereof may be performed in vivo, ex vivo or in vitro.
- a cell may be modified ex vivo or in vitro and administered to a subject.
- the modified cell or modified genomic sequence of the disclosure is neither a human cell nor a human genomic sequence.
- the modified cell or modified genomic sequence of the disclosure is neither a human embryonic cell nor a human embryonic genomic sequence.
- Figure 1 is an alignment depicting a consensus sequence of a DNA-binding protein from Xanthamonas aligned via BLAST to methyltransferase sequences from bacterial strains. Based upon sequence alignment, the DNA binding function of the sequences are
- Figure 2 is a photograph of a gel electrophoresis demonstrating RTN functionality.
- Figure 3 is a construct map depicting an exemplary Xanthomonas-TALE-Clo051 (XTC) Empty Backbone of the disclosure.
- Figure 4 is a construct map depicting an exemplary XTC cloned DNA binding domain of the disclosure. Customized TALE arrays can be cloned into the XTC backbone to target 16-20 bp specific DNA sequences.
- Figure 5 is a schematic depicting of the use of a dual-reporter plasmid for validating efficiency of specific binding and endonuclease activity for polypeptide constructs of the disclosure.
- Figure 6 is a series of photographs depicting the endonuclease activity of an AAVS1 (adeno-associated virus integration site 1) vector indicator 22 hours post-transfection.
- AAVS1 adeno-associated virus integration site 1
- AAVS1 is an exemplary dual-reporter plasmid of the disclosure that is also depicted in Figure 5. Endonuclease activity of Clo051 and Fokl are shown relative to an endonuclease- firee control.
- FIG. 7 is a photograph of a gel depicting the results of a Cell Assay with TALE- Clo051. Cutting efficiency of TALE-Clo051 (average cutting efficiency of replicates of 8.1%) was compared to the cutting efficiency of TALE-Fokl. Average cutting efficiency of replicates of TALE-Clo051 was 8.1% compared to the average cutting efficiency of replicates of TALE-Fokl, which was 7.1%. Thus, TALE-Clo051 has a superior cutting efficiency to TALE-Fokl.
- Figure 8 is a photograph of a gel depicting a Cell assay comparing the relative nuclease activity of the Xanthomonas-TALE-Nuclease (XTN) TALEN of the disclosure to TALEN not encompassed by this disclosure.
- XTN TALENS of the disclosure have significantly higher activity than TALENs not encompassed by this disclosure.
- Figure 9 is a schematic depiction of the Csy4-T2A-Clo05 l-G4Slinker-dCas9 construct map.
- FIG. 10 is a series of photographs depicting Clo051-Cas9 activity.
- Condition (1) shows the pCagsClo051C4RGN plasmid (that encodes for Clo051-dCas9) transfected with a non-specific guide RNA (gRNA) and an indicator, the combination of which serve as a negative control for this experiment.
- Condition (2) shows the pCagsClo051C4RGN plasmid (that encodes for CLo051-dCas9) transfected with NG-AAVSl-gRNA and an indicator.
- Condition (3) shows the pCagsC4RGN plasmid (that encodes for FokI-dCas9) transfected with NG-AAVSl-gRNA and an indicator, the combination of which serve as a positive control in this experiment.
- Figure 11 is a photograph of an alignment of clones of Clo051-XTN.
- the AAV1 locus was amplified from Clo051-XTN treated samples, TOPO cloned, and 48 clones from each sample were sequenced. Sequencing results indicated that 43 Clo051-XTN clones contained usable sequence.
- Four of the 43 Clo051-XTN clones had an indel (an insertion or deletion of bases in the sequence) for a 9.3% rate of indel.
- FIG. 12 is a photograph of an alignment of clones of Fokl-XTN.
- the AAV1 locus was amplified from Fokl-XTN treated samples, TOPO cloned, and 48 clones from each sample were sequenced. Sequencing results indicated that 46 Fokl-XTN clones contained usable sequence.
- Fokl-XTN clones had an indel (an insertion or deletion of bases in the sequence) for a 6.5% rate of indel.
- one clone (#24) has a single base pair (lbp) deletion
- one clone (#21) have a five base pair (5bp) insertion
- one clone (#35) has a -47/+4 indel. From top to bottom, SEQ ID Nos 294 to 299 are shown.
- Figure 13 is a series of photographs depicting the results of transfection and nuclease activity in HEK293 cells treated with either TAL-Bfil (XTN-Bfil) or TAL-Bmrl (XTN-Bmrl), when compared to treatment with XTN-Fokl used herein as a positive control. Indicator only condition used as a negative control. Pictures were captured three days after transfection of the cells with AAVSl XTN (one or XTN-Bfil, XTN-Bmrl or XTN-Fokl) with an indicator.
- TAL-Bfil TAL-Bfil
- XTN-Bmrl TAL-Bmrl
- compositions and methods for directing proteins to specific loci in the genome and uses thereof allow for directing proteins to specific loci in the genome of an organism, including the steps of providing a fusion protein comprising a DNA localization component and an effector molecule.
- the disclosed methods allow for directing proteins to specific loci in the genome of an organism, including the steps of providing a DNA localization component and an effector molecule, wherein the DNA localization component and the effector molecule are capable of being operatively linked via a non-covalent linkage.
- the DNA localization component is capable of binding a specific DNA sequence.
- DNA localization components of the disclosure may be capable of binding a specific DNA sequence.
- the DNA localization component may be selected from, for example, a DNA-binding oligonucleotide, a DNA-binding protein, a DNA binding protein complex, and combinations thereof. Other suitable DNA binding components will be recognized by one of ordinary skill in the art.
- DNA localization components may comprise an oligonucleotide directed to a specific locus or loci in the genome.
- the oligonucleotide may be selected from DNA, RNA, DNA/RNA hybrids, and combinations thereof.
- DNA localization components may comprise a nucleotide binding protein or protein complex that binds an oligonucleotide when bound to a target DNA.
- the protein or protein complex may be capable of recognizing a feature selected from RNA-DNA heteroduplexes, R-loops, or combinations thereof.
- the DNA localization component may comprise a protein or protein complex capable of recognizing an R-loop selected from Cas9, Cascade complex, RecA, RNase H, RNA polymerase, DNA polymerase, or a combination thereof.
- DNA localization components may comprise an engineered protein capable of binding to target DNA.
- the DNA localization component may comprise a protein capable of binding a DNA sequence selected from meganuclease, zinc finger array, transcription activator-like (TAL) array, and combinations thereof.
- DNA localization components may comprise a protein that contains a naturally occurring DNA binding domain.
- the DNA localization component may comprise, for example, a protein comprising a naturally occurring DNA binding domain is selected from a bZIP domain, a Helix-loop-helix, a Helix-turn-helix, a HMG-box, a Leucine zipper, a Zinc finger, or a combination thereof.
- Exemplary DNA localization components of the disclosure include, but are not limited to, a DNA-binding oligonucleotide, a DNA-binding protein, a DNA binding protein complex, and any combination thereof.
- DNA localization components of the disclosure may comprise an oligonucleotide directed to a specific locus in the genome.
- oligonucleotides include, but are not limited to, DNA, RNA, DNA/RNA hybrids, and any combination thereof.
- DNA localization components of the disclosure may comprise a protein or a protein complex capable of recognizing a feature selected from RNA-DNA heteroduplexes, R-loops, and any combination thereof.
- Exemplary proteins or protein complexes capable of recognizing an R-loop include, but are not limited to, Cas9, Cascade complex, RecA, RNase H, RNA polymerase, DNA polymerase, and any combination thereof.
- the protein or protein complex capable of recognizing an R-loop comprises Cas9.
- DNA localization components of the disclosure may comprise a protein capable of binding a DNA sequence selected from meganuclease, Zinc Finger array, TAL array, and any combination thereof.
- DNA localization components of the disclosure may comprise a protein comprising a naturally occurring DNA binding domain.
- exemplary naturally occurring DNA binding domains include, but are not limited to, a bZIP domain, a Helix-loop-helix, a Helix-turn- helix, a HMG-box, a Leucine zipper, a Zinc finger, and any combination thereof.
- DNA localization components of the disclosure may comprise an oligonucleotide directed to a target location in a genome and a protein capable of binding to a target DNA sequence.
- Methods of the disclosure comprise providing an effector molecule.
- Exemplary effector molecules of the disclosure are capable of a predetermined effect at a specific locus in the genome.
- Exemplary effector molecules of the disclosure include, but are not limited to, a transcription factor (activator or repressor), chromatin remodeling factor, nuclease, exonuclease, endonuclease, transposase, methytransferase, demethylase, acetyltransferase, deacetylase, kinase, phosphatase, integrase, recombinase, ligase, topoisomerase, gyrase, helicase, fluorophore, or any combination thereof.
- a transcription factor activator or repressor
- chromatin remodeling factor nuclease, exonuclease, endonuclease, transposase, methytransferase, demethylase, acetyltransferase, deacetylase, kinase, phosphatase, integrase, recombin
- Exemplary effector molecules of the disclosure may comprise a transposase.
- the effector molecule may comprise a PB transposase (PBase).
- Exemplary effector molecules of the disclosure comprise a nuclease.
- nucleases include restriction endonucleases, homing endonucleases, S I
- the effector molecule comprises a restriction endonuclease. In certain embodiments, the effector molecule comprises a Type IIS restriction endonuclease.
- Exemplary effector molecules of the disclosure may comprise an endonuclease.
- the endonuclease include Acil, Mnll, Alwl, Bbvl, Bed, BceAI, BsmAI, BsmFI, BspCNI, BsrI, BtsCI, Hgal, HphI, HpyAV, Mboll, My II, Plel, SfaNI, Acul, BciVI, BfuAI, BmgBI, Bmrl, Bpml, BpuEI, Bsal, BseRI, Bsgl, BsmI, BspMI, BsrBI, BsrBI, BsrDI, BtgZI, Btsl, Earl, Ecil, Mmel, NmeAIII, BbvCI, BpulOI, BspQI, Sapl, Bael, BsaXI, CspCI, Bfil, Mboll, Acc36I and
- the disclosure provides a fusion protein comprising, consisting essentially of or consisting of a DNA localization component and an effector molecule.
- polypeptides of the disclosure are fusion proteins, the nucleic acid sequences encoding one or more components of the fusion protein may be operably linked, for example, in an expression vector.
- Fusion proteins of the disclosure may be chimeric proteins. Fusion proteins of the disclosure may also include proteins encoded by one or more recombinant nucleic acid sequences. Fusion proteins may also include a linker region to operatively-link two components of the fusion protein.
- the disclosure provides a fusion protein comprising, consisting essentially of or consisting of a DNA localization component and an effector molecule, operatively -linked by a linker region.
- the DNA localization component, the linker region, and the effector molecule may be encoded by one or more nucleic acid sequences inserted into an expression cassette and/or expression vector such that translation of the nucleic acid sequence results in the fusion protein.
- Polypeptides and compositions of the disclosure may comprise a non-covalent linkage between the DNA localization component and the effector molecule.
- the non- covalent linkage may comprise an antibody, an antibody fragment, an antibody mimetic, or a scaffold protein.
- Exemplary non-covalent linkages of the disclosure may comprise an antibody fragment covalently attached to an effector molecule, which non-covalently binds directly to a DNA localization component.
- Exemplary non-covalent linkages of the disclosure may comprise an antibody fragment covalently attached to a DNA localization component, non-covalently binds directly to an effector component.
- Exemplary non-covalent linkages of the disclosure may comprise an antibody fragment covalently attached to either an effector molecule or a DNA localization component, which non-covalently binds to an epitope tag covalently attached to the opposite component.
- antibody fragments may comprise or consist of a single-chain variable fragment (scFv), a single domain antibody (sdAB), a small modular immunopharmaceutical (SMIP) molecule, or a nanobody.
- Exemplary non-covalent linkages of the disclosure may comprise a protein binding domain covalently attached to either an effector molecule or a DNA localization component, which non-covalently binds to the opposite component
- Exemplary non-covalent linkages of the disclosure may comprise a protein covalently attached to either an effector molecule or a DNA localization component capable of binding to a protein covalently attached to the opposite component.
- Non-covalent linkages of the disclosure may comprise or consist of an antibody mimetic.
- Exemplary antibody mimetics include, but are not limited to, an organic compound that specifically binds a target sequence and has a structure distinct from a naturally- occurring antibody.
- Exemplary antibody mimetics include, but are not limited to, a protein, a nucleic acid, or a small molecule.
- the antibody mimetic comprises or consists of an affibody, an afflilin, an affimer, an affitin, an alphabody, an anticalin, and avimer, a DARPin, a Fynomer, a Kunitz domain peptide, or a monobody.
- Exemplary non-covalent linkages of the disclosure may comprise a small molecule covalently attached either to an effector molecule or a DNA localization component, which non-covalently binds to a protein or other small molecule covalently attached to the opposite component.
- Antibodies and fragments thereof include, but are not limited to, single-chain variable fragment (scFv), single domain antibodies (sdAB), monobodies, and nanobodies.
- the non-covalent linkage may comprise, a single-chain variable fragment (scFv) or a single domain antibody (sdAB) covalently attached to one or more effector molecules, and which is capable of a non-covalent association to the DNA localization component.
- the non-covalent linkage may comprise a single-chain variable fragment (scFv) covalently attached to the DNA localization component and which non-covalently binds directly to the effector component.
- the non-covalent linkage may comprise a single-chain variable fragment (scFv) covalently attached to either the effector molecule or the DNA localization component.
- the scFV may then non-covalently bind to an epitope tag covalently attached to the opposite component (i.e., to the DNA localization component or the effector molecule).
- the non-covalent linkage may comprise, for example, an antibody mimetic.
- antibody mimetic is intended to describe an organic compound that specifically binds a target sequence and has a structure distinct from a naturally-occurring antibody.
- Antibody mimetics may comprise a protein, a nucleic acid, or a small molecule.
- the target sequence to which an antibody mimetic of the disclosure specifically binds may be an antigen.
- Antibody mimetics may provide superior properties over antibodies including, but not limited to, superior solubility, tissue penetration, stability towards heat and enzymes (e.g. resistance to enzymatic degradation), and lower production costs.
- Exemplary antibody mimetics include, but are not limited to, an affibody, an afflilin, an affimer, an affitin, an alphabody, an anticalin, and avimer (also known as avidity multimer), a DARPin (Designed Ankyrin Repeat Protein), a Fynomer, a Kunitz domain peptide, and a monobody.
- Affibody molecules of the disclosure comprise a protein scaffold comprising or consisting of one or more alpha helix without any disulfide bridges.
- affibody molecules of the disclosure comprise or consist of three alpha helices.
- an affibody molecule of the disclosure may comprise an immunoglobulin binding domain.
- An affibody molecule of the disclosure may comprise the Z domain of protein A.
- Affilin molecules of the disclosure comprise a protein scaffold produced by modification of exposed amino acids of, for example, either gamma-B crystallin or ubiquitin. Affilin molecules functionally mimic an antibody's affinity to antigen, but do not structurally mimic an antibody. In any protein scaffold used to make an affilin, those amino acids that are accessible to solvent or possible binding partners in a properly -folded protein molecule are considered exposed amino acids. Any one or more of these exposed amino acids may be modified to specifically bind to a target sequence or antigen.
- Affimer molecules of the disclosure comprise a protein scaffold comprising a highly stable protein engineered to display peptide loops that provide a high affinity binding site for a specific target sequence.
- Exemplary affimer molecules of the disclosure comprise a protein scaffold based upon a cystatin protein or tertiary structure thereof.
- Exemplary affimer molecules of the disclosure may share a common tertiary structure of comprising an alpha- helix lying on top of an anti-parallel beta-sheet.
- Affitin molecules of the disclosure comprise an artificial protein scaffold, the structure of which may be derived, for example, from a DNA binding protein (e.g. the DNA binding protein Sac7d).
- Affitins of the disclosure selectively bind a target sequence, which may be the entirety or part of an antigen.
- exemplary affitins of the disclosure are
- Target sequences of affitins of the disclosure may be found, for example, in the genome or on the surface of a peptide, protein, virus, or bacteria.
- an affitin molecule may be used as a specific inhibitor of an enzyme.
- Affitin molecules of the disclosure may include heat-resistant proteins or derivatives thereof.
- Alphabody molecules of the disclosure may also be referred to as Cell-Penetrating Alphabodies (CPAB).
- CPAB Cell-Penetrating Alphabodies
- Alphabody molecules of the disclosure comprise small proteins (typically of less than 10 kDa) that bind to a variety of target sequences (including antigens). Alphabody molecules are capable of reaching and binding to intracellular target sequences.
- alphabody molecules of the disclosure comprise an artificial sequence forming single chain alpha helix (similar to naturally occurring coiled-coil structures).
- Alphabody molecules of the disclosure may comprise a protein scaffold comprising one or more amino acids that are modified to specifically bind target proteins. Regardless of the binding specificity of the molecule, alphabody molecules of the disclosure maintain correct folding and thermostability.
- Anticalin molecules of the disclosure comprise artificial proteins that bind to target sequences or sites in either proteins or small molecules.
- Anticalin molecules of the disclosure may comprise an artificial protein derived from a human lipocalin.
- Anticalin molecules of the disclosure may be used in place of, for example, monoclonal antibodies or fragments thereof.
- Anticalin molecules may demonstrate superior tissue penetration and thermostability than monoclonal antibodies or fragments thereof.
- Exemplary anticalin molecules of the disclosure may comprise about 180 amino acids, having a mass of approximately 20 kDa.
- anticalin molecules of the disclosure comprise a barrel structure comprising antiparallel beta-strands pairwise connected by loops and an attached alpha helix.
- anticalin molecules of the disclosure comprise a barrel structure comprising eight antiparallel beta-strands pairwise connected by loops and an attached alpha helix.
- Avimer molecules of the disclosure comprise an artificial protein that specifically binds to a target sequence (which may also be an antigen). Avimers of the disclosure may recognize multiple binding sites within the same target or within distinct targets. When an avimer of the disclosure recognize more than one target, the avimer mimics function of a bi- specific antibody.
- the artificial protein avimer may comprise two or more peptide sequences of approximately 30-35 amino acids each. These peptides may be connected via one or more linker peptides. Amino acid sequences of one or more of the peptides of the avimer may be derived from an A domain of a membrane receptor.
- Avimers have a rigid structure that may optionally comprise disulfide bonds and/or calcium. Avimers of the disclosure may demonstrate greater heat stability compared to an antibody.
- DARPins Designed Ankyrin Repeat Proteins
- DARPins of the disclosure comprise genetically-engineered, recombinant, or chimeric proteins having high specificity and high affinity for a target sequence.
- DARPins of the disclosure are derived from ankyrin proteins and, optionally, comprise at least three repeat motifs (also referred to as repetitive structural units) of the ankyrin protein.
- Ankyrin proteins mediate high-affinity protein-protein interactions.
- DARPins of the disclosure comprise a large target interaction surface.
- Fynomers of the disclosure comprise small binding proteins (about 7 kDa) derived from the human Fyn SH3 domain and engineered to bind to target sequences and molecules with equal affinity and equal specificity as an antibody.
- Kunitz domain peptides of the disclosure comprise a protein scaffold comprising a Kunitz domain.
- Kunitz domains comprise an active site for inhibiting protease activity.
- Structurally, Kunitz domains of the disclosure comprise a disulfide-rich alpha+beta fold. This structure is exemplified by the bovine pancreatic trypsin inhibitor.
- Kunitz domain peptides recognize specific protein structures and serve as competitive protease inhibitors.
- Kunitz domains of the disclosure may comprise Ecallantide (derived from a human lipoprotein- associated coagulation inhibitor (LACI)).
- LACI human lipoprotein- associated coagulation inhibitor
- Monobodies of the disclosure are small proteins (comprising about 94 amino acids and having a mass of about 10 kDa) comparable in size to a single chain antibody. These genetically engineered proteins specifically bind target sequences including antigens.
- Monobodies of the disclosure may specifically target one or more distinct proteins or target sequences.
- monobodies of the disclosure comprise a protein scaffold mimicking the structure of human fibronectin, and more preferably, mimicking the structure of the tenth extracellular type III domain of fibronectin.
- the tenth extracellular type III domain of fibronectin, as well as a monobody mimetic thereof, contains seven beta sheets forming a barrel and three exposed loops on each side corresponding to the three
- CDRs complementarity determining regions
- a monobody In contrast to the structure of the variable domain of an antibody, a monobody lacks any binding site for metal ions as well as a central disulfide bond. Multispecific monobodies may be optimized by modifying the loops BC and FG.
- Monobodies of the disclosure may comprise an adnectin.
- the non-covalent linkage may comprise, for example, a scaffold protein.
- Scaffold proteins of the disclosure include, for example, antibody mimetics of the disclosure. Scaffold proteins of the disclosure further include, for example, small modular immunopharmaceutical (SMIP) molecules, a domain antibody, and a nanobody.
- SMIP small modular immunopharmaceutical
- SMIP molecules of the disclosure are artificial proteins comprising one or more sequences or portions of an immunoglobulin (antibody) that are monospecific for a target sequence or antigen.
- SMIPs of the disclosure may substitute for the use of a monoclonal antibody.
- SMIPs are single chain proteins comprising a binding region, a hinge region (i.e. a connector), and an effector domain.
- the binding region of a SMIP may comprise a modified single-chain variable fragment (scFv).
- SMIPs may be produced from genetically-modified cells as dimers.
- Domain antibodies of the disclosure comprise a single monomelic variable antibody domain (i.e. either heavy or light variable domain). Domain antibodies of the disclosure demonstrate the same antigen specificity as a whole and intact antibody. Domain antibodies of the disclosure may be manufactured, at least in part, by immunization of dromedaries, camels, llamas, alpacas or sharks with the desired antigen and subsequent isolation of the mRNA coding for heavy-chain antibodies.
- Nanobodies of the disclosure comprise a VHH single domain antibody. Nanobodies of the disclosure may comprise single domain antibodies of the disclosure.
- Non-covalent linkages may comprise a protein binding domain covalently attached to either the effector molecule or the DNA localization component and which is capable of a non-covalent interaction with the opposite component.
- protein binding domains include, for example, SH2, SH3, PTB, LIM, SAM, PDZ, FERM, CH, Pleckstin, WW, WSxWS, and the E3 ligase domain.
- Non-covalent linkages may comprise a protein covalently attached to either the effector molecule or the DNA localization component that is capable of binding to a protein covalently attached to the opposite component.
- Non-limiting examples include any two proteins that interact non-covalently. Such proteins are readily identified via the Database of Interacting Proteins (DIP), STRING, BioGRID, MIPS, or the like.
- Non-covalent linkage may comprise a small molecule covalently attached either to an effector molecule or a DNA localization component, and is capable of forming a non- covalent bond to a protein or other small molecule covalently attached to the opposite component.
- One such example would include biotin attached to an oligonucleotide and avidin covalently linked to an effector molecule.
- Transposase proteins for example, must perform several steps to achieve the desired function, including transposon recognition, cleavage of DNA to excise a transposon, movement of a transposon sequence to a new genomic location, recognition of a new target site, and cleavage of DNA to integrate the transposon at a new locus.
