WO2016204341A1 - 신규한 혈관내피세포 성장인자와 결합할 수 있는 폴리펩타이드 및 이의 용도 - Google Patents
신규한 혈관내피세포 성장인자와 결합할 수 있는 폴리펩타이드 및 이의 용도 Download PDFInfo
- Publication number
- WO2016204341A1 WO2016204341A1 PCT/KR2015/009710 KR2015009710W WO2016204341A1 WO 2016204341 A1 WO2016204341 A1 WO 2016204341A1 KR 2015009710 W KR2015009710 W KR 2015009710W WO 2016204341 A1 WO2016204341 A1 WO 2016204341A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- polypeptide
- protein
- vascular endothelial
- growth factor
- endothelial growth
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/461—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from fish
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P27/00—Drugs for disorders of the senses
- A61P27/02—Ophthalmic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/195—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/52—Cytokines; Lymphokines; Interferons
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K19/00—Hybrid peptides, i.e. peptides covalently bound to nucleic acids, or non-covalently bound protein-protein complexes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/70—Fusion polypeptide containing domain for protein-protein interaction
Definitions
- the present invention relates to a novel polypeptide capable of binding to vascular endothelial growth factor and its use. More specifically, the present invention relates to a polypeptide capable of binding to vascular endothelial growth factor and inhibiting its activity.
- a polynucleotide encoding a peptide, a vector comprising the polynucleotide, a host cell transformed with the vector, a method of producing the polypeptide by expressing the vector in the host cell, and a cancer or senile macular degeneration comprising the polypeptide It relates to a composition for preventing or treating sex.
- Antibody therapies have been invested heavily in the development of global pharmaceutical companies and biotechnology companies because of their low side effects and high therapeutic efficacy compared to chemicals, and many antibody therapeutics are currently being used in clinical trials.
- VEGF Vascular endothelial growth factor
- VEGF vascular endothelial growth factor
- Overexpression of VEGF has been reported as a trigger of vascular related diseases such as age-related macular degeneration as well as tumors. As such, overexpression of VEGF is associated with various diseases, and research into the development of therapeutic agents targeting VEGF is being actively conducted.
- drugs targeting VEGF include the anticancer monoclonal antibody bevacizumab, but have been reported to have lower binding and therapeutic efficacy than other monoclonal antibody drugs.
- Another drug targeting VEGF is ranibizumab, an improvement of bevacizumab, which is used as a therapeutic agent for senile macular degeneration, but has been reported to have limited therapeutic efficacy. Therefore, there is an urgent need to develop a new concept of VEGF-targeted therapeutics that overcomes the limitations of existing drugs.
- the present inventors have successfully prepared specific protein binders for various disease-related target proteins using the lipid body scaffold, and verified that they have a biological inhibitory effect by a cell-based method (Registered in Korea).
- Patent No. 10-1,517,960 Patent No. 10-1,517,960
- applied research is still in its infancy, and further research is being actively conducted.
- VEGF vascular endothelial growth factor
- New polypeptides with specific binding to VEGF were selected based on a random mutant library constructed through overall structural analysis.
- the present invention prepared and selected a novel lipida polypeptide that selectively binds to VEGF through a beneficial mutation predicted based on the protein complex structure, and confirmed that the lipida can selectively bind to VEGF.
- the present invention has been completed.
- An object of the present invention is a novel polypeptide capable of inhibiting its biological activity through specific binding to VEGF, a polynucleotide encoding the polypeptide, a vector comprising the polynucleotide, a recombinant microorganism into which the vector is introduced. And it provides a method for producing the polypeptide using the recombinant microorganism.
- Another object of the present invention is to provide a method for treating cancer or senile macular degeneration, comprising administering a composition for preventing or treating cancer containing the polypeptide and a composition for treating cancer or senile macular degeneration containing the polypeptide.
- the present invention provides a modified repeat module of the N-terminal and VLR (Variable Lymphocyte Receptor) protein of the LRR (Leucine rich repeat) family protein having an alpha spiral capping motif and C of the VLR protein.
- VEGF vascular endothelial growth factor
- a polypeptide that selectively binds to VEGF characterized in that the amino acid at one or more positions selected from the group consisting of No., No. 71 and No. 72 is mutated.
- the present invention also provides a polynucleotide encoding the polypeptide and a recombinant vector comprising the polynucleotide.
- the present invention also provides a recombinant microorganism containing the polynucleotide or the recombinant vector.
- the present invention also provides a method for producing a polypeptide comprising culturing the recombinant microorganism to express the polypeptide and recovering the polypeptide from the cultured recombinant microorganism or culture.
- the present invention also provides a composition for preventing or treating cancer containing the polypeptide as an active ingredient.
- FIG. 1 is a schematic diagram showing the overall structure of a repeat body representing amino acid residues that construct a random library to select a polypeptide specifically binding to VEGF.
- Figure 2 shows the results of bio-panning phage display for VEGF using the phage library constructed in the present invention. Normalization of binding signals by ELISA against VEGF versus BSA was performed, and clones with an increased signal of 10-fold or more were defined as a lipid body clone having specific binding capacity to VEGF.