- heterologous protein with site-specific DNA binding activity would only be required during the target site recognition step, and the presence of this protein at earlier stages in the process described above may be detrimental to the other steps.
- a temporary association of the heterologous protein with site-specific DNA binding activity with the transposase would allow the transposase to be directed to the genomic site of interest while allowing for the other steps of the process to be carried out with limited interference of the protein due to the non-covalent binding.
- an enzymatic protein such as a nuclease, methylase, deacetylase, etc. to temporarily interact with a specific DNA binding domain so that its activity occurs at a specific location in the genome.
- an enzymatic protein such as a nuclease, methylase, deacetylase, etc.
- the linker comprises a non-covalent linkage between the DNA binding element and the effector.
- phage display may be used to produce single-chain variable fragment (scFv) antibodies or single domain antibodies (sdAbs) against a particular target.
- PhD may be used to identify a scFv antibody against an effector, for example piggy BBac (PB) transposase that provides a linkage.
- PB piggy BBac
- a large diversity in scFv affinity may be obtained by limiting the stringency of the affinity selection process.
- the linkage may be between PB transposase (PBase) and a modular DNA binding domain such as a poly dactyl zinc finger, a TAL array, or a dCas9 protein (with associated guide RNA).
- PBase PB transposase
- a modular DNA binding domain such as a poly dactyl zinc finger, a TAL array, or a dCas9 protein (with associated guide RNA).
- a scFv antibody with a faster off-rate may provide permissive "breathing" of the complex.
- conformation and/or flexibility of an effector and DNA binding element may be critical.
- Non-covalent linkages may provide conformational pliability to the disclosed gene editing compositions.
- scFv that binds particular epitopes of an effector may provide an optimal stability and conformation of the gene editing complex that would not otherwise be obtainable through traditional peptide linkage.
- a near-exhaustive search among scFv antibodies allows one to select from among a large diversity of possible conformations of a gene editing complex.
- a PhD strategy creates such diversity through the generation of unique monovalent scFvs against multiple unique epitopes.
- a non-covalent linkage method such as that achieved through the use of a scFv antibody, may employ an unmodified and native effector (e.g., PB).
- PB native effector
- This provides a reversible associate between the effector and the DNA binding element, which may circumvent any permanent interference with the activity of an effector that may occur when it is subjected to covalent linkage.
- Certain non-covalent associations could introduce steric hindrances that compromise the effector reaction. As several activities may be involved (site recognition, strand cleavage, transposon binding and integration) it is likely that each separate step may be differentially affected by a particular steric hindrance.
- transposase association with the DNA transposon (during transposon mobilization from one genomic site to another) has a very slow off-rate, then it would be detrimental to have a very high affinity association between a DNA binding element-scFv and the PBase that disrupts this association.
- the DNA binding element-scFv protein binds with a lower, but significant affinity, it could be temporarily displaced during transposon mobilization. It is possible that such an early step could involve temporary dissociation of DNA binding factor- scFv with the PBase, with subsequent reassembly of the complex at later steps to create a fully functional and DNA binding factor-enabled site-specific transposase.
- Polypeptides of the disclosure may be introduced into a dual reporter plasmid to validate the efficiency of polypeptides comprising a nuclease to cut DNA at the targeted site.
- Figure 5 depicts a use of an exemplary dual reporter plasmid of the disclosure that may be used to validate the efficiency of polypeptide specific binding to a target sequence and subsequent endonuclease activity at that site.
- expression of the red fluorescent protein (RFP) under the control of a constitutive reporter illustrates transfection efficiency of the plasmid.
- RFP red fluorescent protein
- expression of the green fluorescent protein (GFP) under the control of a promoter illustrates the efficacy of the nuclease activity of the polypeptide of the disclosure that specifically targets the customized target sequence of the plasmid.
- GFP green fluorescent protein
- Figure 6 demonstrates the endonuclease activity of an AAVS 1 vector containing at least a nuclease domain of either Clo051 or Fokl relative to an endonuclease-free control.
- expression of the red fluorescent protein (RFP) under the control of a constitutive reporter illustrates transfection efficiency of the plasmid.
- the vector containing Clo051 Compared to the positive control, the vector containing Clo051 demonstrates superior transfection efficiency compared to the vector containing Fokl.
- expression of the green fluorescent protein (GFP) under the control of a promoter the activity of which is induced by a targeted double-strand break and subsequent repair by non-homologous end joining (NHEJ) repair, illustrates the efficacy of the nuclease activity of either Clo051 or Fokl compared to the negative control lacking an endonuclease domain.
- the vector containing Clo051 demonstrates greater nuclease activity compared to the vector containing Fokl.
- Polypeptides of the disclosure include a DNA localization component and an effector molecule.
- the polypeptide is a fusion protein comprising, consisting essentially of or consisting of a DNA localization component and an effector molecule.
- the polypeptide may comprise, consist essentially of or consist of a DNA localization component and an effector molecule, wherein the DNA localization component and the effector molecule are capable of operatively linking via a covalent or non- covalent linkage.
- the DNA localization component comprises one or more guide RNAs (gRNAs) and the effector comprises a type IIS endonuclease.
- effectors of the disclosure may comprise an endonuclease homodimer or heterodimer.
- the effector may comprise an endonuclease homodimer or heterodimer comprising, consisting essentially or consisting of a catalytic domain of a form of Cas9 and a type IIS endonuclease or, alternatively, two distinct type II endonucleases.
- the effector may comprise an endonuclease homodimer comprising, consisting essentially or consisting of two identical type II endonucleases.
- Exemplary Cas9 constructs may include a catalytically inactive Cas9 (dCas9) and an effector.
- Cas9 construct of the disclosure may include an effector comprising a type IIS endonuclease including, but not limited to, Acil, Mnll, Alwl, Bbvl, Bed, BceAI, BsmAI, BsmFI, BspCNI, BsrI, BtsCI, Hgal, HphI, HpyAV, Mboll, My II, Plel, SfaNI, Acul, BciVI, BfuAI, BmgBI, Bmrl, Bpml, BpuEI, Bsal, BseRI, Bsgl, BsmI, BspMI, BsrBI, BsrBI, BsrDI, BtgZI, Btsl, Earl, Ecil, Mmel, NmeAIII, BbvCI, BpulOI, BspQI, Sapl, Bael, BsaXI, CspCI, Bfil, Mboll, Acc36I or Clo
- the effector molecule comprises Bmrl, Bfil, or Clo051.
- the effector comprises a homodimer comprising a type IIS endonuclease including, but not limited to, Acil, Mnll, Alwl, Bbvl, Bed, BceAI, BsmAI, BsmFI, BspCNI, BsrI, BtsCI, Hgal, HphI, HpyAV, Mboll, Myll, Plel, SfaNI, Acul, BciVI, BfuAI, BmgBI, Bmrl, Bpml, BpuEI, Bsal, BseRI, Bsgl, BsmI, BspMI, BsrBI, BsrBI, BsrDI, BtgZI, Btsl, Earl, Ecil, Mmel, NmeAIII, BbvCI, BpulOI, BspQI, Sapl, Bad, Bsa
- Exemplary Cas9 constructs may include a catalytically inactive small Cas9
- Cas9 construct of the disclosure may include an effector comprising a type IIS endonuclease including, but not limited to, Acil, Mnll, Alwl, Bbvl, Bed, BceAI, BsmAI, BsmFI, BspCNI, BsrI, BtsCI, Hgal, HphI, HpyAV, Mboll, Myll, Plel, SfaNI, Acul, BciVI, BfuAI, BmgBI, Bmrl, Bpml, BpuEI, Bsal, BseRI, Bsgl, BsmI, BspMI, BsrBI, BsrBI, BsrDI, BtgZI, Btsl, Earl, Ecil, Mmel, NmeAIII, BbvCI, BpulOI, BspQI, Sapl, Bael, BsaXI, CspCI,
- a type IIS endonuclease including
- the effector comprises a homodimer comprising a type IIS endonuclease including, but not limited to, Acil, Mnll, Alwl, Bbvl, Bed, BceAI, BsmAI, BsmFI, BspCNI, BsrI, BtsCI, Hgal, HphI, HpyAV, Mboll, Myll, Plel, SfaNI, Acul, BciVI, BfuAI, BmgBI, Bmrl, Bpml, BpuEI, Bsal, BseRI, Bsgl, BsmI, BspMI, BsrBI, BsrBI, BsrDI, BtgZI, Btsl, Earl, Ecil, Mmel, NmeAIII, BbvCI, BpulOI, BspQI, Sapl, Bael, BsaXI, CspCI, Bfil, Mboll, Acc36I or Clo051.
- compositions comprising a small, Cas9 (Cas9) operatively- linked to an effector.
- the disclosure provides a fusion protein comprising, consisting essentially of or consisting of a DNA localization component and an effector molecule, wherein the effector comprises a small, Cas9 (Cas9).
- a small Cas9 construct of the disclosure may comprise an effector comprising a type IIS endonuclease.
- compositions comprising an inactivated, small, Cas9
- dSaCas9 operatively -linked to an effector.
- the disclosure provides a fusion protein comprising, consisting essentially of or consisting of a DNA localization component and an effector molecule, wherein the effector comprises a small, inactivated Cas9 (dSaCas9).
- a small, inactivated Cas9 (dSaCas9) construct of the disclosure may comprise an effector comprising a type IIS endonuclease.
- dSaCas9 Sequence D10A and N580A mutations (bold, capitalized, and underlined) inactivate the catalytic site.
- Exemplary Cas9 constructs of the disclosure include, but are not limited to, Clo051- Cas9.
- Figure 9 provides a construct map for an exemplary vector of the disclosure, Csy4- T2A-Clo051-G4Slinker-dCas9. The corresponding amino acid sequence for this construct is provided below:
- Figure 10 demonstrates that an exemplary Clo051-Cas9 construct, including the Csy4-T2A-Clo051-G4Slinker-dCas9 construct, of the disclosure is active.
- Cas9 may be combined with any nuclease, including but not limited to Clo051, Bfil and Bmrl. Exemplary sequences for the nuclease domains of Clo051, Bfil and Bmrl are provided below.
- Clo051 nuclease domain may comprise, consist essentially of or consist of, the amino acid sequence of:
- An exemplary Bfil nuclease domain may comprise, consist essentially of or consist of, the amino acid sequence below wherein the catalytic residues include H105, K107, N125, and E136:
- An exemplary Bmrl nuclease domain may comprise, consist essentially of or consist of, the amino acid sequence below wherein the catalytic residues include H105, K107, N125, and E136:
- Transcription factors with programmable DNA binding domains provide a means to create an exogenous biological circuit in an endogenous system and create designer proteins that bind to pre-determined DNA sequences or individual nucleic acids.
- Modular DNA binding domains have been identified in transcriptional activator-like (TAL) proteins, or, more specifically, transcriptional activator-like effector nucleases (TALENs), thereby allowing for the de novo creation of synthetic transcription factors that bind to DNA sequences of interest and, if desirable, also allowing a second domain present on the protein or polypeptide to perform an activity related to DNA.
- TAL proteins have been derived from the organisms Xanthomonas and Ralstonia.
- the disclosure provides polypeptides derived from Xanthomonas amino acid sequences or amino acid sequences related thereto, nucleic acids encoding the same, compositions comprising the same, kits comprising the same, non-human transgenic animals comprising the same, and methods of using the same.
- effector proteins derived from Xanthomonas may be used as part of a larger targeted chimeric protein (i.e. a component of a chimeric protein).
- Chimeric effector proteins of the disclosure including those comprising or consisting of a TAL protein, or any component thereof, may demonstrate accessory activities related to nucleic acids such as nuclease activity.
- a polypeptide or pronucleases that can facilitate homologous recombination in genome engineering may be used as a component of a chimeric protein.
- a transcription factor may be used as a component of a chimeric protein, making the resultant chimeric protein particularly useful for therapeutic compositions and uses thereof requiring a very high level of specificity (including therapeutic compositions and uses thereof directed against pathogens (e.g., viruses)).
- Polypeptides or proteins of the disclosure may be derived from polypeptides or proteins found in Xanthomonas. Polypeptides or proteins of the disclosure may contain one or more sequences that are neither identical to any polypeptide or protein found in
- Polypeptides or proteins of the disclosure may comprise at least a first domain and a second domain, wherein the first domain comprises at least one coding sequence for a nucleic acid recognition element and the second domain comprises at least one coding sequence for a nucleic acid effector element.
- the disclosure provides a preferred Xanthomonas-TALE-Clo051 (XTC) polypeptide.
- This polypeptide comprises a TAL DNA-binding domain derived from Xanthomonas fused to the Clo051 endonuclease.
- Figures 3 and 4 provide a construct map corresponding to an exemplary empty backbone and cloned DNA binding domain for the XTC polypeptide.
- the N-terminal domain sequence comprises a T7 promotor and a nuclear localization signal (NLS) in a 3xFLAG® System Expression Vector.
- the amino acid sequence encoding a Xanthomonas TAL DNA-binding domain comprises:
- the C-terminal Domain sequence of the XTC polypeptide may comprise one of four potential sequences. Variable amino acid positions are denoted by the letter "X”.
- the consensus sequence of the XTC C-terminal Domain comprises
- the XXX variable amino acids are "NNN" and specify a glycine (G).
- G glycine
- the XXX variable amino acids are "SNG" and specify a threonine (T).
- T threonine
- the XXX variable amino acids are "SHD" and specify a cysteine (C).
- the complete sequence for this third embodiment of the sequence of the XTC C-terminal Domain is
- the XXX variable amino acids are "SNI" and specify an alanine (A).
- the complete sequence for this fourth embodiment of the sequence of the XTC C-terminal Domain is
- Preferred Xanthomonas-TALE-Clo051 (XTC) polypeptides of the disclosure comprise a Clo051 nuclease domain comprising, consisting essentially of or consisting of the amino acid sequence of "EGIKSNISLLKDELRGQISHISHEYLSLIDLAFDSKQNRLFEMKVLELLVNEYGFKGR HLGGSRKPDGIVYSTTLEDNFGIIVDTKAYSEGYSLPISQADEMERYVRENSNRDEEV NPNKWWENFSEEVKKYYFVFISGSFKGKFEEQLRRLSMTTGVNGSAVNVVNLLLGA EKIRSGEMTIEELERAMFNNSEFILKY" (SEQ ID NO: 36).
- Xanthomonas-TALE-Clo051 (XTC) polypeptides of the disclosure demonstrate superior cutting efficiency compared to TALE-Fokl.
- endonuclease activity was determined in a CEL I mismatch endonuclease assay using either TALE-Clo051 or TALE-Fokl.
- Cell assays are described in greater detail in Kulinski et al. The CEL I Enzymatic Mutation Detection Assay, BioTechniques 29(l):44-48 (July 2000) (the contents of which are herein incorporated by reference).
- Figure 8 depicts another comparison of endonuclease activity, also demonstrated by CEL I assay, between XTN TALEN compositions of the disclosure and alternative TALEN constructs that are not encompassed by the disclosure.
- Figure 11 depicts an alignment of XTN-Clo051 clones (encoding an XTC polypeptide of the disclosure). Sequence analysis revealed a low rate of insertion or deletion (indel) in the DNA sequences of these clones.
- XTN compositions of the disclosure may include any endonuclease, including, but not limited to, Xanthomonas-TALE-Bfil and Xanthomonas-TALE-Bmrl.
- endonuclease including, but not limited to, Xanthomonas-TALE-Bfil and Xanthomonas-TALE-Bmrl.
- the activity of these XTN compositions transfected into HEK293 cells is demonstrated in Figure 13.
- An exemplary Bfil nuclease domain may comprise, consist essentially of or consist of, the amino acid sequence below wherein the catalytic residues include H105, K107, N125, and E136:
- An exemplary Bmrl nuclease domain may comprise, consist essentially of or consist of, the amino acid sequence below wherein the catalytic residues include H105, K107, N125, and E136:
- the disclosure provides polypeptides derived from Ralstonia amino acid sequences or amino acid sequences related thereto, nucleic acids encoding the same, compositions comprising the same, kits comprising the same, non-human transgenic animals comprising the same, and methods of using the same.
- RVDs variable diresidues
- effector proteins derived from Ralstonia may be used as part of a larger targeted chimeric protein (i.e. a component of a chimeric protein).
- Chimeric effector proteins of the disclosure including those comprising or consisting of a TAL protein, or any component thereof, may demonstrate accessory activities related to nucleic acids such as nuclease activity.
- a polypeptide or pronucleases that can facilitate homologous recombination in genome engineering may be used as a component of a chimeric protein.
- a transcription factor may be used as a component of a chimeric protein, making the resultant chimeric protein particularly useful for therapeutic compositions and uses thereof requiring a very high level of specificity (including therapeutic compositions and uses thereof directed against pathogens (e.g., viruses)).
- Polypeptides or proteins of the disclosure may be derived from polypeptides or proteins found in Ralstonia. Polypeptides or proteins of the disclosure may contain one or more sequences that are neither identical to any polypeptide or protein found in Ralstonia nor naturally-occurring in Ralstonia.
- Polypeptides or proteins of the disclosure may comprise at least a first domain and a second domain, wherein the first domain comprises at least one coding sequence for a nucleic acid recognition element and the second domain comprises at least one coding sequence for a nucleic acid effector element.
- RTNs of the disclosure may refer to a polypeptide or protein that comprises at least a first domain wherein the first domain comprises at least one coding sequence for a nucleic acid recognition element derived from an amino acid sequence derived from Ralstonia.
- RTNs of the disclosure may refer to a polypeptide or proteins of the invention that comprise at least a first domain and a second domain, wherein the first domain comprises at least one coding sequence for a nucleic acid recognition element derived from an amino acid sequence derived from Ralstonia and the second domain comprises a amino acid that is an effector protein.
- RTNs of the disclosure may refer to a polypeptide or proteins of the invention that comprise at least a first domain and a second domain, wherein the first domain comprises at least one coding sequence for a nucleic acid recognition element derived from an amino acid sequence derived from Ralstonia and the second domain comprises a amino acid that is a nuclease.
- RTN DNA binding specificity depends on the number and order of repeat domains in the DNA binding domain.
- repeats may comprise from about 30 to about 40 amino acids.
- repeats may comprise from about 32 to about 38 amino acids, from about 33 to about 37 amino acids, from about 34 to about 35 amino acids, from about 33 to about 36 amino acids, or from about 33 to about 35 amino acids.
- Repeats may consist of 34 to 35 amino acids, consist of 33 to 35 amino acids, or consist of 34 to 36 amino acids.
- Nucleotide binding specificity of repeat domains of the disclosure may be determined by the 12 and 13 amino acids of each repeat domain.
- Polypeptides or proteins of the disclosure may comprise at least one RVD sequence selected from the following: SI, SN, SH, NP, NH, NT, NK, NN, ND, HN, HY, HD, HH, RN, RS, and GS.
- Polypeptides or proteins of the disclosure may comprise at least one RVD sequence in any combination selected from the following: SI, SN, SH, NP, NH, NT, NK, NN, ND, HN, HY, HD, HH, RN, RS, NG and GS; wherein SI, SN, SH, NP, and NH bind any nucleic acid base; wherein NT, NK, and NN bind adenine; wherein ND, HN, HY, HD, and HH bind adenine and/or guanine; wherein NG binds thymine; wherein RN, RS, and GS bind guanine.
- Polypeptides or proteins of the disclosure may comprise at least one RVD sequence in any combination selected from the following: SI, SN, SH, NP, NH, NT, NK, NN, ND, HN, HY, HD, HH, RN, RS, NG and GS; wherein SI, SN, SH, NP, and NH bind any nucleic acid base; wherein NK binds guanine, and NN binds adenine or guanine; wherein ND, HN, HY, HD, and HH bind cytosine; wherein NG binds thymine; wherein RN, RS, and GS bind guanine.
- Polypeptides or proteins of the disclosure may comprise at least one RVD sequence in any combination selected from the following: SI, SN, SH, NP, NH, NT, NK, NN, ND, HN, HY, HD, HH, RN, RS, NG and GS; wherein SI binds adenine; SN binds guanine and/or adenine, SH, NP, and NH bind any nucleic acid base; wherein NK binds guanine; and NN binds adenine and/or guanine; wherein ND binds cytosine, HN binds guanine, HY, HD, and HH bind cytosine; wherein NG binds thymine; wherein RN binds guanine and/or adenine; wherein RS and GS binds guanine.
- SI binds adenine
- SN binds guanine and/
- Polypeptides or proteins of the disclosure may comprise at least one RVD sequence in any combination wherein at least one of the RVD sequences is NP, ND, or HN; and wherein NP binds cytosine, adenine, and guanine; wherein ND binds cytosine; and wherein HN binds adenine and/or guanine.
- Polypeptides or proteins of the disclosure may comprise, consist essentially of, or consist of SEQ ID NO: 1.
- Polypeptides or proteins of the disclosure may comprise, consist essentially of, or consist of SEQ ID NO: 1, wherein X 1 X 2 bind to a single nucleic acid.
- Polypeptides or proteins of the disclosure may comprise, consist essentially of, or consist of SEQ ID NO: 1, wherein X3 ⁇ 4 bind to at least one nucleic acid.
- Polypeptides or proteins of the disclosure may comprise at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% sequence identity to
- Polypeptides or proteins of the disclosure may comprise at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% sequence identity to
- Polypeptides or proteins of the disclosure may comprise at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% sequence identity to
- Polypeptides or proteins of the disclosure may comprise at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% sequence identity to
- Polypeptides or proteins of the disclosure may comprise at least 80% sequence identity to SEQ ID NO: 1. Polypeptides or proteins of the disclosure may comprise at least 90% sequence identity to SEQ ID NO: 1. Polypeptides or proteins of the disclosure may comprise at least 91% sequence identity to SEQ ID NO: 1. Polypeptides or proteins of the disclosure may comprise at least 92% sequence identity to SEQ ID NO: 1. Polypeptides or proteins of the disclosure may comprise at least 93% sequence identity to SEQ ID NO: 1.
- Polypeptides or proteins of the disclosure may comprise at least 94% sequence identity to SEQ ID NO: 1. Polypeptides or proteins of the disclosure may comprise at least 95% sequence identity to SEQ ID NO: 1. Polypeptides or proteins of the disclosure may comprise at least 96% sequence identity to SEQ ID NO: 1. Polypeptides or proteins of the disclosure may comprise at least 97% sequence identity to SEQ ID NO: 1. Polypeptides or proteins of the disclosure may comprise at least 98% sequence identity to SEQ ID NO: 1. Polypeptides or proteins of the disclosure may comprise at least 99% sequence identity to SEQ ID NO: 1.
- Polypeptides or proteins of the disclosure may comprise at least 80% sequence identity to SEQ ID NO: 1 and comprise more than one of the amino acid substitution in any of the polypeptides chosen from SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7, SEQ ID NO:8, SEQ ID NO:9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18, or SEQ ID NO: 19.
- Polypeptides or proteins of the disclosure may comprise at least 90% sequence identity to SEQ ID NO: 1 and comprise more than one of the amino acid substitutions in any of the polypeptides chosen from SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7, SEQ ID NO:8, SEQ ID NO:9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18, or SEQ ID NO: 19.
- Polypeptides or proteins of the disclosure may comprise at least 95% sequence identity to SEQ ID NO: 1 and comprise more than one of the amino acid substitutions in any of the polypeptides chosen from SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7, SEQ ID NO:8, SEQ ID NO:9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18, or SEQ ID NO: 19.
- Polypeptides or proteins of the disclosure may comprise at least 99% sequence identity to SEQ ID NO: 1 and comprise more than one of the amino acid substitutions in any of the polypeptides chosen from SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7, SEQ ID NO:8, SEQ ID NO:9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18, or SEQ ID NO: 19.
- Polypeptides or proteins of the disclosure may comprise at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to SEQ ID NO: 1, SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7, SEQ ID NO:8, SEQ ID NO:9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18, or SEQ ID NO: 19.
- Polypeptides or proteins of the disclosure may comprise at least one, two, three, or four polypeptide sequences selected from polypeptides comprising at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to SEQ ID NO: l, SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7, SEQ ID NO:8, SEQ ID NO:9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18, or SEQ ID NO: 19.
- Polypeptides or proteins of the disclosure may comprise at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% sequence identity to
- Polypeptides or proteins of the disclosure may comprise at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% sequence identity to
- Polypeptides or proteins of the disclosure may comprise at least 80%, 85%, 90%,
- Polypeptides or proteins of the disclosure may comprise at least 80%, 85%, 90%,
- Polypeptides or proteins of the disclosure may comprise at least 80%, 85%, 90%,
- Polypeptides or proteins of the disclosure may comprise at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% sequence identity to
- Polypeptides or proteins of the disclosure may comprise at least 80%, 85%, 90%,
- Polypeptides or proteins of the disclosure may comprise at least 80%, 85%, 90%,
- Polypeptides or proteins of the disclosure may comprise at least 80%, 85%, 90%,
- Polypeptides or proteins of the disclosure may comprise at least 80%, 85%, 90%,
- Polypeptides or proteins of the disclosure may comprise at least 80%, 85%, 90%,
- Polypeptides or proteins of the disclosure may comprise at least 80%, 85%, 90%,
- Polypeptides or proteins of the disclosure may comprise at least 80%, 85%, 90%,
- Polypeptides or proteins of the disclosure may comprise at least 80%, 85%, 90%,
- Polypeptides or proteins of the disclosure may comprise at least 80%, 85%, 90%,
- Polypeptides or proteins of the disclosure may comprise at least 80%, 85%, 90%,
- Polypeptides or proteins of the disclosure may comprise at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% sequence identity to
- Polypeptides or proteins of the disclosure may comprise at least 80%, 85%, 90%,
- Polypeptides or proteins of the disclosure may comprise, consist essentially of or consist of any combination of polypeptide sequences with at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to the polypeptides chosen from: SEQ ID NO: l, SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7, SEQ ID NO:8, SEQ ID NO:9, SEQ ID NO: 10, SEQ ID NO: l l, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18, and SEQ ID NO: 19.
- Polypeptides or proteins of the disclosure may comprise, consist essentially of or consist of any combination of a polypeptide sequences with at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to the polypeptides chosen from: SEQ ID NO: l, SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7, SEQ ID NO:8, SEQ ID NO:9, SEQ ID NO: 10, SEQ ID NO: l l, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18, and SEQ ID NO: 19, wherein the 12 th and 13 th amino acid of at least one of the polypeptide sequences binds at least one nucleic acid.
- Polypeptides or proteins of the disclosure may comprise, consist essentially of or consist of any combination of a polypeptide sequences with 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to the polypeptides chosen from: SEQ ID NO: l, SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7, SEQ ID NO:8, SEQ ID NO:9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18, and SEQ ID NO: 19.
- Polypeptides or proteins of the disclosure may comprise, consist essentially of or consist of a first domain and a second domain, wherein the first domain is a nucleic acid recognition domain that comprises, consists essentially of or consists of at least one combination of polypeptide sequences with 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to the polypeptides chosen from: SEQ ID NO: l, SEQ ID NO:2, SEQ ID NO:3, SEQ ID N0:4, SEQ ID N0:5, SEQ ID N0:6, SEQ ID N0:7, SEQ ID N0:8, SEQ ID N0:9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID N0: 14, SEQ ID N0: 15, SEQ ID N0: 16, SEQ ID N0: 17, SEQ ID N0: 18, and SEQ ID NO: 19.
- Polypeptides or proteins of the disclosure may comprise, consist essentially of or consist of a first domain and a second domain, wherein the first domain is a nucleic acid recognition domain that comprises, consists essentially of or consists of at least one combination of a polypeptide sequences with 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to the polypeptides chosen from: SEQ ID NO: l, SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7, SEQ ID NO:8, SEQ ID NO:9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18, and SEQ ID NO: 19; wherein the 12 th and 13 th amino acid of at least one polypeptides
- nucleic acids of the disclosure may comprise, comprise essentially of, or consist of nucleic acid sequences that encode at least 2, 3, 4, 5 or more polypeptides chosen from polypeptides comprising at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to SEQ ID NO: l, SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7, SEQ ID NO:8, SEQ ID NO:9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18, or SEQ ID NO: 19.
- Compositions Compositions
- compositions of the disclosure may comprise, consist essentially of, or consist of at least one nucleic acid sequence that encodes a protein or polypeptide described herein.
- compositions of the disclosure may comprise, consist essentially of, or consist of a plurality of (i.e. one or more) nucleic acid sequences that encode any protein or polypeptide described herein.
- Compositions of the disclosure may comprise, consist essentially of, or consist of at least one amino acid sequence described herein.
- compositions of the disclosure may comprise, consist essentially of, or consist of a plurality of (i.e. one or more) amino acid sequences described herein.
- the disclosure provides vectors comprising, consisting essentially of or consisting of any one or more of the nucleic acid sequences of the disclosure encoding any one or more of the proteins of the disclosure.
- the vector is a plasmid.
- the vector is a retrovirus. Retrovirus vectors of the disclosure may comprise, for example, long terminal repeats, a psi packaging signal, a cloning site, and a sequence encoding a selectable marker.
- the disclosure provides cells comprising any one or more of the nucleic acids or vectors of the disclosure.
- the cell is a sperm or an egg.
- kits comprising: a vector comprising a nucleic acid encoding any one or more of the proteins of the disclosure.
- the disclosure provides non-human, transgenic animals comprising a nucleic acid molecule encoding any one or more of the proteins of the disclosure.
- Organisms of the disclosure are unicellular or multicellular.
- Multicellular organisms may include, but are not limited to, vertebrates.
- Exemplary vertebrate animals may include, but are not limited to, mammals.
- Exemplary vertebrate animals may include, but are not limited to, non-human mammals.
- DNA sequences of the invention can be provided in expression cassettes for expression in any prokaryotic or eukaryotic cell and/or organism of interest including, but not limited to, bacteria, fungi, algae, plants, and animals.
- Exemplary cassettes include 5' and 3' regulatory sequences operably linked to a DNA sequence of the invention.
- operably linked refers to a functional linkage between two or more elements.
- an operable linkage between a polynucleotide or gene of interest and a regulatory sequence is functional link that allows for expression of the polynucleotide of interest.
- Operably linked elements may be contiguous or non-contiguous. When used to refer to the joining of two protein coding regions, by operably linked is intended that the coding regions are in the same reading frame.
- the cassette may additionally contain at least one additional gene to be cotransformed into the organism. Alternatively, the additional gene(s) can be provided on multiple expression cassettes.
- Such an expression cassette is provided with a plurality of restriction sites and/or recombination sites for insertion of the DNA sequence to be under the transcriptional regulation of the regulatory regions.
- the expression cassette may additionally contain selectable marker genes.
- Exemplary expression cassettes may include in the 5'-3' direction of transcription, a transcriptional and translational initiation region (i.e., a promoter), a DNA sequence of the invention, and a transcriptional and translational termination region (i.e., termination region) functional in plants or other organism or non-human host cell.
- the regulatory regions (i.e., promoters, transcriptional regulatory regions, and translational termination regions) and/or the DNA sequence of the invention may be native/autologous to the host cell or to each other.
- the regulatory regions and/or DNA sequence of the invention may be heterologous to the host cell or to each other.
- heterologous refers to a sequence that originates from a foreign species, or, if from the same species, is substantially modified from its native form in composition and/or genomic locus by deliberate human intervention.
- a promoter operably linked to a heterologous polynucleotide is from a species different from the species from which the polynucleotide was derived, or, if from the same/analogous species, one or both are substantially modified from their original form and/or genomic locus, or the promoter is not the native promoter for the operably linked polynucleotide.
- a chimeric gene comprises a coding sequence operably linked to a transcription initiation region that is heterologous to the coding sequence.
- Termination regions of the disclosure may be native with a transcriptional initiation region, may be native with the operably linked DNA sequence of interest, may be native with the host, or may be derived from another source (i.e., foreign or heterologous) to the promoter, the DNA sequence of interest, the plant host, or any combination thereof.
- Convenient termination regions for use in plants are available from the Ti-plasmid of A. tumefaciens, such as the octopine synthase and nopaline synthase termination regions. See also Guerineau et al. (1991) Mol. Gen. Genet. 262: 141-144; Proudfoot (1991) Cell 64:671- 674; Sanfacon et al. (1991) Genes Dev. 5: 141-149; Mogen et al. (1990) Plant Cell 2: 1261- 1272; Munroe et al. (1990) Gene 91 : 151-158; Ballas et al. (1989) Nucleic Acids Res.
- Polynucleotides of the disclosure may be optimized for increased expression in a transformed organism. That is, the polynucleotides can be synthesized using codons preferred by the host for improved expression. See, for example, Campbell and Gown (1990) Plant Physiol. 92: 1-11 for a discussion of host-preferred codon usage. Methods are available in the art for synthesizing host-preferred gene, particularly plant-preferred genes. See, for example, U. S. Pat. Nos. 5,380,831 , and 5,436,391 , and Murray et al. (1989) Nucleic Acids Res.
- sequence modifications may be used to enhance gene expression in a cellular host.
- Exemplary sequence modifications include, but are not limited to, elimination of sequences encoding spurious polyadenylation signals, exon-intron splice site signals, transposon-like repeats, and other such well-characterized sequences that may be deleterious to gene expression.
- the G-C content of the sequence may be adjusted to levels average for a given cellular host, as calculated by reference to known genes expressed in the host cell. When possible, the sequence is modified to avoid predicted hairpin secondary mRNA structures.
- Expression cassettes of the disclosure may contain 5' leader sequences.
- leader sequences can act to enhance translation.
- Translation leaders are known in the art and include, for example: picornavirus leaders, for example, EMCV leader
- TEV leader tobacco Etch Virus
- MDMV leader Maize Dwarf Mosaic Virus
- BiP human immunoglobulin heavy-chain binding protein
- AMV RNA 4 untranslated leader from the coat protein mRNA of alfalfa mosaic virus
- TMV tobacco mosaic virus leader
- MCMV maize chlorotic mottle virus leader
- the various DNA fragments may be manipulated, so as to provide for the DNA sequences in the proper orientation and, as appropriate, in the proper reading frame.
- adapters or linkers may be employed to join the DNA fragments or other manipulations may be involved to provide for convenient restriction sites, removal of superfluous DNA, removal of restriction sites, or the like.
- resubstitutions e.g., transitions and transversions
- transitions and transversions may be involved.
- the disclosure provides viral vectors comprising any one or more than one nucleic acid sequence disclosed herein.
- the viral vector is optionally selected from the group comprising a retroviral vector, an adenoviral vector, an adeno-associated viral vector, spumaviral, a lentiviral vector and a plasmid or other vector, such as transposons, described in the application.
- the retroviral vector optionally comprises an oncoretroviral vector.
- the retroviral vector optionally comprises a lentiviral vector.
- compositions of the disclosure may be pharmaceutical compositions.
- compositions of the disclosure may be used to treat patients having diseases, disorders or abnormal physical states, and comprise an acceptable carrier, auxiliary or excipient.
- compositions are optionally administered by ex vivo and in vivo methods such as electroporation, DNA microinjection, liposome DNA delivery, and virus vectors that have RNA or DNA genomes including retrovirus vectors, lentivirus vectors, Adenovirus vectors and Adeno-associated virus (AAV) vectors, Semliki Forest Virus.
- ex vivo and in vivo methods such as electroporation, DNA microinjection, liposome DNA delivery, and virus vectors that have RNA or DNA genomes including retrovirus vectors, lentivirus vectors, Adenovirus vectors and Adeno-associated virus (AAV) vectors, Semliki Forest Virus.
- the expression cassettes are optionally introduced into the cells or their precursors using ex vivo or in vivo delivery vehicles such as liposomes or DNA or RNA virus vectors. They are also optionally introduced into these cells using physical techniques such as microinjection or chemical methods such as coprecipitation.
- compositions are typically prepared by known methods for the preparation of pharmaceutically acceptable compositions which are administered to patients, and such that an effective quantity of the nucleic acid molecule is combined in a mixture with a pharmaceutically acceptable vehicle.
- Suitable vehicles are described, for example in Remington's Pharmaceutical Sciences ⁇ Remington's Pharmaceutical Sciences, Mack
- the pharmaceutical compositions could include an active compound or substance, such as a nucleic acid molecule, in association with one or more pharmaceutically acceptable vehicles or diluents, and contained in buffered solutions with a suitable pH and isoosmotic with the physiological fluids.
- the methods of combining the expression cassettes with the vehicles or combining them with diluents are well known to those skilled in the art.
- the composition could include a targeting agent for the transport of the active compound to specified sites within cells.
- the expression cassette can also comprise a selectable marker gene for the selection of transformed cells. Selectable marker genes are utilized for the selection of transformed cells or tissues.
- Marker genes include genes encoding antibiotic resistance, such as those encoding neomycin phosphotransferase II (NEO) and hygromycin phosphotransferase (HPT), as well as genes conferring resistance to herbicidal compounds, such as glufosinate ammonium, bromoxynil, imidazolinones, and 2,4-dichlorophenoxyacetate (2,4-D).
- Additional selectable markers include phenotypic markers such as .beta.- galactosidase and fluorescent proteins such as green fluorescent protein (GFP) (Su et al. (2004) Biotechnol Bioeng 85:610-9 and Fetter et al. (2004) Plant Cell 16:215-28), cyan florescent protein (CYP) (Bolte et al. (2004) J. Cell Science 117:943-54 and Kato et al.
- GFP green fluorescent protein
- CYP cyan florescent protein
- the disclosure provides a eukaryotic cell comprising a mutation, a heterologous gene, a variant and/or another genetic modification caused by introduction of one or more nucleic acids or polypeptides described herein.
- the disclosure provides a mammalian cell comprising a mutation, a heterologous gene, a variant and/or another genetic modification caused by introduction of one or more nucleic acids or polypeptides described herein.
- the disclosure provides a human cell comprising any one or combination of proteins or nucleic acid sequences disclosed herein.
- the disclosure provides a human cell comprising a mutation, a heterologous gene, a variant, and/or another genetic
- the disclosure provides non-human cells comprising a mutation, a heterologous gene, a variant and/or another genetic modification caused by introduction of one or more nucleic acids or polypeptides described herein.
- the disclosure provides an insect cell comprising a mutation, a heterologous gene, a variant and/or other genetic modification caused by introduction of one or more nucleic acids or polypeptides described herein.
- the disclosure provides a fish cell comprising a mutation, a heterologous gene, a variant and/or other genetic modification caused by introduction of one or more nucleic acids or polypeptides described herein.
- the disclosure provides a plant cell comprising a mutation, a heterologous gene, a variant and/or other genetic modification caused by introduction of one or more nucleic acids or polypeptides described herein.
- the disclosure provides plants (and portions or parts thereof), seeds, plant cells and other non-human host cells transformed with the isolated nucleic acid molecules of the disclosure and the proteins or polypeptides encoded by the nucleic acid molecules (including coding regions thereof) of the disclosure.
- Polypeptides and DNA molecules described herein may be introduced into animal and human cells as well as cells of other organisms, including, but not limited to, fungi or plants.
- compositions of the disclosure may be used for site-specific modification of the genome of any cell, including, but not limited to, stem cells and gametes.
- stem cells include pluripotent cells, totipotent cells, somatic stem cells, spermatogonial stem cells (SSCs), embryonic stem (ES) cells, induced pluripotent stem (iPS) cells, embryos, germ cells, primordial germ cells (PGCs), plant tube cells, pollen cells, and spores.
- Site-specific engineering of stem cells results in altered function of gene(s) or gene product(s) and genetically modified organisms, and cell or tissue culture models are produced from these engineered stem cells.
- Modified stem cells and organisms include knockout and knockin cells and organisms.
- Genetically modified organisms created by site-specific engineering using the compositions and methods of the disclosure include, but not limited to mammals (e.g. rats, mice, pigs, rabbits, guinea pigs, dogs, non-human primates, mini-pigs) as well as plants (e.g., maize, soybean, rice, potato, wheat, tobacco, tomato, and Arabidopsis, as well as the descendants and ancestors of such organisms).
- mammals e.g. rats, mice, pigs, rabbits, guinea pigs, dogs, non-human primates, mini-pigs
- plants e.g., maize, soybean, rice, potato, wheat, tobacco, tomato, and Arabidopsis, as well as the descendants and ancestors of such organisms.
- the application includes methods and compositions for providing a coding nucleic acid molecule to the cells of an individual such that expression of the coding nucleic acid molecule in the cells provides the biological activity or phenotype of the polypeptide encoded by the coding nucleic acid molecule.
- the method also relates to a method for providing an individual having a disease, disorder or abnormal physical state with a biologically active polypeptide by administering a nucleic acid molecule of the present application. The method may be performed ex vivo or in vivo. Gene therapy methods and compositions are demonstrated, for example, in U.S. Pat. Nos.
- Vectors containing the nucleic acid molecules of the application are typically administered to mammals, preferably humans, in gene therapy using techniques described below.
- the polypeptides produced from the nucleic acid molecules are also optionally administered to mammals, preferably humans.
- the application relates to a method of medical treatment of a mammal in need thereof, preferably a human, by administering to the mammal a vector of the application or a cell containing a vector of the application.
- a recipient, preferably human, who develops an adverse event, such as graft versus host disease, is typically administered a drug, such as AZT, that is a substrate for the modified tmpk molecules of the application.
- Blood diseases such as blood diseases or neural diseases (neurodegenerative), that are readily treated are described in this application and known in the art (e.g. diseases, such as thalassemia or sickle cell anemia that are treated by administering a globin gene as described in Canadian patent application no. 2,246,005).
- Blood diseases treatable by stem cell transplant include leukemias, myelodysplastic syndromes, stem cell disorders, myeloproliferative disorders, lymphoproliferative disorders phagocyte disorders, inherited metabolic disorders, histiocytic disorders, inherited erythrocyte abnormalities, inherited immune system disorders, inherited platelet
- Stem cell nerve diseases to be treated by neural stem cell transplantation include diseases resulting in neural cell damage or loss, (e.g. paralysis, Parkinson's disease, Alzheimer's disease, ALS, multiple sclerosis).
- the vector of the application is useful as a stem cell marker and to express genes that cause stem cells to differentiate (e.g. growth factor).
- the disclosure provides a method for providing a human with a therapeutic polypeptide including: introducing human cells into a human, the human cells having been treated in vitro or ex vivo to insert therein a vector of the application, the human cells expressing in vivo in the human a therapeutically effective amount of the therapeutic polypeptide.
- the method also relates to a method for producing a stock of recombinant virus by producing virus suitable for gene therapy comprising modified DNA encoding globin.
- This method preferably involves transfecting cells permissive for virus replication (the virus containing modified globin) and collecting the virus produced.
- Cotransfection (DNA and marker on separate molecules) may be employed (see eg U.S. Pat. No. 5,928,914 and U.S. Pat. No. 5,817,492).
- a detection cassette or marker such as Green Fluorescent Protein marker or a derivative, CD 19 or CD25
- the vector itself preferably a viral vector.
- Methods of the disclosure may be used to mutate any eukaryotic stem cell, including, but not limited to, haploid, diploid, triploid, tetraploid, or aneuploid.
- the cell is diploid.
- Stem cells in which the methods of the present invention can be advantageously used include, but are not limited to stem cells such as somatic stem cells, SSCs, ES cells, iPS cells, embryos, or any cell capable of developing into one or more organisms.
- the disclosure provides a method to produce a site-specific knockout, knock-in or otherwise genetically modified stem cell.
- the site-specific mutation is generated using a composition of the disclosure that cleaves the desired site, followed by NHEJ repair, resulting in deletion mutations.
- the site-specific mutation can be produced in
- SSCs spermatogonial stem cells
- the disclosure provides a method to produce a site-specific knockout, knock-in or otherwise genetically modified stem cell.
- the site-specific mutation is generated using a composition of the disclosure that the desired site resulting in deletion mutations.
- the site specific mutation is produced in embryonic stem (ES) cells, which are used to generate heterozygous or homozygous genetically modified organisms.
- ES embryonic stem
- the disclosure provides methods to produce a site-specific knockout, knock-in or otherwise genetically modified stem cell.
- the site specific mutation is generated using a composition that cleaves the desired site resulting in deletion mutations.
- the site-specific mutation is produced in induced pluripotent stem (iPS) cells, which are used to generate heterozygous or homozygous genetically modified organisms.
- iPS induced pluripotent stem
- the disclosure provides methods to produce a site-specific knockout, knockin or otherwise genetically modified stem cell.
- the site specific mutation is generated using a composition that cleaves the desired site resulting in deletion mutations.
- the site-specific mutation is produced in embryos which are used to generate heterozygous or homozygous genetically modified organisms.
- the disclosure provides methods to mutate cells within the organism or within the native environment as in tissue explants (e.g., in vivo or in situ). Alternatively, tissues or stem cells isolated from the organism using art-known methods and genes can be mutated according to the methods of the disclosure.
- the tissues or stem cells are either maintained in culture (e.g., in vitro), or re-implanted into a tissue or organism (e.g., ex vivo).
- the disclosure provides a preferred assembly method to construct TALE repeat arrays in which three distinct TALE repeat backbones that differ slightly in their amino acid and DNA sequences occur in a repeated pattern.
- the first, amino-terminal TALE repeat in an array was designated as a unit. This is followed by ⁇ , and ⁇ units and then an a unit that is substantially identical to the first a unit, except for the different positioning of a Type IIS restriction site on the 5' and 3' end (required to enable creation of a unique overhangs needed for cloning into an organized array).
- the a unit is then followed again by repeats of ⁇ and ⁇ units.
- RVDs repeat variable di-residues
- 10 plasmids were synthesized (IDT) and generated, for a library total of forty pRVD plasmids (ampicillin selectable marker).
- IDT repeat variable di-residues
- 10 plasmids were generated for the RVD NI such that NI-1 was an a unit, NI-2 was a ⁇ unit, NI-3 was a ⁇ unit, NI-4 was an a unit and so on.
- the sequence encoding the TALE repeat domain is flanked by Bsal restriction sites such that the overhangs generated by digestion of any pRVD plasmids encoding units designed to be adjacent to one another (eg. 1 and 2, 2 and 3 etc) with Basl are complementary to each other.