- FIG. 3 is a diagram and a diagram showing the results of experiments confirming the binding force to VEGF of the specific binding clones obtained in FIG. 2 by surface plasmon resonance (SPR).
- FIG. 5 is a diagram and a diagram showing the results of experiments confirming the binding force to VEGF of the binding force-binding clones by performing a positional mutation to increase the binding force by surface plasmon resonance.
- Figure 6 is an experiment verifying the therapeutic efficacy of C2 by comparing the difference in neovascularization after treatment with intraocular injection of polypeptide C2 (SEQ ID NO: 4) and control (PBS) that binds to VEGF in the macular degeneration mouse model The result is.
- vascular endothelial growth factor of the present invention is a signal transduction protein and is known to play an essential role in angiogenesis and vascular permeability by being involved in the growth, proliferation and migration of endothelial cells.
- Overexpression of VEGF in cells causes excessive angiogenesis and increased vascular permeability, and this phenomenon is found in various cancers and vascular diseases such as colorectal cancer, breast cancer, lung cancer and senile macular degeneration.
- VEGF vascular endothelial growth factor
- the polypeptide contained in the library is 75%, preferably 85%, more preferably 90%, even more preferably 95% encoded by the polynucleotide sequence of SEQ ID NO: 1 or the polynucleotide sequence of SEQ ID NO: It may be encoded by a polynucleotide sequence having the above homology.
- the library may be in the form of a phagemid comprising the polynucleotide.
- phagemid refers to a circular polynucleotide molecule derived from phage, which is an E. coli-host virus, and includes sequences of proteins and surface proteins necessary for propagation and propagation.
- Recombinant phagemids can be prepared using genetic recombination techniques well known in the art, and site-specific DNA cleavage and ligation can be performed using enzymes or the like generally known in the art.
- the phagemid may include a signal sequence or leader sequence for secretion in addition to expression control elements such as a promoter, an operator, an initiation codon, a termination codon, an enhancer, and mainly fused a desired protein with the surface protein of the phage to label the phage surface. It can be used for the method.
- the promoter of phagemid is mainly inducible and may include a selectable marker for selecting host cells.
- the phagemid comprises a signal sequence or leader sequence MalEss, DsbAss or PelBss for expressing and secreting the polynucleotides encoding the polypeptides constituting the library, wherein the phagemid comprises a recombinant protein on the surface of the phage.
- 1,346,075) comprising a histidine-tag to confirm expression and a polynucleotide encoding a gp3 domain, which is a kind of surface protein of M13 phage for expression on phage surface It may be a polynucleotide of SEQ ID NO: 2, but is not particularly limited thereto.
- the present inventors selected from the group consisting of 47, 49, 50, 69, 71 and 72 in the amino acid sequence represented by SEQ ID NO: 2 using the phage display method using the library containing the phagemid Amino acid at one or two or more positions are mutated to select a novel polypeptide (SEQ ID NOS: 3 to 8) in the form of a lipid body having excellent binding to VEGF (FIG. 2), and measuring the binding capacity of the selected polypeptide. (FIG. 3), it was confirmed that the polypeptides specifically bind to vascular endothelial growth factor (FIG. 4).
- the present invention provides a modified repeat module of VLR (Variable Lymphocyte Receptor) protein and N-terminus of LRR (Leucine rich repeat) family protein having alpha spiral capping motif and C- of VLR protein.
- VLR Very Lymphocyte Receptor
- LRR Leucine rich repeat
- the present invention relates to a polypeptide that selectively binds to VEGF, characterized in that an amino acid at one or more positions selected from the group consisting of No. 71 and No. 72 is mutated.
- the N-terminus of the LRR family protein having the alpha helical capping motif can be characterized in that the N-terminus of the internalin protein, wherein the internalin protein is preferably Internalin A And, it may be characterized in that it is selected from the group consisting of internalin B, internalin C, internalin H and internalin J, more preferably, it is characterized in that the internalin B protein.
- internaline B protein refers to a type of LRR family protein expressed in Listeria strains, which is different from other LRR family proteins in which other hydrophobic cores are uniformly distributed throughout the molecule.
- N-terminal structure is known to be stably expressed in microorganisms.
- the N-terminus of these internalin proteins is the microorganism from which the N-terminus site, which is most important for folding the repeat module, contains a more stable structure, including its alpha helix, so that the LRR family of proteins It can be effectively used for stable expression.
- N-terminus of an internalin protein refers to the N-terminus of an internalin protein necessary for water soluble expression and folding of the protein, and refers to an alpha helical capping motif and repeat module of an internalin protein. it means.
- the N-terminus of the internalin protein includes without limitation the N-terminus of the internalin protein necessary for the water soluble expression and folding of the protein, but may include, for example, the alpha helical capping motif "ETITVSTPIKQIFPDDAFAETIKANLKKKSVTDAVTQNE" and a repeat module.
- the repeating module pattern may include "LxxLxxLxLxxN".