- Step la Clone pRVDs 1 through 10 (specifying the first 10 targeted nucleotides) into pIN-X.
- Step lb Clone pRVDs 1 up to 10 (specifying the 11th up to 20th targeted nucleotide) into pIN-Z.
- Step 2 Clone the pIN-X array and the pIN-Z array of TALE repeat backbones into the correct XTN-expression backbone to produce an XTN targeting up to 20 specified nucleotide sequence.
- pRVDs (pRVDs 1 through 10) are selected in the correct order to match the first ten targeted DNA sequences.
- lOOng of each pRVD is mixed with lOOng of pIN-X in a single 20ul reaction containing lul Bsal (10U, NEB) and lul T4 DNA ligase (2000U, NEB) in T4 DNA ligase buffer (NEB).
- the reaction is then incubated in a thermocyler to 10 cycles of 5 min at 37°C and l Omin at 16°C, then heated to 50°C for 5 min and then 80°C for 5 min.
- the mixture is then used to transform E. coli cells and plated on LB agar containing 50ug/ml Kanamycin. Colonies are then screened by colony PCR and sequenced to identify clones that contain the desired 10RVD array.
- Step lb pRVDs are selected in the correct order to match the 1 1th through (upto) 20th targeted DNA sequence.
- l OOng of each pRVD is mixed with l OOng of pIN-Z and the procedure described in Step la above is replicated to identify desired clones.
- Step 2 150ng of each pIN-X and pIN-Z plasmids containing the intermediary repeat arrays is mixed with 150ng of the desired XTN expression plasmid in a single 20ul reaction containing lul BsmBI (10U NEB) and lul T4 DNA ligase (2000U NEB) in T4 DNA ligase buffer (NEB).
- the reaction is treated and used to transform E coli as in Step la, except Ampicillin (l OOug/ml) is used in place of Kanamycin for selection of transformants.
- Clones are screened by colony PCR and sequenced to identify desired clones.
- pIN-X and pIN-Z are Kanamycin selectable plasmids that contain two sites each for Bsal and BsmBI such that when digested with Bsal, produce overhangs that complement the Bsal overhangs of pRVD-1 and pRVD-10 to incorporate an array of pRVDs 1 through 10 into the intermediate plasmids.
- pIN-X and pIN-Z are Kanamycin selectable plasmids that contain two sites each for Bsal and BsmBI such that when digested with Bsal, produce overhangs that complement the Bsal overhangs of pRVD-1 and pRVD-10 to incorporate an array of pRVDs 1 through 10 into the intermediate plasmids.
- Several versions of pIN-X have been generated for use depending on the number of repeats to be incorporated (6 through 10 repeats).
- XTN Expression Backbones Similar to the FLASH system of the disclosure, the last targeted nucleotide specified by the final half Effector Binding Element (EBE), is incorporated in the expression backbone and hence there are four expression backbones that each specify the last targeted nucleotide to be A, C, T or G.
- the expression backbone contains the XTN N-terminal sequence, the C-terminal sequence linked to a particular obligate dimer nuclease such as Fokl (Clo51 , Bfil, Bmrl).
- the disclosure provides methods of modifying genetic material of a cell or at least one cell of an organism (multicellular or unicellular), the method comprising administering directly to the cell or at least one cell of the organism one or more of the nucleic acids or polypeptides of the disclosure.
- Polypeptides of the disclosure may be provided or administered as a nucleic acid encoding the protein.
- the nucleic acid encoding the protein is administered with a second nucleic acid sequence that encodes an effector.
- the disclosure provide methods for constructing new repeat units and testing the specific binding activities of artificially constructed repeat units specifically recognizing base pairs in a target DNA sequence.
- the number of repeat units to be used in a repeat domain may be varied for optimal specific binding. Generally, at least 1.5 repeat units are considered as a minimum, although typically at least about 8 repeat units are used. The repeat units are not required to be complete repeat units because repeat units of half the size may be used.
- polypeptides and methods of making and using the polypeptides of the disclosure depend on repeat domains with a particular number of repeat units.
- a polypeptide of the disclosure may comprise, for example, 1.5, 2, 2.5, 3, 3.5, 4, 4.5, 5, 5.5, 6, 6.5, 7, 7.5, 8, 8.5, 9, 9.5, 10, 10.5, 1 1, 11.5, 12, 12.5, 13, 13.5, 14, 14.5, 15, 15.5, 16, 16.5, 17, 17.5, 18, 18.5, 19, 19.5, 20, 20.5, 21 , 21.5, 22, 22.5, 23, 23.5, 24, 24.5, 25, 25.5, 26, 26.5, 27, 27.5, 28, 28.5, 29, 29.5, 30, 30.5, 31 , 31.5, 32, 32.5, 33, 33.5, 34, 34.5, 35, 35.5, 36, 36.5, 37, 37.5, 38, 38.5, 39, 39.5, 40, 40.5, 41 , 41.5, 42, 42.5, 43, 43.5, 44, 44.5, 46, 46.5, 47, 47.5, 48, 48.5, 49, 49.5, 50, 50.5 or more repeat units.
- Polypeptides of the disclosure may comprise a repeat domain with repeat units wherein in the repeat units hypervariable regions are included which determine recognition of a base pair in a target DNA sequence.
- each repeat unit of the repeat domains of the disclosure may include a hypervariable region which determines recognition of one base pair in a target DNA sequence.
- 1 or 2 repeat units in a repeat domain may be included which do not specifically recognize a base pair in a target DNA sequence.
- each repeat unit is responsible for the specific recognition of one base pair in a target DNA sequence. Consequently, in this modular arrangement, a sequence of repeat units may correspond to a sequence of base pairs in a target DNA sequence so that 1 repeat unit corresponds to one base pair.
- the disclosure provides a method for selectively recognizing a base pair in a target DNA sequence by a polypeptide that comprises at least one repeat domain, the at least one repeat domain comprising a plurality of repeat units, wherein each repeat unit comprises at least one RVD region. RVD regions of the disclosure determine recognition of a base pair or nucleotide in a target DNA sequence.
- the RVD regions of the disclosure include those amino acids in a DNA-binding polypeptide responsible for selective recognition of base pairs in a target DNA sequence. Having defined these recognition codes (i.e. RVD regions), the disclosure provides a general principle for recognizing specific base pairs in a target DNA sequence by selected amino acids in a polypeptide. Distinct types of monomers that are part of a repeat unit array (or polymer) of varying amino acid length have the capacity to recognize one defined/specific base pair. Within each repeat unit forming a repeat domain, a RVD region is responsible for the specific recognition of a base pair in a target DNA sequence.
- the disclosure provides not only a method for selectively recognizing a base pair in a target DNA sequence by a polypeptide comprising at least one repeat domain comprising repeat units, but also methods for generating target DNA sequences that are selectively recognized by repeat domains in a polypeptide.
- These polypeptides are useful as molecular biology tools for cloning, mutagenizing or otherwise altering an isolated nucleic acid sequence or other in vivo sequence.
- the polypeptides and methods of use described herein provide an efficient means of selective mutagenesis.
- the disclosure also provides a method for constructing and/or making a polypeptide that recognizes a specific DNA sequence.
- Polypeptides of the disclosure comprise at least one repeat monomer of the disclosure and can be constructed by a modular approach. This modular approach may include preassembling repeat units in target vectors that,
- DNA constructs of the disclosure may be codon optimized to recombinantly produce and/or secrete recombinant polypeptides of the disclosure.
- Any recombinant system in the art can be used to produce a recombinant protein of the disclosure.
- Exemplary recombinant systems include, but not limited to, baculovirus cells, eukaryotic cells (e.g. mammalian cells), or bacterial cells.
- compositions and methods of the disclosure may be used to construct of a modular series of repeat units, including specific recognition amino acid sequences, and assemble these repeat units into a polypeptide in the appropriate order to enable recognition of and specific binding to the desired target DNA sequence.
- Any polypeptide can be modified by combination with a modular repeat unit DNA-binding domain of the disclosure.
- Such examples include polypeptides that are transcription activator and repressor proteins, resistance-mediating proteins, nucleases, topoisomerases, ligases, integrases, recombinases, resolvases, methylases, acetylases, demethylases, deacetylases, and any other polypeptide capable of modifying DNA, RNA, or proteins.
- the modular repeat unit DNA-binding domain of the disclosure may be combined with a cell compartment localization signal (e.g. a nuclear localization signal), to function at any other regulatory regions, including, but not limited to, transcriptional regulatory regions and translational termination regions.
- a cell compartment localization signal e.g. a nuclear localization signal
- Modularly designed repeat units of the disclosure may be combined with an endonuclease domain capable of cleaving DNA when brought into proximity with DNA (for example, as a result of binding by the repeat domain).
- endonucleolytic breaks stimulate the rate of homologous recombination in eukaryotes, including fungi, plants, and animals.
- the ability to simulate homologous recombination at a specific site as a result of a site- specific endonucleolytic break allows the recovery of transformed cells that have integrated a DNA sequence of interest at the specific site, at a much higher frequency than is possible without having made the site-specific break.
- endonucleolytic breaks such as those caused by polypeptides formed from a repeat domain and an endonuclease domain are sometimes repaired by the cellular DNA metabolic machinery in a way that alters the sequence at the site of the break, for instance by causing a short insertion or deletion at the site of the break compared to the unaltered sequence.
- sequence alterations can cause inactivation of the function of a gene or protein, for instance by altering a protein-coding sequence to make a non-functional protein, modifying a splice site so that a gene transcript is not properly cleaved, making a non-functional transcript, and/or changing the promoter sequence of a gene so that it can no longer by appropriately transcribed.
- Breaking DNA using site specific endonucleases can increase the rate of homologous recombination in the region of the breakage.
- the Clo051 endonuclease may be utilized in an effector to induce DNA breaks.
- the Clo051 endonuclease domain functions independently of the DNA binding domain and cuts a double stranded DNA typically as a dimer.
- an effector could be constructed that contains a repeat domain for recognition of a desired target DNA sequence as well as a Clo051 endonuclease domain to induce DNA breakage at or near the target DNA sequence.
- Any other endonuclease domain may be operably-linked with heterologous DNA binding domains to be utilized as an effector.
- the Clo051 endonuclease is one such non- limiting example. Prior to use of a particular endonuclease, if not already present, the recognition site of that endonuclease must be introduced at the desired location to enhance homologous recombination at that site.
- Novel endonucleases may be designed and/or synthesize by, for example, modifying known endonucleases or making chimeric versions of one or more such endonucleases that recognize novel target DNA sequences, thus paving the way for generation of such engineered endonuclease domains to cleave endogenous target DNA sequences of interest (Chevalier et al. (2002) Molecular Cell 10: 895-905; WO2007/060495; WO2009/095793; Fajardo-Sanchez et al. (2008) Nucleic Acids Res. 36:2163-2173, both of which are incorporated by reference in their entireties).
- endonuclease domains may be similarly engineered to render the DNA-binding activity non-functional but preserve the DNA cleaving activity of a known endonuclease to induce DNA breaks similar to those induced by the known endonuclease (for example, similar to those breaks induced by the use of Clo051 described above).
- target DNA sequence recognition would preferably be provided by the repeat domain of the effector but DNA cleavage would be accomplished by the engineered endonuclease domain.
- Effectors of the disclosure may include a repeat domain with specific recognition for a desired specific target sequence.
- the effector specifically binds to an endogenous chromosomal DNA sequence.
- the specific nucleic acid sequence or more preferably specific endogenous chromosomal sequence can be any sequence in a nucleic acid region where it is desired to enhance homologous recombination.
- the nucleic acid region may be a region which contains a gene in which it is desired to introduce a mutation, such as a point mutation or deletion, or a region into which it is desired to introduce a gene conferring a desired phenotype.
- the disclosure provides methods of generating a modified plant in which a desired addition has been introduced. The methods can include obtaining a plant cell that includes an endogenous target DNA sequence into which it is desired to introduce a modification;
- These methods may be applied to generate genetically modified plant and animal cells in vivo, in vitro or ex vivo.
- the target DNA sequence may be artificial or naturally occurring. These methods may be used in any organism (such non-limiting organisms to include animals, humans, fungi, oomycetes bacteria and viruses) using techniques and methods known in the art and utilized for such purposes in such organisms.
- Modularly designed repeat domains of the disclosure may be combined with one or more domains responsible for the modulation or control of the expression of a gene, including, but not limited to, plant genes, animal genes, fungal genes, oomycete genes, viral genes, and/or human genes.
- Methods for modulating gene expression by generating DNA- binding polypeptides containing zinc finger domains have been described (U.S. Pat. Nos. 7,285,416, 7,521,241, 7,361 ,635, 7,273,923, 7,262,054, 7,220,719, 7,070,934, 7,013,219, 6,979,539, 6,933, 113, 6,824,978, each of which is hereby herein incorporated by reference in its entirety).
- Effectors of the Xanthomonus and/or Ralstonia family may be modified to bind to specific target DNA sequences.
- Such polypeptides include, for example, transcription activators or repressor proteins of transcription that are modified by the methods of the disclosure to specifically bind to genetic control regions in a promoter of or other regulatory region for a gene of interest in order to activate, repress or otherwise modulate transcription of the gene.
- Target DNA sequences of the disclosure may be modified to be specifically recognized by a naturally occurring repeat domain or by a modified repeat domain.
- the target DNA sequences for members of the Xanthomonus and/or Ralstonia family may be inserted into promoters to generate novel controllable promoters that can be induced by the corresponding effector.
- Secondary inducible systems may be constructed using a trans-activator and a target gene, wherein the trans -activator is a polypeptide wherein the polypeptide comprises at least a repeat domain comprising repeat units of the present invention that bind to the target gene and induce expression.
- the trans-activator and the target gene may be introduced into one cell line but may also be present in different cell lines and later be introgressed.
- Disease-resistant plants may be generated by inserting the target DNA sequence of a repeat domain containing polypeptide of the present invention in front of a gene that, after expression, leads to a defense reaction of the plant by activating a resistance-mediating gene.
- Custom DNA-binding polypeptides may be constructed by rearranging repeat unit types resulting in the generation of repeat domains with novel target DNA binding specificity. Individual repeat units of the disclosure are nearly identical at the DNA level which precludes classical cloning strategies.
- the compositions and methods of the disclosure provide a quick and inexpensive strategy to assemble custom polypeptides with repeat domains.
- the disclosure provides a two- step assembly method. This method may be used to assemble polypeptides with novel repeat types to study their target DNA recognition and binding specificity.
- DNA sequences may be generated to enable binding by a repeat domain containing polypeptide of the disclosure by introducing base pairs into any DNA region or specific regions of a gene, or into a genetic control element, to specifically target a polypeptide having a repeat domain comprised of repeat units that will bind a modified DNA sequence to facilitate specific recognition and binding to each other.
- Polypeptides of the disclosure may be synthetically manufactured using known amino acid chemistries familiar to one of ordinary skill in organic chemistry synthesis. Such procedures include both solution and solid phase procedures, e.g., using either Boc or Fmoc methodologies.
- the disclosure also provides a method for targeted modulation of gene expression by constructing modular repeat units specific for a target DNA sequence of interest, modifying a polypeptide by the addition of the repeat monomers so as to enable the polypeptide to now recognize the target DNA, introducing or expressing the modified polypeptide in a prokaryotic or eurkaryotic cell so as to enable the modified polypeptide to recognize the target DNA sequence, and modulating the expression of the target gene in the cell as a result of such recognition.
- the disclosure also provides a method for directed modification of a target DNA sequence by the construction of a polypeptide including at least a repeat domain of the present invention that recognizes the target DNA sequence and that the polypeptide also contains a functional domain capable of modifying the target DNA (such as via site specific recombination, restriction or integration of donor target sequences) thereby enabling targeted DNA modifications in complex genomes.
- the disclosure further provides for the production of modified polypeptides including at least a repeat domain comprising repeat units wherein a hypervariable region within each of the repeat units determines selective recognition of a base pair in a target DNA sequence.
- the disclosure provides DNA that encodes for a polypeptide containing a repeat domain as described above.
- the disclosure provides a method for selectively recognizing base pairs in a target DNA sequence by a polypeptide wherein the polypeptide comprises at least a repeat domain comprising repeat units wherein each repeat unit contains a hypervariable region which determines recognition of a base pair in the target DNA sequence wherein consecutive repeat units correspond to consecutive base pairs in the target DNA sequence.
- the disclosure provides a method of modulating expression of a target gene in a cell.
- exemplary cells include, but are not limited to, a plant cell, a human cell, an animal cell, a fungal cell or any other living cell.
- Cells of the disclosure may contain a polypeptide of the disclosure that comprises at least a repeat domain comprising repeat units. Repeat units of the disclosure comprise a hypervariable region. Each repeat unit is responsible for the recognition of 1 base pair in a target DNA sequence.
- Polypeptides of the disclosure are introduced either as DNA encoding for a polypeptide or the polypeptide is introduced per se into the cell by methods described herein.
- polypeptides of the disclosure comprise at least one repeat domain that specifically recognizes and preferably binds to a target DNA sequence of base pairs and modulates the expression of a target gene.
- all repeat units contain a hypervariable region which determines recognition of base pairs in a target DNA sequence.
- Examples of peptide sequences which can be linked to an polypeptide or RTN of the disclosure, for facilitating uptake of effectors into cells include, but are not limited to: an 1 1 amino acid peptide of the tat protein of HIV; a 20 residue peptide sequence which corresponds to amino acids 84 103 of the pl6 protein (see Fahraeus et al. (1996) Current Biology 6:84); the third helix of the 60-amino acid long homeodomain of Antennapedia (Derossi et al. (1994) J. Biol. Chem.
- effectors can be designed to recognize any suitable target site, for regulation of expression of any endogenous gene of choice.
- endogenous genes suitable for regulation include VEGF, CCR5, ER alpha., Her2/Neu, Tat, Rev, HBV C, S, X, and P, LDL-R, PEPCK, CYP7, Fibrinogen, ApoB, Apo E, Apo(a), renin, NF-.kappa.B, I-.kappa.B, TNF-.
- suitable genes to be regulated include, but are not limited to, cytokines, lymphokines, growth factors, mitogenic factors, chemotactic factors, onto-active factors, receptors, potassium channels, G-proteins, signal transduction molecules, disease resistance genes, and other disease-related genes.
- Toxin molecules may be used to transport polypeptides across cell membranes. Often, such molecules are composed of at least two parts (called "binary toxins"): a translocation or binding domain or polypeptide and a separate toxin domain or polypeptide. Typically, the translocation domain or polypeptide binds to a cellular receptor, and then the toxin is transported into the cell.
- Clostridium perfringens iota toxin diphtheria toxin (DT), Pseudomonas exotoxin A (PE), pertussis toxin (PT), Bacillus anthracis toxin, and pertussis adenylate cyclase (CYA) have been used in attempts to deliver peptides to the cell cytosol as internal or amino-terminal fusions (Arora et al.
- Effectors can also be introduced into an animal cell, preferably a mammalian cell, via liposomes and liposome derivatives such as immunoliposomes.
- liposome refers to vesicles comprised of one or more concentrically ordered lipid bilayers, which encapsulate an aqueous phase.
- the aqueous phase typically contains the compound to be delivered to the cell, in this case an effector.
- the liposome fuses with the plasma membrane, thereby releasing the effector into the cytosol.
- the liposome is phagocytosed or taken up by the cell in a transport vesicle. Once in the endosome or phagosome, the liposome either degrades or fuses with the membrane of the transport vesicle and releases its contents.
- the disclosure provides methods of generating a non-human, transgenic animal comprising a germline mutation comprising: introducing a vector comprising a nucleotide sequence encoding one or more of the proteins of the disclosure into a cell of the non-human, transgenic animal.
- Compositions of the disclosure may be administered to an organism locally or systemically.
- the disclosure provides methods of mutagenizing the germ line of a non-human, transgenic animal comprising: introducing a nucleic acid molecule encoding one or more of the proteins of the disclosure into a cell under conditions sufficient to generate a transgenic animal.
- the term “about” or “approximately” means within an acceptable error range for the particular value as determined by one of ordinary skill in the art, which will depend in part on how the value is measured or determined, e.g., the limitations of the measurement system. For example, “about” can mean within 1 or more standard deviations. Alternatively, “about” can mean a range of up to 20%, or up to 10%, or up to 5%, or up to 1% of a given value. Alternatively, particularly with respect to biological systems or processes, the term can mean within an order of magnitude, preferably within 5 -fold, and more preferably within 2-fold, of a value. Where particular values are described in the application and claims, unless otherwise stated the term "about” meaning within an acceptable error range for the particular value should be assumed.
- the disclosure provides isolated or substantially purified polynucleotide or protein compositions.
- An "isolated” or “purified” polynucleotide or protein, or biologically active portion thereof, is substantially or essentially free from components that normally accompany or interact with the polynucleotide or protein as found in its naturally occurring environment.
- an isolated or purified polynucleotide or protein is substantially free of other cellular material or culture medium when produced by recombinant techniques, or substantially free of chemical precursors or other chemicals when chemically synthesized.
- an "isolated" polynucleotide is free of sequences (optimally protein encoding sequences) that naturally flank the polynucleotide (i.e., sequences located at the 5' and 3' ends of the polynucleotide) in the genomic DNA of the organism from which the polynucleotide is derived.
- the isolated polynucleotide can contain less than about 5 kb, 4 kb, 3 kb, 2 kb, 1 kb, 0.5 kb, or 0.1 kb of nucleotide sequence that naturally flank the polynucleotide in genomic DNA of the cell from which the polynucleotide is derived.
- a protein that is substantially free of cellular material includes preparations of protein having less than about 30%, 20%, 10%, 5%, or 1% (by dry weight) of contaminating protein.
- optimally culture medium represents less than about 30%, 20%, 10%, 5%, or 1 % (by dry weight) of chemical precursors or non-protein-of-interest chemicals.
- fragments and variants of the disclosed DNA sequences and proteins encoded by these DNA sequences refers to a portion of the DNA sequence or a portion of the amino acid sequence and hence protein encoded thereby.
- Fragments of a DNA sequence comprising coding sequences may encode protein fragments that retain biological activity of the native protein and hence DNA recognition or binding activity to a target DNA sequence as herein described.
- fragments of a DNA sequence that are useful as hybridization probes generally do not encode proteins that retain biological activity or do not retain promoter activity.
- fragments of a DNA sequence may range from at least about 20 nucleotides, about 50 nucleotides, about 100 nucleotides, and up to the full-length polynucleotide of the invention.
- Nucleic acids or proteins of the disclosure can be constructed by a modular approach including preassembling monomer units and/or repeat units in target vectors that can subsequently be assembled into a final destination vector.
- Polypeptides of the disclosure may comprise repeat monomers of the disclosure and can be constructed by a modular approach by preassembling repeat units in target vectors that can subsequently be assembled into a final destination vector.
- the disclosure provides polypeptide produced by this method as well nucleic acid sequences encoding these polypeptides.
- the disclosure provides host organisms and cells comprising nucleic acid sequences encoding polypeptides produced this modular approach.
- antibody is used in the broadest sense and specifically covers single monoclonal antibodies (including agonist and antagonist antibodies) and antibody compositions with polyepitopic specificity. It is also within the scope hereof to use natural or synthetic analogs, mutants, variants, alleles, homologs and orthologs (herein collectively referred to as "analogs") of the antibodies hereof as defined herein. Thus, according to one embodiment hereof, the term “antibody hereof in its broadest sense also covers such analogs. Generally, in such analogs, one or more amino acid residues may have been replaced, deleted and/or added, compared to the antibodies hereof as defined herein.
- Antibody fragment and all grammatical variants thereof, as used herein are defined as a portion of an intact antibody comprising the antigen binding site or variable region of the intact antibody, wherein the portion is free of the constant heavy chain domains (i.e. CH2, CH3, and CH4, depending on antibody isotype) of the Fc region of the intact antibody.
- constant heavy chain domains i.e. CH2, CH3, and CH4, depending on antibody isotype
- antibody fragments include Fab, Fab', Fab'- SH, F(ab')2, and Fv fragments; diabodies; any antibody fragment that is a polypeptide having a primary structure consisting of one uninterrupted sequence of contiguous amino acid residues (referred to herein as a "single-chain antibody fragment” or “single chain polypeptide"), including without limitation (1) single-chain Fv (scFv) molecules (2) single chain polypeptides containing only one light chain variable domain, or a fragment thereof that contains the three CDRs of the light chain variable domain, without an associated heavy chain moiety and (3) single chain polypeptides containing only one heavy chain variable region, or a fragment thereof containing the three CDRs of the heavy chain variable region, without an associated light chain moiety; and multispecific or multivalent structures formed from antibody fragments.
- single-chain antibody fragment single-chain Fv
- the heavy chain(s) can contain any constant domain sequence (e.g. CHI in the IgG isotype) found in a non-Fc region of an intact antibody, and/or can contain any hinge region sequence found in an intact antibody, and/or can contain a leucine zipper sequence fused to or situated in the hinge region sequence or the constant domain sequence of the heavy chain(s).
- the term further includes single domain antibodies ("sdAB") which generally refers to an antibody fragment having a single monomeric variable antibody domain, (for example, from camelids). Such antibody fragment types will be readily understood by a person having ordinary skill in the art.
- Binding refers to a sequence-specific, non-covalent interaction between macromolecules (e.g., between a protein and a nucleic acid). Not all components of a binding interaction need be sequence-specific (e.g., contacts with phosphate residues in a DNA backbone), as long as the interaction as a whole is sequence-specific.
- a "binding protein” is a protein that is able to bind non-covalently to another molecule.
- a binding protein can bind to, for example, a DNA molecule (a DNA-binding protein), an RNA molecule (an RNA-binding protein) and/or a protein molecule (a protein- binding protein).
- a DNA-binding protein a DNA-binding protein
- an RNA-binding protein an RNA-binding protein
- a protein molecule a protein- binding protein
- a binding protein can have more than one type of binding activity. For example, zinc finger proteins have DNA-binding, RNA-binding and protein-binding activity.
- compositions and methods include the recited elements, but do not exclude others.
- Consisting essentially of when used to define compositions and methods shall mean excluding other elements of any essential significance to the combination when used for the intended purpose. Thus, a composition consisting essentially of the elements as defined herein would not exclude trace contaminants or inert carriers.
- Consisting of shall mean excluding more than trace elements of other ingredients and substantial method steps. Embodiments defined by each of these transition terms are within the scope of this invention.
- effector molecule means a molecule, such as a protein or protein domain, oftentimes an enzymatic protein, capable of exerting a localized effect in a cell.
- the effector molecule may take a variety of different forms, including selectively binding to a protein or to DNA, for example, to regulate a biological activity. Effector molecules may have a wide variety of different activities, including, but not limited to nuclease activity, increasing or decreasing enzyme activity, increasing or decreasing gene expression, or affecting cell signaling. Other examples of effector molecules will be readily appreciated by one having ordinary skill in the art.
- epitope tag refers to a short amino acid sequence or peptide enabling a specific interaction with a protein or a ligand.
- epitope refers to an antigenic determinant of a polypeptide.
- An epitope could comprise three amino acids in a spatial conformation, which is unique to the epitope. Generally, an epitope consists of at least 4, 5, 6, or 7 such amino acids, and more usually, consists of at least 8, 9, or 10 such amino acids. Methods of determining the spatial conformation of amino acids are known in the art, and include, for example, x-ray crystallography and two-dimensional nuclear magnetic resonance.
- expression refers to the process by which polynucleotides are transcribed into mRNA and/or the process by which the transcribed mRNA is subsequently being translated into peptides, polypeptides, or proteins. If the polynucleotide is derived from genomic DNA, expression may include splicing of the mRNA in a eukaryotic cell.
- Gene expression refers to the conversion of the information, contained in a gene, into a gene product.
- a gene product can be the direct transcriptional product of a gene (e.g., mRNA, tRNA, rRNA, antisense RNA, ribozyme, shRNA, micro RNA, structural RNA or any other type of RNA) or a protein produced by translation of a mRNA.
- Gene products also include RNAs which are modified, by processes such as capping, polyadenylation, methylation, and editing, and proteins modified by, for example, methylation, acetylation, phosphorylation, ubiquitination, ADP-ribosylation, myristilation, and glycosylation.
- Modulation or “regulation” of gene expression refers to a change in the activity of a gene. Modulation of expression can include, but is not limited to, gene activation and gene repression.
- operatively linked or its equivalents (e.g., “linked operatively") means two or more molecules are positioned with respect to each other such that they are capable of interacting to affect a function attributable to one or both molecules or a combination thereof.
- Non-covalently linked components and methods of making and using non- covalently linked components are disclosed.
- the various components may take a variety of different forms as described herein.
- non-covalently linked (i.e., operatively linked) proteins may be used to allow temporary interactions that avoid one or more problems in the art.
- the ability of non-covalently linked components, such as proteins, to associate and dissociate enables a functional association only or primarily under
- the linkage may be of duration sufficient to allow the desired effect.
- a method for directing proteins to a specific locus in a genome of an organism is disclosed.
- the method may comprise the steps of providing a DNA localization component and providing an effector molecule, wherein the DNA localization component and the effector molecule are capable of operatively linking via a non-covalent linkage.
- scFv refers to a single-chain variable fragment.
- scFv is a fusion protein of the variable regions of the heavy (VH) and light chains (VL) of immunoglobulins, connected with a linker peptide.
- the linker peptide may be from about 5 to 40 amino acids or from about 10 to 30 amino acids or about 5, 10, 15, 20, 25, 30, 35, or 40 amino acids in length.
- Single-chain variable fragments lack the constant Fc region found in complete antibody molecules, and, thus, the common binding sites (e.g., Protein G) used to purify antibodies.
- the term further includes a scFv that is an intrabody, an antibody that is stable in the cytoplasm of the cell, and which may bind to an intracellular protein.
- single domain antibody means an antibody fragment having a single monomeric variable antibody domain which is able to bind selectively to a specific antigen.
- a single-domain antibody generally is a peptide chain of about 110 amino acids long, comprising one variable domain (VH) of a heavy-chain antibody, or of a common IgG, which generally have similar affinity to antigens as whole antibodies, but are more heat-resistant and stable towards detergents and high concentrations of urea. Examples are those derived from camelid or fish antibodies.
- single-domain antibodies can be made from common murine or human IgG with four chains.
- the terms “specifically bind” and “specific binding” as used herein refer to the ability of an antibody, an antibody fragment or a nanobody to preferentially bind to a particular antigen that is present in a homogeneous mixture of different antigens. In certain embodiments, a specific binding interaction will discriminate between desirable and undesirable antigens in a sample, in some embodiments more than about ten- to 100-fold or more (e.g., more than about 1000- or 10,000-fold). "Specificity” refers to the ability of an immunoglobulin or an immunoglobulin fragment, such as a nanobody, to bind preferentially to one antigenic target versus a different antigenic target and does not necessarily imply high affinity.
- a "target site” or “target sequence” is a nucleic acid sequence that defines a portion of a nucleic acid to which a binding molecule will bind, provided sufficient conditions for binding exist.
- nucleic acid or “oligonucleotide” or “polynucleotide” refer to at least two nucleotides covalently linked together.
- the depiction of a single strand also defines the sequence of the complementary strand.
- a nucleic acid may also encompass the complementary strand of a depicted single strand.
- a nucleic acid of the disclosure also encompasses substantially identical nucleic acids and complements thereof that retain the same structure or encode for the same protein.
- Probes of the disclosure may comprise a single stranded nucleic acid that can hybridize to a target sequence under stringent hybridization conditions.
- nucleic acids of the disclosure may refer to a probe that hybridizes under stringent hybridization conditions.
- Nucleic acids of the disclosure may be single- or double-stranded. Nucleic acids of the disclosure may contain double-stranded sequences even when the majority of the molecule is single-stranded. Nucleic acids of the disclosure may contain single-stranded sequences even when the majority of the molecule is double-stranded. Nucleic acids of the disclosure may include genomic DNA, cDNA, RNA, or a hybrid thereof. Nucleic acids of the disclosure may contain combinations of deoxyribo- and ribo-nucleotides.
- Nucleic acids of the disclosure may contain combinations of bases including uracil, adenine, thymine, cytosine, guanine, inosine, xanthine hypoxanthine, isocytosine and isoguanine. Nucleic acids of the disclosure may be synthesized to comprise non-natural amino acid modifications. Nucleic acids of the disclosure may be obtained by chemical synthesis methods or by recombinant methods.
- Nucleic acids of the disclosure may be non-naturally occurring. Nucleic acids of the disclosure may contain one or more mutations, substitutions, deletions, or insertions that do not naturally-occur, rendering the entire nucleic acid sequence non-naturally occurring. Nucleic acids of the disclosure may contain one or more duplicated, inverted or repeated sequences, the resultant sequence of which does not naturally-occur, rendering the entire nucleic acid sequence non-naturally occurring. Nucleic acids of the disclosure may contain modified, artificial, or synthetic nucleotides that do not naturally-occur, rendering the entire nucleic acid sequence non- naturally occurring.
- nucleotide sequences may encode any particular protein. All such nucleotides sequences are contemplated herein.
- operably linked refers to the expression of a gene that is under the control of a promoter with which it is spatially connected.
- a promoter can be positioned 5' (upstream) or 3' (downstream) of a gene under its control.
- the distance between a promoter and a gene can be approximately the same as the distance between that promoter and the gene it controls in the gene from which the promoter is derived. Variation in the distance between a promoter and a gene can be accommodated without loss of promoter function.
- promoter refers to a synthetic or naturally-derived molecule which is capable of conferring, activating or enhancing expression of a nucleic acid in a cell.
- a promoter can comprise one or more specific transcriptional regulatory sequences to further enhance expression and/or to alter the spatial expression and/or temporal expression of same.
- a promoter can also comprise distal enhancer or repressor elements, which can be located as much as several thousand base pairs from the start site of transcription.
- a promoter can be derived from sources including viral, bacterial, fungal, plants, insects, and animals.
- a promoter can regulate the expression of a gene component constitutively or differentially with respect to cell, the tissue or organ in which expression occurs or, with respect to the developmental stage at which expression occurs, or in response to external stimuli such as physiological stresses, pathogens, metal ions, or inducing agents.
- promoters include the bacteriophage T7 promoter, bacteriophage T3 promoter, SP6 promoter, lac operator-promoter, tac promoter, SV40 late promoter, SV40 early promoter, RSV-LTR promoter, CMV IE promoter, SV40 early promoter or SV40 late promoter and the CMV IE promoter.
- the term "substantially complementary” refers to a first sequence that is at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98% or 99% identical to the complement of a second sequence over a region of 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 180, 270, 360, 450, 540, or more nucleotides or amino acids, or that the two sequences hybridize under stringent hybridization conditions.
- the term "substantially identical” refers to a first and second sequence are at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98% or 99% identical over a region of 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 180, 270, 360, 450, 540 or more nucleotides or amino acids, or with respect to nucleic acids, if the first sequence is substantially complementary to the complement of the second sequence.
- nucleic acid refers to (i) a portion or fragment of a referenced nucleotide sequence; (ii) the complement of a referenced nucleotide sequence or portion thereof; (iii) a nucleic acid that is substantially identical to a referenced nucleic acid or the complement thereof; or (iv) a nucleic acid that hybridizes under stringent conditions to the referenced nucleic acid, complement thereof, or a sequences substantially identical thereto.
- vector refers to a nucleic acid sequence containing an origin of replication.
- a vector can be a viral vector, bacteriophage, bacterial artificial chromosome or yeast artificial chromosome.
- a vector can be a DNA or RNA vector.
- a vector can be a self-replicating extrachromosomal vector, and preferably, is a DNA plasmid.
- variant when used to describe a peptide or polypeptide, refers to a peptide or polypeptide that differs in amino acid sequence by the insertion, deletion, or conservative substitution of amino acids, but retain at least one biological activity. Variant can also mean a protein with an amino acid sequence that is substantially identical to a referenced protein with an amino acid sequence that retains at least one biological activity.
- a conservative substitution of an amino acid i.e., replacing an amino acid with a different amino acid of similar properties (e.g., hydrophilicity, degree and distribution of charged regions) is recognized in the art as typically involving a minor change. These minor changes can be identified, in part, by considering the hydropathic index of amino acids, as understood in the art. Kyte et al, J. Mol. Biol. 157: 105-132 (1982). The hydropathic index of an amino acid is based on a consideration of its hydrophobicity and charge. Amino acids of similar hydropathic indexes can be substituted and still retain protein function. In one aspect, amino acids having hydropathic indexes of ⁇ 2 are substituted.
- hydrophilicity of amino acids can also be used to reveal substitutions that would result in proteins retaining biological function.
- a consideration of the hydrophilicity of amino acids in the context of a peptide permits calculation of the greatest local average hydrophilicity of that peptide, a useful measure that has been reported to correlate well with antigenicity and
- Substitution of amino acids having similar hydrophilicity values can result in peptides retaining biological activity, for example immunogenicity. Substitutions can be performed with amino acids having hydrophilicity values within ⁇ 2 of each other. Both the hyrophobicity index and the hydrophilicity value of amino acids are influenced by the particular side chain of that amino acid. Consistent with that observation, amino acid substitutions that are compatible with biological function are understood to depend on the relative similarity of the amino acids, and particularly the side chains of those amino acids, as revealed by the hydrophobicity, hydrophilicity, charge, size, and other properties.
- fusion polypeptides and/or nucleic acids encoding such fusion polypeptides include conservative substitutions have been introduced by modification of polynucleotides encoding polypeptides of the invention. Amino acids can be classified according to physical properties and contribution to secondary and tertiary protein structure. A conservative substitution is a substitution of one amino acid for another amino acid that has similar properties. Exemplary conservative substitutions are set out in
- conservative amino acids can be grouped as described in Lehninger, (Biochemistry, Second Edition; Worth Publishers, Inc. NY, N.Y. (1975), pp. 71-77) as set forth in Table B.
- polypeptides of the disclosure are intended to include polypeptides bearing one or more insertions, deletions, or substitutions, or any combination thereof, of amino acid residues as well as modifications other than insertions, deletions, or substitutions of amino acid residues.
- Polypeptides or nucleic acids of the disclosure may contain one or more conservative substitution.
- the term "more than one" of the aforementioned amino acid substitutions refers to 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 , 12, 13, 14, 15, 16, 17, 18, 19, or 20 or more of the recited amino acid substitutions.
- the term "more than one" may refer to 2, 3, 4, or 5 of the recited amino acid substitutions.
- Polypeptides and proteins of the disclosure may be non-naturally occurring.
- Polypeptides and proteins of the disclosure may contain one or more mutations, substitutions, deletions, or insertions that do not naturally-occur, rendering the entire amino acid sequence non-naturally occurring.
- Polypeptides and proteins of the disclosure may contain one or more duplicated, inverted or repeated sequences, the resultant sequence of which does not naturally-occur, rendering the entire amino acid sequence non-naturally occurring.
- Polypeptides and proteins of the disclosure may contain modified, artificial, or synthetic amino acids that do not naturally- occur, rendering the entire amino acid sequence non-naturally occurring.
- sequence identity may be determined by using the stand-alone executable BLAST engine program for blasting two sequences (bl2seq), which can be retrieved from the National Center for Biotechnology Information (NCBI) ftp site, using the default parameters (Tatusova and Madden, FEMS Microbiol Lett., 1999, 174, 247-250; which is incorporated herein by reference in its entirety).
- NCBI National Center for Biotechnology Information
- identity when used in the context of two or more nucleic acids or polypeptide sequences, refer to a specified percentage of residues that are the same over a specified region of each of the sequences.
- the percentage can be calculated by optimally aligning the two sequences, comparing the two sequences over the specified region, determining the number of positions at which the identical residue occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the specified region, and multiplying the result by 100 to yield the percentage of sequence identity.
- the residues of single sequence are included in the denominator but not the numerator of the calculation.
- Identity can be performed manually or by using a computer sequence algorithm such as BLAST or BLAST 2.0.
- endogenous refers to nucleic acid or protein sequence naturally associated with a target gene or a host cell into which it is introduced.
- exogenous refers to nucleic acid or protein sequence not naturally associated with a target gene or a host cell into which it is introduced, including non-naturally occurring multiple copies of a naturally occurring nucleic acid, e.g., DNA sequence, or naturally occurring nucleic acid sequence located in a non- naturally occurring genome location.
- the disclosure provides methods of introducing a polynucleotide construct comprising a DNA sequence into a host cell.
- introducing is intended presenting to the plant the polynucleotide construct in such a manner that the construct gains access to the interior of the host cell.
- the methods of the invention do not depend on a particular method for introducing a polynucleotide construct into a host cell, only that the polynucleotide construct gains access to the interior of one cell of the host.
- Methods for introducing polynucleotide constructs into bacteria, plants, fungi and animals are known in the art including, but not limited to, stable transformation methods, transient transformation methods, and virus-mediated methods.
- stable transformation is intended that the polynucleotide construct introduced into a plant integrates into the genome of the host and is capable of being inherited by progeny thereof.
- transient transformation is intended that a polynucleotide construct introduced into the host does not integrate into the genome of the host.
- the term "genetically modified plant (or transgenic plant)” refers to a plant which comprises within its genome an exogenous polynucleotide.
- the exogenous polynucleotide is stably integrated into the genome such that the polynucleotide is passed on to successive generations.
- the exogenous polynucleotide may be integrated into the genome alone or as part of a recombinant expression cassette.
- Transgenic is used herein to include any cell, cell line, callus, tissue, plant part or plant, the genotype of which has been altered by the presence of exogenous nucleic acid including those trans genies initially so altered as well as those created by sexual crosses or asexual propagation from the initial transgenic.
- the term "transgenic” as used herein does not encompass the alteration of the genome (chromosomal or extra-chromosomal) by conventional plant breeding methods or by naturally occurring events such as random cross-fertilization, non-recombinant viral infection, non-recombinant bacterial transformation, non-recombinant transposition, or spontaneous mutation.
- the term "modifying" is intended to mean that the sequence is considered modified simply by the binding of the polypeptide. It is not intended to suggest that the sequence of nucleotides is changed, although such changes (and others) could ensue following binding of the polypeptide to the nucleic acid of interest.
- the nucleic acid sequence is DNA. Modification of the nucleic acid of interest (in the sense of binding thereto by a polypeptide modified to contain modular repeat units) could be detected in any of a number of methods (e.g. gel mobility shift assays, use of labelled polypeptides—labels could include radioactive, fluorescent, enzyme or
- biotin/streptavidin labels Modification of the nucleic acid sequence of interest (and detection thereof) may be all that is required (e.g. in diagnosis of disease). Desirably, however, further processing of the sample is performed. Conveniently the polypeptide (and nucleic acid sequences specifically bound thereto) is separated from the rest of the sample.
- the polypeptide-DNA complex is bound to a solid phase support, to facilitate such separation.
- the polypeptide may be present in an acrylamide or agarose gel matrix or, more preferably, is immobilized on the surface of a membrane or in the wells of a microtitre plate.
- Every maximum numerical limitation given throughout this disclosure includes every lower numerical limitation, as if such lower numerical limitations were expressly written herein. Every minimum numerical limitation given throughout this disclosure will include every higher numerical limitation, as if such higher numerical limitations were expressly written herein. Every numerical range given throughout this disclosure will include every narrower numerical range that falls within such broader numerical range, as if such narrower numerical ranges were all expressly written herein.
- RTALs Ralstonia TALs
- Nucleic acid sequences that encode the polypeptides of the claimed invention are made through molecular biology techniques known to those with ordinary skill in the art. DNA sequences, for instance, are synthesized with the Xbal and/or Sail restriction sites flanking each nucleic acid sequence that encodes the polyproteins of the present invention. Polymerase chain reaction is performed to amplify the DNA with certain restriction endonuclease sites. Sequences are gel-purified, isolated, and reconstituted in water or suitable buffer for ligation reactions.
- a plasmid that encodes a protein with effector function (such as nuclease function) that comprises requisite regulatory elements is ligated to one or more of the nucleic acid sequences that encode the following sequences at the plasmid multiple cloning sites:
- Plasmid sequences are transformed in suitable bacteria for production of high copy numbers of plasmid. Plasmids containing at least one polypeptide above can be selected using antibiotic selection, isolated and purified from bacterial cells using techniques known to those skilled in the art.
- Plasmids are built and in-vitro testing of expressed DNA-binding polypeptides is validated using the methods described in Nature Biotechnology 2012 May;30(5):460-5.
- TALE repeat arrays were constructed using the same architecture first described by Miller, J.C. et al. ("A TALE nuclease architecture for efficient genome editing.” , Nat Biotechnol. 2011 ; 29: 143-148; the contents of which are herein incorporated by reference) in which distinct TALE repeat backbones that differ slightly in their amino acid and DNA sequences occur in a repeated pattern.
- the first, amino-terminal TALE repeat in an array was designated as the a unit.
- This a unit is followed by ⁇ , Y, and ⁇ units and then an ⁇ unit that is essentially identical to the a unit, except for the different positioning of a Type IIS restriction site on the 5' end (required to enable creation of a unique overhang on the a unit needed for cloning).
- the ⁇ unit is then followed again by repeats of ⁇ , Y, ⁇ and ⁇ units. Due to constraints related to creation of a 3 'end required for cloning, slightly modified DNA sequences were required for TALE repeat arrays that end with a carboxyterminal /or ⁇ unit.
- TALE repeat-encoding DNA fragments for FLASH assembly 20 rounds of PCR are performed with each a unit plasmid as a template using primers oJS2581(5'- Biotin-TCTAGAGAAGACAAGAACCTGACC-3') (SEQ ID NO: 44) and oJS2582(5'- GGATCCGGTCTCTTAAGGCCGTGG-3') (SEQ ID NO: 45).
- the resulting PCR products are biotinylated on the 5' end.
- PCR product is then digested with 40 units of Bsal-HF restriction enzyme to generate 4bp overhangs, purified using the QIAquick PCR purification kit (QIAGEN) according to manufacturer's instructions except that the final product will be eluted in 50 ⁇ of 0.1X EB.
- QIAGEN QIAquick PCR purification kit
- Beads are then drawn to the side of the well by placing the plate on the magnet and then washed with 100 ⁇ B&W buffer with 0.005% Tween 20 (Sigma) and again with 100 ⁇ 0.1 mg/ml bovine serum albumin (BSA) (New England Biolabs). Additional ySs fragments are ligated by removing the plate from the magnet, resuspending the beads in solution in each well, digesting the bead-bound fragment with Bsal-HF restriction enzyme, placing the plate on the magnet, washing with 100 ⁇ B&W/Tween20 followed by ⁇ of 0.1 mg/ml BSA, and then ligating the next fragment. This process is repeated multiple times with additional ⁇ units to extend the bead-bound fragment.
- BSA bovine serum albumin
- the last fragment to be ligated is always a ⁇ , ⁇ *, ⁇ , or ⁇ * unit to enable cloning of the full-length fragment into expression vectors (note that fragments that end with a ⁇ * unit will always be preceded by ligation of a ⁇ / unit).
- the final full-length bead-bound fragment is digested with 40 units of Bsal-HF restriction enzyme followed by 25 units of Bbsl restriction enzyme (New England Biolabs). Digestion with Bbsl released the fragment from the beads and generates a unique 5' overhang for cloning of the fragment. Digestion with Bsal-HF results in creation of a unique 3' overhang for cloning.
- DNA fragments encoding our FLASH assembled TALE repeat arrays are subcloned into TALE expression vectors.
- TALE expression vectors include a CMV promoter, a translational start codon optimized for mammalian cell expression, a triple FLAG epitope tag, a nuclear localization signal, amino acids 153 to 288 from the TALE 13 protein (as numbered by Miller, J.C. et al. ⁇ Nat Biotechnol.
- Type IIS BsmBI restriction sites two unique and closely positioned Type IIS BsmBI restriction sites, a 0.5 TALE repeat domain encoding RVDs, amino acids 715 to 777 from the TALE 13 protein, and the wild- type Fokl cleavage domain.
- TALEN expression vector for subcloning, 5 ⁇ g of plasmid DNA is digested with 50 units of BsmBI restriction enzyme (New England Biolabs) in NEBuffer 3 for 8 hours at 55 degrees C. Digested DNA will be purified using 90 ⁇ of Ampure XP beads (Agencourt) according to manufacturer's instructions and diluted to a final concentration of Sng/ ⁇ in 1 mM TrisHCl. FLASH-assembled TALE repeat arrays are ligated into TALEN expression vectors using 400 U of T4 DNA Ligase (New England Biolabs). Ligation products are transformed into chemically competent XL-1 Blue cells.
- BsmBI restriction enzyme New England Biolabs
- oSQT3 anneals at the 3' end of the TALE repeat array coding sequence and enables sequencing of the carboxy -terminal half of the assembled array
- oJS2980 primes within the coding sequence of the Fokl domain (downstream of oSQT3) and enables sequencing and verification of the carboxy -terminal 0.5 TALE repeat domain.
- EGFP reporter assays are performed in a clonal U20S human cell line bearing an integrated construct that constitutively expresses an EGFP-PEST fusion protein.
- This clonal line is derived from a polyclonal U20S EGFP-PEST reporter line.
- Clonal U20S EGFP- PEST cells are cultured in Advanced DMEM (Life Technologies) supplemented with 10% FBS, 2 mM GlutaMax (Life Technologies), penicillin/streptomycin, and 400 ⁇ g/ml G418.
- Cells are transfected in triplicate with 500 ng of each TALEN plasmid DNA and 50 ng ptdTomato-Nl plasmid DNA using a Lonza 4D-Nucleofector System, Solution SE, and program DN-100 according to manufacturer's instructions. 1 ⁇ g of ptdTomato-Nl plasmid alone is transfected in triplicate as a negative control. Cells are assayed for EGFP and tdTomato expression at 2 and 5 days post-transfection using a BD FACSAriall flow cytometer. PCR amplification and sequence verification of endogenous human genes
- Standard PCR conditions with Phusion Hot Start II high-fidelity DNA polymerase are performed according to manufacturer's instructions for 35 cycles (98°C, 10 s denaturation; 68°C, 15 s annealing; 72°C, 30 s extension).
- U20S-EGFP cells are cultured and transfected in duplicate as described above.
- Genomic DNA is isolated from cells transfected with TALEN-encoding or control plasmids using a high-throughput magnetic-bead based purification system (Agencourt DNAdvance) according to the manufacturer's instructions.
- PCR to amplify endogenous loci are performed for 35 cycles as described above and fragments were purified with Ampure XP (Agencourt) according to manufacturer's instructions.
- 200 ng of purified PCR product are denatured and reannealed in NEBuffer 2 (New England Biolabs) using a thermocycler with the following protocol (95°C, 5 min; 95-85°C at -2°C/s; 85-25°C at -0.1°C/s; hold at
- Hybridized PCR products were treated with 10 U of T7 Endonuclease I at 37°C for 15 minutes in a reaction volume of 20 ⁇ . Reactions are stopped by the addition of 2 ⁇ 0.5 M EDTA, purified with Ampure XP, and quantified on a QIAxcel capillary electrophoresis system using method OM500. The sum of the area beneath TALEN-specific cleavage peaks (expressed as a percentage of the parent amplicon peak, denoted fraction cleaved) is used to estimate gene modification levels using the following equation as previously described.
- these cloned fragments are used to generate chimeric proteins of six repeat units fused to Fokl nuclease, i.e. a chimeric protein that targets a string of A (C, T and G) nucleotides. These chimeric proteins are then tested for binding/targeting efficiency to desired DNA bases using a reporter construct.
- This library can then be used to generate Ralstonia TALENs following the exact protocol of the FLASH TALEN system.
- a pair of Bmpr2 specific EBEs (Ralstonia DNA binding domain, 16EBEs each) are gene synthesized and cloned into XTN-BB (Xanthomonas TAL backbone fused to Fokl). These constructs are co-transfected into Rat C6 cells and gDNA extracted after 48hrs for Cell surveyor nuclease assay. A successful assay should produce 240bp and 150bp subpopulations from the original 400bp amplicon of the locus. The results are shown in the Figures 2.
- the assay reveals the expected 250bp and 150bp bands in the Ralstonia and Xanthomonas TALEN transfected cells, which are absent in the WT negative control. This indicates that the Ralstonia EBEs target this locus and the fusion of Fokl nuclease to Ralstonia EBEs lead to targeted digestion of genomic DNA.
- Using the 250bp band 5.75% for XTN, 1.82% for RTN.
- Using the 150bp band 3.66% for XTN, 5.43% for RTN.
- the first and the last nucleotide of the targeted site are not specified by the RTNs. These are specified by the Xanthomonas TALEN backbone.
- a library of Ralstonia EBEs and backbone vectors were made which could be used to assemble full length Ralstonia DNA binding domains into Ralstonia or Xanthomonas TALEN backbones, utilizing the golden gate assembly method.
- the RTNs were co- transfected into the Rat C6 cell line and gDNA extracted for analysis 48hrs post transfection.
- a 420bp gDNA fragment containing the RTN binding site was amplified by PCR. This amplicon was then subjected to the Cell assay using Surveyor Mutation Detection Kit (Transgenomic) as per manufacturer protocol. In brief, the amplicon is denatured into single stranded DNA and slowly re-annealed back to double stranded DNA.
- heteroduplexes and cleaves them, which generated two shorter fragments from (255bp and 165bp) the original amplicon (420bp).
- pRVD plasmid containing a single Ralstonia EBE. Individual EBEs were gene synthesized and cloned in FLASH-XTN sub-array backbone (Xbal, BamHI).
- pFus X a sub-array plasmid that holds the first 10 EBEs of any given RTN. The required piece was gene synthesized and cloned into pHSG-298 (Sacl, Sbfl).
- pFUS Z a sub-array plasmid that holds EBE 11 up to the second-last EBE of any given RTN.
- XTN-bb Xanthomonas TAL backbone that contains the N-terminal and C-terminal Xanthomonas TAL domains fused to Fokl nuclease. This backbone specifies a T nucleotide 5' of the target sequence specified by the EBEs. It also contains the last half EBE that specifies the last nucleotide of the targeted sequence. Therefore there are four XTN-bb plasmids, each specifying a different final nucleotide of the targeted sequence (same as FLASH XTN backbones).
- Assembly of a custom TALEN or TAL effector construct involves two steps: (i) assembly of repeat modules (pRVDs) into sub-arrays of 1-10 repeats and (ii) joining of the sub-arrays into a backbone to make the final construct.
- TALEN monomer with a 17 RVD array (5'-TGATAGTCGC- CTTATG-T-3'): Select from the pRVD plasmids those that encode RVDs 1-10 in the array using plasmids numbered in that order. For example, the plasmid for the first RVD would be gRTN-lT, the second gRTN-2G, the third gRTN-3A etc. Modules from these plasmids are cloned into sub-array plasmid pFUS-X. Next, select modules for RVDs 11-16 in the 16 RVD array again starting with plasmids numbered from 1.
- RVD 11 gRTN-lC would be used, for RVD 12 gRTN-2T, etc.
- the pFUS-Z plasmids are numbered 1-10 and should be selected according to the number of EBEs going in. Thus, in our example, pFUS-Z6 should be used.
- the pRVDs and sub-array plasmids (150 ng each) are subjected to digestion and ligation in a single 20 ⁇ reaction containing 1 ⁇ Bsal (10 U, New England BioLabs) and 1 ⁇ T4 DNA Ligase (2000 U, New England BioLabs) in T4 DNA ligase buffer (New England BioLabs).
- the reaction is incubated in a thermocycler for 10 cycles of 5 min at 37°C and 10 min at 16°C, then heated to 50°C for 5 min and then 80°C for 5 min. Then, 1 ⁇ 25mM ATP and 1 ⁇ Plasmid Safe DNase (10 U, Epicentre) are added. The mixture is incubated at 37°C for 1 h, then used to transform Escherichia coli cells. Cells are plated on LB agar containing 50 mg/ml Kanamycin, overnight at 37°C.
- Plasmid DNA was isolated from the pFUS-X and pFUS-Z cultures. Sub-arrays were joined into one of the four backbone plasmids. A 20 ⁇ digestion and ligation reaction mixture is prepared with 150 ng each of the pFUS-X and pFUS-Z plasmids, 150 ng of the backbone plasmid, in this case XTN-bbT, 1 ⁇ Esp3I (10U, Thermo Scientific) and 1 ⁇ T4 DNA Ligase (2000U, New England Biolabs) in T4 DNA ligase buffer. The reaction is then incubated in a thermocycler for 3 cycles of 10 min at 37°C and 15 min at 16°C.
- the reaction is then incubated at 37°C for an additional 30 min and heated to 50°C for 5 min, then 80°C for 5 min. After cooling to room temperature, 1 ⁇ 25mM ATP and 1 ⁇ Plasmid Safe DNase (10U, Epicenter) were added and incubated at 37°C for lhr. The reaction is then used to transform E. coli as above, except that Plasmid Safe. Also, in this step, ampicillin (100 mg/ml) is used in place of Kanamycin for selection of transformants.
- Phage display is used to identify a scFv antibody against a FLAG affinity tag that provides an optimal linkage.
- a large diversity in scFv affinity is obtained by limiting the stringency of the affinity selection process. This diversity may represent a key advantage of a PhD approach for identifying a successful linkage between a FLAG affinity tag and a scFv with affinity for the FLAG tag.
- a single-chain variable fragment (scFv) antibody with a faster off-rate may provide permissive "breathing" of a scFv-FLAG complex.
- a near-exhaustive search among scFv antibodies allows one to select from among a large diversity of possible conformations of scFv-FLAG affinity tag complexes.
- a PhD strategy may create such diversity through the generation of unique monovalent scFvs against the FLAG epitope.
- a non-covalent linkage method such as that achieved through the use of a scFv antibody employs a protein fused to a scFv that provides a reversible association between a FLAG affinity tag and the scFv, which may circumvent any permanent interference with the target protein that may occur when it is subjected to covalent linkage.
- An antibody library is produced from immunized rabbits as is well known in the art.
- Six New Zealand White rabbits are immunized each with 200 pg of a FLAG affinity tag peptide sequence plus adjuvant, and serum is collected six weeks after immunization for determining antibody titers.
- Titers are determined by ELISAs on immobilized FLAG affinity tag and the animals with the highest titers (at least 1 : 1000) are sacrificed for isolating the spleen and bone marrow. If rabbits do not produce sufficient titers, a naive library from embryonic rabbit tissue is used. This provides an unbiased collection of un-rearranged heavy and light chain genes.
- Total RNA is extracted from tissues using Trizol (Invitrogen), and cDNA synthesis is performed with the iScript cDNA synthesis kit (BioRad).
- the pComb3H plasmid expresses the scFv-plll fusion at a level such that about one or two molecules are integrated with wild-type pill (which is provided by helper phage). Since up to 1012 phage particles can be generated in a single preparation, a very large number of scFvs can thus be screened.
- the scFv coding sequence is always linked to the phage particle displaying the protein, so subsequent DNA sub-cloning is conveniently achieved.
- Ligated plasmid DNA (50 to 100 ng) is electroporated into ER2538 E. coli (New England Biolabs). E. coli will then be recovered by shaking for 1 hour at 37°C in 5 mLs of SOC. Phage is produced with the VCSM13 helper phage, which has a defective origin of replication. Phage particles will be precipitated with PEG-8000 and then isolated by further centrifugation. This phage prep is the primary library, and will be affinity selected by "panning.” Double recognition panning is performed in which the phage elution is re- incubated with the immobilized antigen, washed, and eluted again. This helps eliminate nonspecific phage.
- phage pools are assayed by ELISAs for affinity to the PB antigen.
- PB or BSA are coated to 96-well plates, incubated with phage, and then incubated with a horseradish peroxidase (HRP) conjugated anti-M13 antibody, which recognizes the Ml 3 phage coat protein.
- HRP horseradish peroxidase
- Phagemid DNA is isolated from bacteria after the 2nd (R2) and 3rd (R3) rounds of panning by infecting E. coli with each phage pool, selecting with carbenicillin, followed by standard plasmid preparation. Plasmid DNA is digested with Sfil to liberate the scFv coding sequence, and ligated upstream of the E2c coding sequence within the pLVX-IRES- ZsGreenl (Clontech) vector. The E2c coding sequence also has a short linker sequence (GGSSRSS) (SEQ ID NO: 247) and creates a fusion of the scFv library to the N-terminal portion of E2c. The two ensuing plasmid libraries (R2 and R3) will then be prepared as in Aim 2, for production of two lenti virus libraries.
- GGSSRSS short linker sequence
- Lentivirus library production For production of lentivirus particles, the Lenti-X HT Packaging System (Clontech) is used, which produces viral titers as high as 5x10 s infectious units per mL. Virus is produced according to the manufacturer's specifications. Viral supematants are titered on HepG2 and Huh7 cells, followed by FACS fluorescence produced by the ZsGreenl reporter to count transduced cells.
- scFvs that are stable in the cytoplasm may be identified by forming a fusion protein between the scFv and EGFP and expressing in a surrogate mammalian cell line.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Genetics & Genomics (AREA)
- Chemical & Material Sciences (AREA)
- Engineering & Computer Science (AREA)
- Organic Chemistry (AREA)
- Wood Science & Technology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Zoology (AREA)
- Molecular Biology (AREA)
- Biomedical Technology (AREA)
- Biotechnology (AREA)
- General Engineering & Computer Science (AREA)
- General Health & Medical Sciences (AREA)
- Biochemistry (AREA)
- Microbiology (AREA)
- Medicinal Chemistry (AREA)
- Biophysics (AREA)
- Plant Pathology (AREA)
- Physics & Mathematics (AREA)
- Crystallography & Structural Chemistry (AREA)
- Mycology (AREA)
- Cell Biology (AREA)
- Pharmacology & Pharmacy (AREA)
- Epidemiology (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Peptides Or Proteins (AREA)
- Enzymes And Modification Thereof (AREA)
- Breeding Of Plants And Reproduction By Means Of Culturing (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
Priority Applications (12)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CA2989827A CA2989827C (en) | 2015-06-17 | 2016-06-16 | Compositions and methods for directing proteins to specific loci in the genome |
| EP16733813.6A EP3310909B1 (en) | 2015-06-17 | 2016-06-16 | Compositions and methods for directing proteins to specific loci in the genome |
| CN201680047154.3A CN108026519A (zh) | 2015-06-17 | 2016-06-16 | 将蛋白质定向至基因组中的特定基因座的组合物和方法 |
| EP21177979.8A EP3929286A1 (en) | 2015-06-17 | 2016-06-16 | Compositions and methods for directing proteins to specific loci in the genome |
| US15/580,675 US11473082B2 (en) | 2015-06-17 | 2016-06-16 | Compositions and methods for directing proteins to specific loci in the genome |
| DK16733813.6T DK3310909T3 (da) | 2015-06-17 | 2016-06-16 | Sammensætninger og fremgangsmåder til at føre proteiner til specifikke loci i genomet |
| KR1020187001436A KR102637402B1 (ko) | 2015-06-17 | 2016-06-16 | 게놈 내 특정 유전자좌에 단백질을 유도하기 위한 조성물 및 방법 |
| JP2018517674A JP2018521689A (ja) | 2015-06-17 | 2016-06-16 | タンパク質をゲノム内の特定の遺伝子座に導くための組成物および方法 |
| ES16733813T ES2886599T3 (es) | 2015-06-17 | 2016-06-16 | Composiciones y métodos para dirigir proteínas a loci específicos en el genoma |
| AU2016278226A AU2016278226B2 (en) | 2015-06-17 | 2016-06-16 | Compositions and methods for directing proteins to specific loci in the genome |
| AU2021250992A AU2021250992B2 (en) | 2015-06-17 | 2021-10-18 | Compositions and methods for directing proteins to specific loci in the genome |
| US17/822,240 US20230257737A1 (en) | 2015-06-17 | 2022-08-25 | Compositions and methods for directing proteins to specific loci in the genome |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201562181162P | 2015-06-17 | 2015-06-17 | |
| US62/181,162 | 2015-06-17 |
Related Child Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US15/580,675 A-371-Of-International US11473082B2 (en) | 2015-06-17 | 2016-06-16 | Compositions and methods for directing proteins to specific loci in the genome |
| US17/822,240 Continuation US20230257737A1 (en) | 2015-06-17 | 2022-08-25 | Compositions and methods for directing proteins to specific loci in the genome |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2016205554A1 true WO2016205554A1 (en) | 2016-12-22 |
Family
ID=56292934
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2016/037922 Ceased WO2016205554A1 (en) | 2015-06-17 | 2016-06-16 | Compositions and methods for directing proteins to specific loci in the genome |
Country Status (11)
| Country | Link |
|---|---|
| US (2) | US11473082B2 (https=) |
| EP (2) | EP3929286A1 (https=) |
| JP (3) | JP2018521689A (https=) |
| KR (1) | KR102637402B1 (https=) |
| CN (1) | CN108026519A (https=) |
| AU (2) | AU2016278226B2 (https=) |
| CA (1) | CA2989827C (https=) |
| DK (1) | DK3310909T3 (https=) |
| ES (1) | ES2886599T3 (https=) |
| PT (1) | PT3310909T (https=) |
| WO (1) | WO2016205554A1 (https=) |
Cited By (20)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US9982279B1 (en) | 2017-06-23 | 2018-05-29 | Inscripta, Inc. | Nucleic acid-guided nucleases |
| US10011849B1 (en) | 2017-06-23 | 2018-07-03 | Inscripta, Inc. | Nucleic acid-guided nucleases |
| US10329543B2 (en) | 2017-10-23 | 2019-06-25 | Poseida Therapeutics, Inc. | Modified stem cell memory T cells, methods of making and methods of using same |
| WO2019126578A1 (en) * | 2017-12-20 | 2019-06-27 | Poseida Therapeutics, Inc. | Compositions and methods for directing proteins to specific loci in the genome |
| WO2019135816A3 (en) * | 2017-10-23 | 2019-09-12 | The Broad Institute, Inc. | Novel nucleic acid modifiers |
| US10415016B2 (en) | 2016-09-30 | 2019-09-17 | Poseida Therapeutics, Inc. | Modified stem cell memory T cells, methods of making and methods of using same |
| KR20200021529A (ko) * | 2017-07-11 | 2020-02-28 | 시그마-알드리치 컴퍼니., 엘엘씨 | 표적된 게놈 변형을 개선하기 위한 뉴클레오솜 상호작용 단백질 도메인 사용 |
| WO2020077360A1 (en) | 2018-10-12 | 2020-04-16 | Poseida Therapeutics, Inc. | Hematopoietic stem cell compositions, methods of making and method of use |
| KR20230035467A (ko) * | 2016-09-30 | 2023-03-13 | 포세이다 테라퓨틱스, 인크. | 변형된 줄기세포 기억 t 세포, 이의 제조 방법 및 사용 방법 |
| EP3954699A4 (en) * | 2019-04-09 | 2023-05-10 | Japan Science and Technology Agency | Nucleic acid binding protein |
| WO2023164573A1 (en) * | 2022-02-23 | 2023-08-31 | Poseida Therapeutics, Inc. | Genetically modified cells and methods of use thereof |
| US11744861B2 (en) | 2017-03-13 | 2023-09-05 | Poseida Therapeutics, Inc. | Compositions and methods for selective elimination and replacement of hematopoietic stem cells |
| WO2024084025A1 (en) | 2022-10-21 | 2024-04-25 | Keygene N.V. | Rna transfection in plant cells with modified rna |
| WO2024121354A1 (en) | 2022-12-08 | 2024-06-13 | Keygene N.V. | Duplex sequencing with covalently closed dna ends |
| WO2024178069A1 (en) * | 2023-02-21 | 2024-08-29 | Poseida Therapeutics, Inc. | Compositions and methods for genome editing |
| WO2024178055A1 (en) * | 2023-02-21 | 2024-08-29 | Poseida Therapeutics, Inc. | Compositions and methods for genome editing |
| WO2024209000A1 (en) | 2023-04-04 | 2024-10-10 | Keygene N.V. | Linkers for duplex sequencing |
| WO2025096980A1 (en) * | 2023-11-02 | 2025-05-08 | Poseida Therapeutics, Inc. | Compositions targeting klkb1 and methods of use thereof |
| WO2025221789A1 (en) | 2024-04-16 | 2025-10-23 | Poseida Therapeutics, Inc. | Compositions and methods for use in car/tcr cell therapies |
| WO2026080393A1 (en) | 2024-10-07 | 2026-04-16 | Poseida Therapeutics, Inc. | Compositions and methods for use in car cell therapies |
Families Citing this family (33)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CA2891510C (en) | 2012-11-16 | 2022-10-18 | Transposagen Biopharmaceuticals, Inc. | Site-specific enzymes and methods of use |
| EP3201340B1 (en) | 2014-10-01 | 2020-12-02 | The General Hospital Corporation | Methods for increasing efficiency of nuclease-induced homology-directed repair |
| JP7275043B2 (ja) | 2016-12-16 | 2023-05-17 | ビー-モーゲン・バイオテクノロジーズ,インコーポレーテッド | 増大したhATファミリートランスポゾン媒介遺伝子導入ならびに関連する組成物、システムおよび方法 |
| US11278570B2 (en) | 2016-12-16 | 2022-03-22 | B-Mogen Biotechnologies, Inc. | Enhanced hAT family transposon-mediated gene transfer and associated compositions, systems, and methods |
| CA3104288A1 (en) | 2018-06-21 | 2019-12-26 | B-Mogen Biotechnologies, Inc. | Enhanced hat family transposon-mediated gene transfer and associated compositions, systems, and methods |
| CN110938658B (zh) * | 2018-09-21 | 2023-02-07 | 中国科学院分子细胞科学卓越创新中心 | 一种抗体进化方法及其应用 |
| CA3124103A1 (en) | 2018-12-20 | 2020-06-25 | Poseida Therapeutics, Inc. | Nanotransposon compositions and methods of use |
| WO2020160481A1 (en) * | 2019-02-01 | 2020-08-06 | The General Hospital Corporation | Targetable 3'-overhang nuclease fusion proteins |
| WO2020252455A1 (en) | 2019-06-13 | 2020-12-17 | The General Hospital Corporation | Engineered human-endogenous virus-like particles and methods of use thereof for delivery to cells |
| US20220372105A1 (en) | 2019-09-05 | 2022-11-24 | Poseida Therapeutics, Inc. | Allogeneic cell compositions and methods of use |
| AU2020407235A1 (en) | 2019-12-20 | 2022-07-07 | Poseida Therapeutics, Inc. | Anti-MUC1 compositions and methods of use |
| WO2021183795A1 (en) | 2020-03-11 | 2021-09-16 | Poseida Therapeutics, Inc. | Chimeric stimulatory receptors and methods of use in t cell activation and differentiation |
| CA3189601A1 (en) | 2020-07-24 | 2022-01-27 | The General Hospital Corporation | Enhanced virus-like particles and methods of use thereof for delivery to cells |
| US20240000969A1 (en) | 2020-10-21 | 2024-01-04 | Poseida Therapeutics San Diego | Compositions and methods for delivery of nucleic acids |
| WO2022087354A1 (en) * | 2020-10-23 | 2022-04-28 | Altius Institute For Biomedical Sciences | Cell permeable proteins for genome engineering |
| CN112750498B (zh) * | 2020-12-30 | 2022-06-24 | 同济大学 | 靶向逆转录引物结合位点从而抑制hiv病毒复制的方法 |
| EP4298205A1 (en) | 2021-02-23 | 2024-01-03 | Poseida Therapeutics, Inc. | Genetically modified induced pluripotent stem cells and methods of use thereof |
| EP4297728A1 (en) | 2021-02-23 | 2024-01-03 | Poseida Therapeutics, Inc. | Compositions and methods for delivery of nucleic acids |
| WO2023039488A1 (en) | 2021-09-09 | 2023-03-16 | Iovance Biotherapeutics, Inc. | Processes for generating til products using pd-1 talen knockdown |
| EP4413141A1 (en) | 2021-10-04 | 2024-08-14 | Poseida Therapeutics, Inc. | Transposon compositions and methods of use thereof |
| US20250099383A1 (en) | 2022-01-21 | 2025-03-27 | Poseida Therapeutics, Inc. | Compositions and methods for delivery of nucleic acids |
| WO2023209649A1 (en) * | 2022-04-29 | 2023-11-02 | Seqirus, Inc. | Method of dna linearization |
| US20250388883A1 (en) * | 2022-06-30 | 2025-12-25 | Demeetra Agbio, Inc. | Gene editing compositions and methods of use thereof |
| JP2025539816A (ja) | 2022-11-21 | 2025-12-09 | アイオバンス バイオセラピューティクス,インコーポレイテッド | 腫瘍浸潤リンパ球の増幅のための2次元プロセス及びそれからの治療法 |
| JP2025539712A (ja) | 2022-11-21 | 2025-12-09 | アイオバンス バイオセラピューティクス,インコーポレイテッド | 遺伝子編集されたt細胞の増殖能を評価するための方法 |
| WO2024118836A1 (en) | 2022-11-30 | 2024-06-06 | Iovance Biotherapeutics, Inc. | Processes for production of tumor infiltrating lymphocytes with shortened rep step |
| WO2024155931A1 (en) | 2023-01-20 | 2024-07-25 | Poseida Therapeutics, Inc. | Lipidoid compounds and related compositions and uses |
| KR20250162510A (ko) | 2023-01-20 | 2025-11-18 | 포세이다 테라퓨틱스, 인크. | 리피도이드 화합물 및 관련 조성물 및 용도 |
| CN121335979A (zh) | 2023-05-17 | 2026-01-13 | 波西达治疗公司 | 靶向hbg1和hbg2的组合物及其使用方法 |
| WO2025049925A2 (en) | 2023-09-01 | 2025-03-06 | Poseida Therapeutics, Inc. | Lipidoid compounds and related compositions and uses |
| WO2025160432A1 (en) | 2024-01-26 | 2025-07-31 | Poseida Therapeutics, Inc. | Methods and compositions for enhancing in vivo persistence and potency of cell therapy |
| WO2025171237A1 (en) | 2024-02-08 | 2025-08-14 | Poseida Therapeutics, Inc. | Lipidoid compounds and related compositions and uses |
| WO2026030277A1 (en) | 2024-08-01 | 2026-02-05 | Amgen Inc. | Method for reducing protease activities |
Citations (38)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4554101A (en) | 1981-01-09 | 1985-11-19 | New York Blood Center, Inc. | Identification and preparation of epitopes on antigens and allergens on the basis of hydrophilicity |
| US5240846A (en) | 1989-08-22 | 1993-08-31 | The Regents Of The University Of Michigan | Gene therapy vector for cystic fibrosis |
| US5380831A (en) | 1986-04-04 | 1995-01-10 | Mycogen Plant Science, Inc. | Synthetic insecticidal crystal protein gene |
| US5399346A (en) | 1989-06-14 | 1995-03-21 | The United States Of America As Represented By The Department Of Health And Human Services | Gene therapy |
| US5436391A (en) | 1991-11-29 | 1995-07-25 | Mitsubishi Corporation | Synthetic insecticidal gene, plants of the genus oryza transformed with the gene, and production thereof |
| US5436146A (en) | 1989-09-07 | 1995-07-25 | The Trustees Of Princeton University | Helper-free stocks of recombinant adeno-associated virus vectors |
| US5529774A (en) | 1991-08-13 | 1996-06-25 | The Regents Of The University Of California | In vivo transfer of the HSV-TK gene implanted retroviral producer cells |
| US5547932A (en) | 1991-09-30 | 1996-08-20 | Boehringer Ingelheim International Gmbh | Composition for introducing nucleic acid complexes into higher eucaryotic cells |
| US5639642A (en) | 1994-06-16 | 1997-06-17 | Novo Nordisk A/S | Synthetic leader peptide sequences |
| US5645829A (en) | 1993-06-18 | 1997-07-08 | Beth Israel Hospital Association | Mesothelial cell gene therapy |
| US5656465A (en) | 1994-05-04 | 1997-08-12 | Therion Biologics Corporation | Methods of in vivo gene delivery |
| US5670488A (en) | 1992-12-03 | 1997-09-23 | Genzyme Corporation | Adenovirus vector for gene therapy |
| US5672344A (en) | 1987-12-30 | 1997-09-30 | The Regents Of The University Of Michigan | Viral-mediated gene transfer system |
| US5741486A (en) | 1994-05-24 | 1998-04-21 | Research Corporation Technologies, Inc. | Safe vectors for gene therapy |
| US5817492A (en) | 1994-09-19 | 1998-10-06 | Sumitomo Pharmaceuticals Company, Ltd. | Recombinant DNA viral vector for transfecting animal cells |
| US5830880A (en) | 1994-08-26 | 1998-11-03 | Hoechst Aktiengesellschaft | Gene therapy of tumors with an endothelial cell-specific, cell cycle-dependent active compound |
| US5854019A (en) | 1995-07-12 | 1998-12-29 | Hoechst Aktiengesellschaft | Cell-specific gene therapy using as promoter novel promoters for tissue inhibitors of metalloproteinase-3 |
| US5869040A (en) | 1995-06-07 | 1999-02-09 | Biogen, Inc | Gene therapy methods and compositions |
| US5910488A (en) | 1993-06-07 | 1999-06-08 | Vical Incorporated | Plasmids suitable for gene therapy |
| US5911983A (en) | 1992-06-26 | 1999-06-15 | University Of Pittsburgh | Gene therapy for Gaucher disease using retroviral vectors |
| US5928214A (en) | 1994-12-05 | 1999-07-27 | New York Blood Center, Inc. | High concentration white cells, a method for agglomeration of the high concentration and a bag set for use in conjunction therewith |
| US5928914A (en) | 1996-06-14 | 1999-07-27 | Albert Einstein College Of Medicine Of Yeshiva University, A Division Of Yeshiva University | Methods and compositions for transforming cells |
| CA2246005A1 (en) | 1998-10-01 | 2000-04-01 | Hsc Research And Development Limited Partnership | Hybrid genes for gene therapy in erythroid cells |
| US6824978B1 (en) | 1999-01-12 | 2004-11-30 | Sangamo Biosciences, Inc. | Regulation of endogenous gene expression in cells using zinc finger proteins |
| US7001768B2 (en) | 2000-04-28 | 2006-02-21 | Sangamo Biosciences, Inc. | Targeted modification of chromatin structure |
| US7013219B2 (en) | 1999-01-12 | 2006-03-14 | Sangamo Biosciences, Inc. | Regulation of endogenous gene expression in cells using zinc finger proteins |
| US7070934B2 (en) | 1999-01-12 | 2006-07-04 | Sangamo Biosciences, Inc. | Ligand-controlled regulation of endogenous gene expression |
| WO2007060495A1 (en) | 2005-10-25 | 2007-05-31 | Cellectis | I-crei homing endonuclease variants having novel cleavage specificity and use thereof |
| US7262054B2 (en) | 2002-01-22 | 2007-08-28 | Sangamo Biosciences, Inc. | Zinc finger proteins for DNA binding and gene regulation in plants |
| US7273923B2 (en) | 2001-01-22 | 2007-09-25 | Sangamo Biosciences, Inc. | Zinc finger proteins for DNA binding and gene regulation in plants |
| US7285416B2 (en) | 2000-01-24 | 2007-10-23 | Gendaq Limited | Regulated gene expression in plants |
| US7361635B2 (en) | 2002-08-29 | 2008-04-22 | Sangamo Biosciences, Inc. | Simultaneous modulation of multiple genes |
| WO2009095793A1 (en) | 2008-01-31 | 2009-08-06 | Cellectis | New i-crei derived single-chain meganuclease and uses thereof |
| WO2012093833A2 (en) * | 2011-01-03 | 2012-07-12 | Toolgen Incorporation | Genome engineering via designed tal effector nucleases |
| WO2012168304A1 (en) * | 2011-06-07 | 2012-12-13 | Helmholtz Zentrum München - Deutsches Forschungszentrum für Gesundheit und Umwelt (GmbH) | Protein having nuclease activity, fusion proteins and uses thereof |
| WO2014089290A1 (en) * | 2012-12-06 | 2014-06-12 | Sigma-Aldrich Co. Llc | Crispr-based genome modification and regulation |
| US20150044772A1 (en) * | 2013-08-09 | 2015-02-12 | Sage Labs, Inc. | Crispr/cas system-based novel fusion protein and its applications in genome editing |
| WO2015195798A1 (en) * | 2014-06-17 | 2015-12-23 | Poseida Therapeutics, Inc. | A method for directing proteins to specific loci in the genome and uses thereof |
Family Cites Families (35)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4873192A (en) | 1987-02-17 | 1989-10-10 | The United States Of America As Represented By The Department Of Health And Human Services | Process for site specific mutagenesis without phenotypic selection |
| WO2000002996A2 (en) | 1998-07-10 | 2000-01-20 | Cornell Research Foundation, Inc. | Recombinant constructs and systems for secretion of proteins via type iii secretion systems |
| AU6045900A (en) | 1999-05-25 | 2000-12-12 | Panorama Research, Inc. | Interaction-activated proteins |
| US7700754B1 (en) * | 2001-06-05 | 2010-04-20 | Masahiro Hiraoka | Polypeptide for unstabilizing protein in cells under aerobic conditions and DNA encoding the same |
| US20030138850A1 (en) | 2001-10-18 | 2003-07-24 | Ekkehard Mossner | Selecting for antibody-antigen interactions in bacteria cells by employing a protein fragment complementation assay |
| WO2003080809A2 (en) | 2002-03-21 | 2003-10-02 | Sangamo Biosciences, Inc. | Methods and compositions for using zinc finger endonucleases to enhance homologous recombination |
| GB0226729D0 (en) | 2002-11-15 | 2002-12-24 | Medical Res Council | Intracellular antibodies |
| US8021849B2 (en) | 2004-11-05 | 2011-09-20 | Siemens Healthcare Diagnostics Inc. | Methods and kits for the determination of sirolimus in a sample |
| US20060252140A1 (en) | 2005-04-29 | 2006-11-09 | Yant Stephen R | Development of a transposon system for site-specific DNA integration in mammalian cells |
| US7790379B2 (en) | 2005-05-19 | 2010-09-07 | Universite De Geneve | Mapping of proteins along chromatin by chromatin cleavage |
| JP2007159512A (ja) | 2005-12-15 | 2007-06-28 | Institute Of Physical & Chemical Research | Iis型制限酵素を用いる翻訳終止コドンの除去方法 |
| US20100015661A1 (en) | 2006-04-21 | 2010-01-21 | Mab-Factory Gmbh | Antibody-rnase-conjugate |
| EP2155868A2 (en) | 2007-04-19 | 2010-02-24 | Codon Devices, Inc | Engineered nucleases and their uses for nucleic acid assembly |
| JP2010538659A (ja) | 2007-09-17 | 2010-12-16 | アフォミックス コーポレイション | デュアルベイトレポーターを用いてscFvスクリーニングにおける特異性を増大させる方法 |
| CA2753287A1 (en) | 2009-02-24 | 2010-09-02 | Glaxo Group Limited | Antigen-binding constructs |
| WO2010147686A2 (en) | 2009-03-11 | 2010-12-23 | Wyeth Llc | Methods of purifying small modular immunopharmaceutical proteins |
| US8586526B2 (en) | 2010-05-17 | 2013-11-19 | Sangamo Biosciences, Inc. | DNA-binding proteins and uses thereof |
| US8889394B2 (en) | 2009-09-07 | 2014-11-18 | Empire Technology Development Llc | Multiple domain proteins |
| WO2012092970A1 (en) | 2011-01-06 | 2012-07-12 | Complix Nv | Alphabody libraries and methods for producing the same |
| US9499592B2 (en) | 2011-01-26 | 2016-11-22 | President And Fellows Of Harvard College | Transcription activator-like effectors |
| CA3111953C (en) | 2011-04-05 | 2023-10-24 | Cellectis | Method for the generation of compact tale-nucleases and uses thereof |
| EP2522726A1 (en) | 2011-05-12 | 2012-11-14 | Fundació Privada Centre de Regulació Genòmica (CRG) | Zinc finger nucleases for p53 editing |
| US20140201858A1 (en) | 2011-05-17 | 2014-07-17 | Transposagen Biopharmaceuticals, Inc | Methods for site-specific genetic modification in stem cells using xanthomonas tal nucleases (xtn) for the creation of model organisms |
| WO2012168307A2 (en) | 2011-06-07 | 2012-12-13 | Helmholtz Zentrum München - Deutsches Forschungszentrum für Gesundheit und Umwelt (GmbH) | Improved recombination efficiency by inhibition of nhej dna repair |
| UA115772C2 (uk) | 2011-12-16 | 2017-12-26 | Таргітджин Байотекнолоджиз Лтд | Композиція програмованого нуклеопротеїнового молекулярного комплексу і спосіб модифікування заданої послідовності нуклеїнової кислоти-мішені |
| WO2013152220A2 (en) | 2012-04-04 | 2013-10-10 | Life Technologies Corporation | Tal-effector assembly platform, customized services, kits and assays |
| WO2013177231A1 (en) | 2012-05-21 | 2013-11-28 | Massachusetts Institute Of Technology | Translocation of non-natural chemical entities through anthrax protective antigen pore |
| AU2013266968B2 (en) * | 2012-05-25 | 2017-06-29 | Emmanuelle CHARPENTIER | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US9181535B2 (en) * | 2012-09-24 | 2015-11-10 | The Chinese University Of Hong Kong | Transcription activator-like effector nucleases (TALENs) |
| AU2013336601B2 (en) | 2012-10-26 | 2018-01-25 | Vrije Universiteit Brussel | Vector for liver-directed gene therapy of hemophilia and methods and use thereof |
| CA2891510C (en) | 2012-11-16 | 2022-10-18 | Transposagen Biopharmaceuticals, Inc. | Site-specific enzymes and methods of use |
| WO2014093655A2 (en) | 2012-12-12 | 2014-06-19 | The Broad Institute, Inc. | Engineering and optimization of systems, methods and compositions for sequence manipulation with functional domains |
| EP3115457B1 (en) | 2014-03-05 | 2019-10-02 | National University Corporation Kobe University | Genomic sequence modification method for specifically converting nucleic acid bases of targeted dna sequence, and molecular complex for use in same |
| CA2952618A1 (en) | 2014-06-17 | 2015-12-23 | Poseida Therapeutics, Inc. | Methods and compositions for in vivo non-covalent linking |
| CN104450785A (zh) * | 2014-12-08 | 2015-03-25 | 复旦大学 | 使用编码靶向核酸内切酶附着体载体的基因组编辑方法及试剂盒 |
-
2016
- 2016-06-16 US US15/580,675 patent/US11473082B2/en active Active
- 2016-06-16 DK DK16733813.6T patent/DK3310909T3/da active
- 2016-06-16 ES ES16733813T patent/ES2886599T3/es active Active
- 2016-06-16 WO PCT/US2016/037922 patent/WO2016205554A1/en not_active Ceased
- 2016-06-16 CN CN201680047154.3A patent/CN108026519A/zh active Pending
- 2016-06-16 JP JP2018517674A patent/JP2018521689A/ja not_active Ceased
- 2016-06-16 EP EP21177979.8A patent/EP3929286A1/en active Pending
- 2016-06-16 EP EP16733813.6A patent/EP3310909B1/en active Active
- 2016-06-16 KR KR1020187001436A patent/KR102637402B1/ko active Active
- 2016-06-16 AU AU2016278226A patent/AU2016278226B2/en active Active
- 2016-06-16 CA CA2989827A patent/CA2989827C/en active Active
- 2016-06-16 PT PT167338136T patent/PT3310909T/pt unknown
-
2021
- 2021-05-10 JP JP2021079698A patent/JP7170090B2/ja active Active
- 2021-08-31 JP JP2021141109A patent/JP2021182942A/ja not_active Withdrawn
- 2021-10-18 AU AU2021250992A patent/AU2021250992B2/en active Active
-
2022
- 2022-08-25 US US17/822,240 patent/US20230257737A1/en active Pending
Patent Citations (43)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4554101A (en) | 1981-01-09 | 1985-11-19 | New York Blood Center, Inc. | Identification and preparation of epitopes on antigens and allergens on the basis of hydrophilicity |
| US5380831A (en) | 1986-04-04 | 1995-01-10 | Mycogen Plant Science, Inc. | Synthetic insecticidal crystal protein gene |
| US5672344A (en) | 1987-12-30 | 1997-09-30 | The Regents Of The University Of Michigan | Viral-mediated gene transfer system |
| US5399346A (en) | 1989-06-14 | 1995-03-21 | The United States Of America As Represented By The Department Of Health And Human Services | Gene therapy |
| US5240846A (en) | 1989-08-22 | 1993-08-31 | The Regents Of The University Of Michigan | Gene therapy vector for cystic fibrosis |
| US5436146A (en) | 1989-09-07 | 1995-07-25 | The Trustees Of Princeton University | Helper-free stocks of recombinant adeno-associated virus vectors |
| US5529774A (en) | 1991-08-13 | 1996-06-25 | The Regents Of The University Of California | In vivo transfer of the HSV-TK gene implanted retroviral producer cells |
| US5547932A (en) | 1991-09-30 | 1996-08-20 | Boehringer Ingelheim International Gmbh | Composition for introducing nucleic acid complexes into higher eucaryotic cells |
| US5436391A (en) | 1991-11-29 | 1995-07-25 | Mitsubishi Corporation | Synthetic insecticidal gene, plants of the genus oryza transformed with the gene, and production thereof |
| US5911983A (en) | 1992-06-26 | 1999-06-15 | University Of Pittsburgh | Gene therapy for Gaucher disease using retroviral vectors |
| US5670488A (en) | 1992-12-03 | 1997-09-23 | Genzyme Corporation | Adenovirus vector for gene therapy |
| US5910488A (en) | 1993-06-07 | 1999-06-08 | Vical Incorporated | Plasmids suitable for gene therapy |
| US5645829A (en) | 1993-06-18 | 1997-07-08 | Beth Israel Hospital Association | Mesothelial cell gene therapy |
| US5656465A (en) | 1994-05-04 | 1997-08-12 | Therion Biologics Corporation | Methods of in vivo gene delivery |
| US5741486A (en) | 1994-05-24 | 1998-04-21 | Research Corporation Technologies, Inc. | Safe vectors for gene therapy |
| US5639642A (en) | 1994-06-16 | 1997-06-17 | Novo Nordisk A/S | Synthetic leader peptide sequences |
| US7521241B2 (en) | 1994-08-20 | 2009-04-21 | Gendaq Limited | Regulated gene expression in plants |
| US5830880A (en) | 1994-08-26 | 1998-11-03 | Hoechst Aktiengesellschaft | Gene therapy of tumors with an endothelial cell-specific, cell cycle-dependent active compound |
| US5817492A (en) | 1994-09-19 | 1998-10-06 | Sumitomo Pharmaceuticals Company, Ltd. | Recombinant DNA viral vector for transfecting animal cells |
| US5928214A (en) | 1994-12-05 | 1999-07-27 | New York Blood Center, Inc. | High concentration white cells, a method for agglomeration of the high concentration and a bag set for use in conjunction therewith |
| US5869040A (en) | 1995-06-07 | 1999-02-09 | Biogen, Inc | Gene therapy methods and compositions |
| US5854019A (en) | 1995-07-12 | 1998-12-29 | Hoechst Aktiengesellschaft | Cell-specific gene therapy using as promoter novel promoters for tissue inhibitors of metalloproteinase-3 |
| US5928914A (en) | 1996-06-14 | 1999-07-27 | Albert Einstein College Of Medicine Of Yeshiva University, A Division Of Yeshiva University | Methods and compositions for transforming cells |
| CA2246005A1 (en) | 1998-10-01 | 2000-04-01 | Hsc Research And Development Limited Partnership | Hybrid genes for gene therapy in erythroid cells |
| US7220719B2 (en) | 1999-01-12 | 2007-05-22 | Sangamo Biosciences, Inc. | Modulation of endogenous gene expression in cells |
| US6979539B2 (en) | 1999-01-12 | 2005-12-27 | Sangamo Biosciences, Inc. | Regulation of endogenous gene expression in cells using zinc finger proteins |
| US7013219B2 (en) | 1999-01-12 | 2006-03-14 | Sangamo Biosciences, Inc. | Regulation of endogenous gene expression in cells using zinc finger proteins |
| US7070934B2 (en) | 1999-01-12 | 2006-07-04 | Sangamo Biosciences, Inc. | Ligand-controlled regulation of endogenous gene expression |
| US7163824B2 (en) | 1999-01-12 | 2007-01-16 | Sangamo Biosciences, Inc. | Regulation of endogenous gene expression in cells using zinc finger proteins |
| US6933113B2 (en) | 1999-01-12 | 2005-08-23 | Sangamo Biosciences, Inc. | Modulation of endogenous gene expression in cells |
| US6824978B1 (en) | 1999-01-12 | 2004-11-30 | Sangamo Biosciences, Inc. | Regulation of endogenous gene expression in cells using zinc finger proteins |
| US7285416B2 (en) | 2000-01-24 | 2007-10-23 | Gendaq Limited | Regulated gene expression in plants |
| US7001768B2 (en) | 2000-04-28 | 2006-02-21 | Sangamo Biosciences, Inc. | Targeted modification of chromatin structure |
| US7273923B2 (en) | 2001-01-22 | 2007-09-25 | Sangamo Biosciences, Inc. | Zinc finger proteins for DNA binding and gene regulation in plants |
| US7262054B2 (en) | 2002-01-22 | 2007-08-28 | Sangamo Biosciences, Inc. | Zinc finger proteins for DNA binding and gene regulation in plants |
| US7361635B2 (en) | 2002-08-29 | 2008-04-22 | Sangamo Biosciences, Inc. | Simultaneous modulation of multiple genes |
| WO2007060495A1 (en) | 2005-10-25 | 2007-05-31 | Cellectis | I-crei homing endonuclease variants having novel cleavage specificity and use thereof |
| WO2009095793A1 (en) | 2008-01-31 | 2009-08-06 | Cellectis | New i-crei derived single-chain meganuclease and uses thereof |
| WO2012093833A2 (en) * | 2011-01-03 | 2012-07-12 | Toolgen Incorporation | Genome engineering via designed tal effector nucleases |
| WO2012168304A1 (en) * | 2011-06-07 | 2012-12-13 | Helmholtz Zentrum München - Deutsches Forschungszentrum für Gesundheit und Umwelt (GmbH) | Protein having nuclease activity, fusion proteins and uses thereof |
| WO2014089290A1 (en) * | 2012-12-06 | 2014-06-12 | Sigma-Aldrich Co. Llc | Crispr-based genome modification and regulation |
| US20150044772A1 (en) * | 2013-08-09 | 2015-02-12 | Sage Labs, Inc. | Crispr/cas system-based novel fusion protein and its applications in genome editing |
| WO2015195798A1 (en) * | 2014-06-17 | 2015-12-23 | Poseida Therapeutics, Inc. | A method for directing proteins to specific loci in the genome and uses thereof |
Non-Patent Citations (100)
| Title |
|---|
| "Medical Professional's Guide to Unrelated Donor Stem Cell Transplants" |
| "Remington's Pharmaceutical Sciences", MACK PUBLISHING COMPANY |
| AN, G. ET AL., PLANT PYSIOL., vol. 81, 1986, pages 301 - 305 |
| ARORA ET AL., J. BIOL. CHEM, vol. 268, 1993, pages 3334 3341 |
| ASANO ET AL., PLANT CELL REP., 1994, pages 13 |
| AYERES N. M.; PARK, W. D., CRIT REV. PLANT. SCI., vol. 13, 1994, pages 219 - 239 |
| BAIM ET AL., PROC. NATL. ACAD. SCI. USA, vol. 88, 1991, pages 5072 - 5076 |
| BALLAS ET AL., NUCLEIC ACIDS RES., vol. 17, 1989, pages 7891 - 7903 |
| BARCELO ET AL., PLANT. J., vol. 5, 1994, pages 583 - 592 |
| BARKLEY ET AL., THE OPERON, 1980, pages 177 - 220 |
| BECKER ET AL., PLANT. J., vol. 5, 1994, pages 299 - 307 |
| BIBIKOVA ET AL., SCIENCE, vol. 300, 2003, pages 764 |
| BLOCK, M., THEOR. APPL GENET, vol. 76, 1988, pages 767 - 774 |
| BOLTE ET AL., J. CELL SCIENCE, vol. 117, 2004, pages 943 - 54 |
| BONIN, PH.D. THESIS, 1993 |
| BORKOWSKA ET AL., ACTA. PHYSIOL PLANT., vol. 16, 1994, pages 225 - 230 |
| BROWN ET AL., CELL, vol. 49, 1987, pages 603 - 612 |
| CAMPBELL; GOWN, PLANT PHYSIOL., vol. 92, 1990, pages 1 - 11 |
| CARBONETTI ET AL., ABSTR. ANNU. MEET. AM. SOC. MICROBIOL., vol. 95, 1995, pages 295 |
| CASAS ET AL., PROC. NAT ACAD SCI. USA, vol. 90, 1993, pages 11212 - 11216 |
| CHEE, P. P.; SLIGHTOM, J. L., GENE, vol. 118, 1992, pages 255 - 260 |
| CHEVALIER ET AL., MOLECULAR CELL, vol. 10, 2002, pages 895 - 905 |
| CHRISTOPHERSON ET AL., PROC. NATL. ACAD. SCI. USA, vol. 89, 1992, pages 6314 - 6318 |
| CHRISTOU ET AL., TRENDS. BIOTECHNOL., vol. 10, 1992, pages 239 - 246 |
| CHRISTOU, P., AGRO. FOOD. IND. HI TECH, vol. 5, 1994, pages 17 - 27 |
| CHRISTOU, P., IN VITRO CELL. DEV. BIOL.-PLANT, vol. 29P, 1993, pages 119 - 124 |
| COUSINS ET AL., AUST. J. PLANT PHYSIOL., vol. 18, 1991, pages 481 - 494 |
| DAVIES ET AL., PLANT CELL REP, vol. 12, 1993, pages 180 - 183 |
| DEGENKOLB ET AL., ANTIMICROB. AGENTS CHEMOTHER., vol. 35, 1991, pages 1591 - 1595 |
| DELLA-CIOPPA ET AL., PLANT PHYSIOL., vol. 84, 1987, pages 965 - 968 |
| DEROSSI ET AL., J. BIOL. CHEM, vol. 269, 1994, pages 10444 |
| DEUSCHLE ET AL., PROC. NATL. ACAD. ACI. USA, vol. 86, 1989, pages 5400 - 5404 |
| DEUSCHLE ET AL., SCIENCE, vol. 248, 1990, pages 480 - 483 |
| D'HALLUIN ET AL., BIO/TECHNOL., vol. 10, 1992, pages 309 - 314 |
| DHIR ET AL., PLANT PHYSIOL., vol. 99, 1992, pages 81 - 88 |
| DONG, J. A.; MCHUGHEN, A., PLANT SCI., vol. 91, 1993, pages 139 - 148 |
| DONNELLY ET AL., PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 3530 3534 |
| EAPEN ET AL., PLANT CELL REP, vol. 13, 1994, pages 582 - 586 |
| ELLIOT; O'HARE, CELL, vol. 88, 1997, pages 223 233 |
| ELROY-STEIN ET AL., PROC. NATL. ACAD. SCI. USA, vol. 86, 1989, pages 6126 - 6130 |
| FAHRAEUS ET AL., CURRENT BIOLOGY, vol. 6, 1996, pages 84 |
| FAJARDO-SANCHEZ ET AL., NUCLEIC ACIDS RES., vol. 36, 2008, pages 2163 - 2173 |
| FETTER ET AL., PLANT CELL, vol. 16, 2004, pages 215 - 28 |
| FIGGE ET AL., CELL, vol. 52, 1988, pages 713 - 722 |
| FRANKLIN, C. I.; TRIEU, T. N., PLANT. PHYSIOL., vol. 102, 1993, pages 167 |
| FRY, J. ET AL., PLANT CELL REP., vol. 6, 1987, pages 321 - 325 |
| FUERST ET AL., PROC. NATL. ACAD. SCI. USA, vol. 86, 1989, pages 2549 - 2553 |
| GALLIE ET AL., GENE, vol. 165, no. 2, 1995, pages 233 - 238 |
| GALLIE ET AL.: "Molecular Biology of RNA", 1989, LISS, pages: 237 - 256 |
| GILL ET AL., NATURE, vol. 334, 1988, pages 721 - 724 |
| GOLOVKIN ET AL., PLANT SCI., vol. 90, 1993, pages 41 - 52 |
| GOSSEN ET AL., PROC. NATL. ACAD. SCI. USA, vol. 89, 1992, pages 5547 - 5551 |
| GOSSEN, PH.D. THESIS, 1993 |
| GUERINEAU ET AL., MOL. GEN. GENET, vol. 262, 1991, pages 141 - 144 |
| GUO, CHIN SCI. BULL., vol. 38, pages 2072 - 2078 |
| HARTMAN ET AL., BIO-TECHNOLOGY, vol. 12, 1994, pages 919923 |
| HILLENAND-WISSMAN, TOPICS MOL. STRUC. BIOL, vol. 10, 1989, pages 143 - 162 |
| HINCHEE ET AL., STADLER. GENET. SYMP., vol. 203212, 1990, pages 203 - 212 |
| HU ET AL., CELL, vol. 48, 1987, pages 555 - 566 |
| JOSHI ET AL., NUCLEIC ACIDS RES., vol. 15, 1987, pages 9627 - 9639 |
| KATO ET AL., PLANT PHYSIOL, vol. 129, 2002, pages 913 - 42 |
| KLEINSCHNIDT ET AL., BIOCHEMISTRY, vol. 27, 1988, pages 1094 - 1104 |
| KLIMPEL ET AL., PROC. NATL. ACAD. SCI. USA, vol. 89, pages 10277 10281 |
| KULINSKI ET AL.: "The CEL I Enzymatic Mutation Detection Assay", BIOTECHNIQUES, vol. 29, no. 1, July 2000 (2000-07-01), pages 44 - 48, XP001026330 |
| KYTE ET AL., J. MOL. BIOL., vol. 157, 1982, pages 105 - 132 |
| L. CONG ET AL: "RNA-Guided Human Genome Engineering via Cas9", SCIENCE, vol. 339, no. 6121, 3 January 2013 (2013-01-03), US, pages 823 - 826, XP055248658, ISSN: 0036-8075, DOI: 10.1126/science.1231143 * |
| LABOW ET AL., MOL. CELL. BIOL., vol. 10, 1990, pages 3343 - 3356 |
| LEAVKA ET AL.: "Handbook of Experimental Pharmacology", vol. 78, 1985, SPRINGER-VERLAG |
| LEHNINGER: "Biochemistry", 1975, WORTH PUBLISHERS, INC., pages: 71 - 77 |
| LOMMEL ET AL., VIROLOGY, vol. 81, 1991, pages 382 - 385 |
| LUKE A. GILBERT ET AL: "CRISPR-Mediated Modular RNA-Guided Regulation of Transcription in Eukaryotes", CELL, vol. 154, no. 2, 1 July 2013 (2013-07-01), pages 442 - S5, XP055167546, ISSN: 0092-8674, DOI: 10.1016/j.cell.2013.06.044 * |
| MACEJAK ET AL., NATURE, vol. 353, 1991, pages 90 - 94 |
| MANIATIS ET AL.: "Molecular Cloning - A Laboratory Manual", 1989, COLD SPRING HARBOR PRESS |
| MILLER, J.C. ET AL., NAT BIOTECHNOL., vol. 29, 2011, pages 143 - 148 |
| MILLER, J.C. ET AL.: "A TALE nuclease architecture for efficient genome editing", NAT BIOTECHNOL., vol. 29, 2011, pages 143 - 148 |
| MOGEN ET AL., PLANT CELL, vol. 2, 1990, pages 1261 - 1272 |
| MUNROE ET AL., GENE, vol. 91, 1990, pages 151 - 158 |
| MURRAY ET AL., NUCLEIC ACIDS RES., vol. 17, 1989, pages 477 - 498 |
| NOVAK ET AL., J. BIOL. CHEM., vol. 267, 1992, pages 17186 17193 |
| OLIVA ET AL., ANTIMICROB. AGENTS CHEMOTHER., vol. 36, 1992, pages 913 - 919 |
| PERELLE ET AL., INFECT. IMMUN, vol. 61, 1993, pages 5147 5156 |
| PROUDFOOT, CELL, vol. 64, 1991, pages 671 - 674 |
| REINES ET AL., PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 1917 - 1921 |
| REYON D; TSAI SQ; KHAYTER C; FODEN JA; SANDER JD; JOUNG JK: "FLASH assembly of TALENs for high-throughput genome editing", NATURE BIOTECHNOLOGY, vol. 30, no. 5, May 2012 (2012-05-01), pages 460 - 5, XP055171172, DOI: doi:10.1038/nbt.2170 |
| REZNIKOFF, MOL. MICROBIOL, vol. 6, 1992, pages 2419 - 2422 |
| RITALA ET AL., PLANT. MOL. BIOL, vol. 24, 1994, pages 317 - 325 |
| SANFACON ET AL., GENES DEV., vol. 5, 1991, pages 141 - 149 |
| SEBO ET AL., INFECT. IMMUN., vol. 63, 1995, pages 3851 3857 |
| STENMARK ET AL., J. CELL BIOL., vol. 113, 1991, pages 1025 1032 |
| SU ET AL., BIOTECHNOL BIOENG, vol. 85, 2004, pages 610 - 9 |
| TABLING ET AL., NATURE, vol. 325, 1987, pages 622 - 625 |
| TATUSOVA; MADDEN, FEMS MICROBIOL LETT, vol. 174, 1999, pages 247 - 250 |
| UMOV ET AL., NATURE, vol. 435, 2005, pages 646 |
| VIROLOGY, vol. 154, pages 9 - 20 |
| WAN, Y. C.; LEMAUX, P. G., PLANT PHYSIOL., vol. 104, 1994, pages 3748 |
| WRIGHT ET AL., THE PLANT JOURNAL, vol. 44, 2005, pages 693 - 705 |
| WYBORSKI ET AL., NUCLEIC ACIDS RES., vol. 19, 1991, pages 4647 - 4653 |
| YAO ET AL., CELL, vol. 71, 1992, pages 63 - 72 |
| YARRANTON, CURR. OPIN. BIOTECH, vol. 3, 1992, pages 506 - 511 |
| ZAMBRETTI ET AL., PROC. NATL ACAD. SCI. USA, vol. 89, 1992, pages 3952 - 3956 |
Cited By (35)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US10415016B2 (en) | 2016-09-30 | 2019-09-17 | Poseida Therapeutics, Inc. | Modified stem cell memory T cells, methods of making and methods of using same |
| KR102757155B1 (ko) * | 2016-09-30 | 2025-01-21 | 포세이다 테라퓨틱스, 인크. | 변형된 줄기세포 기억 t 세포, 이의 제조 방법 및 사용 방법 |
| US11802269B2 (en) | 2016-09-30 | 2023-10-31 | Poseida Therapeutics, Inc. | Superpiggybac transposase compositions |
| KR20230035467A (ko) * | 2016-09-30 | 2023-03-13 | 포세이다 테라퓨틱스, 인크. | 변형된 줄기세포 기억 t 세포, 이의 제조 방법 및 사용 방법 |
| US10513686B2 (en) | 2016-09-30 | 2019-12-24 | Poseida Therapeutics, Inc. | Modified stem cell memory T cells, methods of making and methods of using same |
| US11744861B2 (en) | 2017-03-13 | 2023-09-05 | Poseida Therapeutics, Inc. | Compositions and methods for selective elimination and replacement of hematopoietic stem cells |
| US11697826B2 (en) | 2017-06-23 | 2023-07-11 | Inscripta, Inc. | Nucleic acid-guided nucleases |
| US10435714B2 (en) | 2017-06-23 | 2019-10-08 | Inscripta, Inc. | Nucleic acid-guided nucleases |
| US10011849B1 (en) | 2017-06-23 | 2018-07-03 | Inscripta, Inc. | Nucleic acid-guided nucleases |
| US12195749B2 (en) | 2017-06-23 | 2025-01-14 | Inscripta, Inc. | Nucleic acid-guided nucleases |
| US12180502B2 (en) | 2017-06-23 | 2024-12-31 | Inscripta, Inc. | Nucleic acid-guided nucleases |
| US10626416B2 (en) | 2017-06-23 | 2020-04-21 | Inscripta, Inc. | Nucleic acid-guided nucleases |
| US10337028B2 (en) | 2017-06-23 | 2019-07-02 | Inscripta, Inc. | Nucleic acid-guided nucleases |
| US9982279B1 (en) | 2017-06-23 | 2018-05-29 | Inscripta, Inc. | Nucleic acid-guided nucleases |
| KR20230053732A (ko) * | 2017-07-11 | 2023-04-21 | 시그마-알드리치 컴퍼니., 엘엘씨 | 표적된 게놈 변형을 개선하기 위한 뉴클레오솜 상호작용 단백질 도메인 사용 |
| US12221606B2 (en) | 2017-07-11 | 2025-02-11 | Sigma-Aldrich Co. Llc | Using nucleosome interacting protein domains to enhance targeted genome modification |
| KR102523217B1 (ko) * | 2017-07-11 | 2023-04-20 | 시그마-알드리치 컴퍼니., 엘엘씨 | 표적된 게놈 변형을 개선하기 위한 뉴클레오솜 상호작용 단백질 도메인 사용 |
| KR20200021529A (ko) * | 2017-07-11 | 2020-02-28 | 시그마-알드리치 컴퍼니., 엘엘씨 | 표적된 게놈 변형을 개선하기 위한 뉴클레오솜 상호작용 단백질 도메인 사용 |
| US12065642B2 (en) | 2017-07-11 | 2024-08-20 | Sigma-Aldrich Co. Llc | Using nucleosome interacting protein domains to enhance targeted genome modification |
| KR102655021B1 (ko) | 2017-07-11 | 2024-04-04 | 시그마-알드리치 컴퍼니., 엘엘씨 | 표적된 게놈 변형을 개선하기 위한 뉴클레오솜 상호작용 단백질 도메인 사용 |
| US10329543B2 (en) | 2017-10-23 | 2019-06-25 | Poseida Therapeutics, Inc. | Modified stem cell memory T cells, methods of making and methods of using same |
| US12227742B2 (en) | 2017-10-23 | 2025-02-18 | The Broad Institute, Inc. | Nucleic acid modifiers |
| WO2019135816A3 (en) * | 2017-10-23 | 2019-09-12 | The Broad Institute, Inc. | Novel nucleic acid modifiers |
| WO2019126578A1 (en) * | 2017-12-20 | 2019-06-27 | Poseida Therapeutics, Inc. | Compositions and methods for directing proteins to specific loci in the genome |
| WO2020077360A1 (en) | 2018-10-12 | 2020-04-16 | Poseida Therapeutics, Inc. | Hematopoietic stem cell compositions, methods of making and method of use |
| EP3954699A4 (en) * | 2019-04-09 | 2023-05-10 | Japan Science and Technology Agency | Nucleic acid binding protein |
| WO2023164573A1 (en) * | 2022-02-23 | 2023-08-31 | Poseida Therapeutics, Inc. | Genetically modified cells and methods of use thereof |
| WO2024084025A1 (en) | 2022-10-21 | 2024-04-25 | Keygene N.V. | Rna transfection in plant cells with modified rna |
| WO2024121354A1 (en) | 2022-12-08 | 2024-06-13 | Keygene N.V. | Duplex sequencing with covalently closed dna ends |
| WO2024178069A1 (en) * | 2023-02-21 | 2024-08-29 | Poseida Therapeutics, Inc. | Compositions and methods for genome editing |
| WO2024178055A1 (en) * | 2023-02-21 | 2024-08-29 | Poseida Therapeutics, Inc. | Compositions and methods for genome editing |
| WO2024209000A1 (en) | 2023-04-04 | 2024-10-10 | Keygene N.V. | Linkers for duplex sequencing |
| WO2025096980A1 (en) * | 2023-11-02 | 2025-05-08 | Poseida Therapeutics, Inc. | Compositions targeting klkb1 and methods of use thereof |
| WO2025221789A1 (en) | 2024-04-16 | 2025-10-23 | Poseida Therapeutics, Inc. | Compositions and methods for use in car/tcr cell therapies |
| WO2026080393A1 (en) | 2024-10-07 | 2026-04-16 | Poseida Therapeutics, Inc. | Compositions and methods for use in car cell therapies |
Also Published As
| Publication number | Publication date |
|---|---|
| EP3929286A1 (en) | 2021-12-29 |
| KR20180036696A (ko) | 2018-04-09 |
| JP7170090B2 (ja) | 2022-11-11 |
| JP2018521689A (ja) | 2018-08-09 |
| JP2021112211A (ja) | 2021-08-05 |
| JP2021182942A (ja) | 2021-12-02 |
| AU2016278226B2 (en) | 2021-08-12 |
| CA2989827A1 (en) | 2016-12-22 |
| DK3310909T3 (da) | 2021-09-13 |
| CA2989827C (en) | 2024-09-10 |
| US20180187185A1 (en) | 2018-07-05 |
| EP3310909A1 (en) | 2018-04-25 |
| US11473082B2 (en) | 2022-10-18 |
| PT3310909T (pt) | 2021-09-09 |
| AU2021250992A1 (en) | 2021-11-11 |
| CN108026519A (zh) | 2018-05-11 |
| KR102637402B1 (ko) | 2024-02-15 |
| AU2016278226A1 (en) | 2018-01-25 |
| EP3310909B1 (en) | 2021-06-09 |
| US20230257737A1 (en) | 2023-08-17 |
| HK1253508A1 (zh) | 2019-06-21 |
| ES2886599T3 (es) | 2021-12-20 |
| AU2021250992B2 (en) | 2023-09-28 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20230257737A1 (en) | Compositions and methods for directing proteins to specific loci in the genome | |
| AU2019216699B2 (en) | Site-Specific Enzymes and Methods of Use | |
| WO2019126578A1 (en) | Compositions and methods for directing proteins to specific loci in the genome | |
| EP3157328B1 (en) | A method for directing proteins to specific loci in the genome and uses thereof | |
| EP3158070A1 (en) | Methods and compositions for in vivo non-covalent linking | |
| KR20200005640A (ko) | 광-전환성 폴리펩타이드 및 이의 용도 | |
| HK40065962A (en) | Compositions and methods for directing proteins to specific loci in the genome | |
| HK1253508B (en) | Compositions and methods for directing proteins to specific loci in the genome | |
| CN121975771A (en) | Compositions and methods for targeting proteins to specific loci in the genome | |
| HK1215284B (en) | Site-specific enzymes and methods of use | |
| BR112015010911B1 (pt) | Enzimas específicas de sítio e métodos de uso |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 16733813 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 2989827 Country of ref document: CA Ref document number: 2018517674 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 20187001436 Country of ref document: KR Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2016278226 Country of ref document: AU Date of ref document: 20160616 Kind code of ref document: A |