- L in the repeating module pattern is alanine, glycine, phenylalanine, tyrosine, leucine, isoleucine, valine or tryptophan; N means asparagine, glutamine, serine, cysteine or threonine, x means hydrophilic amino acid.
- the N-terminus of the internalin protein can be selected as the N-terminus having high structural similarity according to the type of LRR family protein that can be fused, and the most stable amino acid can be selected through calculation of binding energy and the like. Variation is possible.
- VLR Variable Lymphocyte Receptor
- LRR Leucine rich repeat protein
- the repeat module consists of 20 to 30 amino acids, and (iii) the LRR repeat module has "LxxLxxLxLxxN" in a conserved pattern, where L is alanine, glycine, phenylalanine, tyrosine, leucine, isoleucine, valine and tryptophan Hydrophobic amino acids, such as N, asparagine, glutamine, serine, cysteine or threonine, x means all 20 kinds of amino acids, (iv) LRR family protein has a three-dimensional structure such as horseshoe Means a protein having.
- the LRR family protein of the present invention is not only known by its sequence or newly discovered in vivo using mRNA or cDNA, but also has a sequence not known to nature through the design of consensus design and the like. It may include all variants with skeletal structure of the module.
- Lipibody refers to a polypeptide which is optimized by consensus design by fusing based on the similarity of the structure of the VLR with the N-terminus of the internalin having an LRR structure.
- Lipibody proteins can be divided into concave (concave) and convex (convex) structures. The concave regions are known for their high degree of sequence diversity and important sites for protein interaction. Convex regions, on the other hand, play a role in keeping the overall structure of the protein stable based on highly conserved sequences. Lipibody proteins may include all fusion LRR family proteins that have enhanced the water-soluble expression and protein biophysical properties of all proteins belonging to the LRR family having repeat modules in this manner.
- polypeptide may be characterized by consisting of the amino acid sequence of any one of SEQ ID NO: 3 to 10.
- the polypeptide may be characterized by binding to blood endothelial growth factor (VEGF) and inhibiting its activity.
- VEGF blood endothelial growth factor
- the present invention relates to a polynucleotide encoding the polypeptide.
- the polynucleotide is not particularly limited thereto, but may be a polynucleotide encoding the amino acid sequence of any one of SEQ ID NOs: 3 to 10, 70% or more of the polynucleotide, more preferably 80 It may be a polynucleotide having a nucleotide sequence having at least%, more preferably at least 90% homology, but is not particularly limited thereto.
- the present invention relates to a vector comprising the polynucleotide.
- the term "vector” refers to a DNA preparation containing a nucleotide sequence of a polynucleotide encoding the target protein operably linked to a suitable regulatory sequence to enable expression of the target protein in a suitable host.
- the regulatory sequence includes a promoter capable of initiating transcription, any operator sequence for regulating such transcription, a sequence encoding a suitable mRNA ribosomal binding site, and a sequence regulating termination of transcription and translation.
- the vector used in the present invention is not particularly limited as long as it can be replicated in the host, and any vector known in the art may be used.
- Examples of commonly used vectors include natural or recombinant plasmids, phagemids, cosmids, viruses and bacteriophages.
- pWE15, M13, ⁇ MBL3, ⁇ MBL4, ⁇ IXII, ⁇ ASHII, ⁇ APII, ⁇ t10, ⁇ t11, Charon4A, and Charon21A can be used as the phage vector or cosmid vector
- pBR, pUC, and pBluescriptII systems are used as plasmid vectors.
- pGEM-based, pTZ-based, pCL-based and pET-based and the like can be used.
- the vector usable in the present invention is not particularly limited and known expression vectors can be used.
- pACYC177, pACYC184, pCL, pECCG117, pUC19, pBR322, pMW118, pCC1BAC, pET-21a, pET-32a vector and the like can be used.
- pET-21a and pET-32a vectors can be used.
- the present invention relates to a recombinant microorganism into which the polynucleotide or the vector including the polynucleotide is introduced.
- the term "recombinant microorganism” refers to a cell in which a vector having a gene encoding at least one target protein is transfected into a host cell to express the target protein, and all cells such as eukaryotic cells and prokaryotic cells.
- bacterial cells such as E. coli, Streptomyces, Salmonella typhimurium; Yeast cells; Fungal cells such as Pchia pastoris; Insect cells such as Drozophila and Spodoptera Sf9 cells; Animal cells such as CHO, COS, NSO, 293, bow melanoma cells; Or plant cells.
- the host cell usable in the present invention is not particularly limited, but Escherichia coli may be preferably used as the host cell. Most preferably E. coli BL21 (DE3), OrigamiB (DE3) can be used as the host cell.
- the term “transformation” means introducing a vector comprising a polynucleotide encoding a target protein into a host cell so that the protein encoded by the polynucleotide can be expressed in the host cell.
- Transformed polynucleotides include all of them, as long as they can be expressed in the host cell, whether they are inserted into or located outside the chromosome of the host cell.
- the polynucleotides include DNA and RNA encoding the target protein.
- the polynucleotide may be introduced in any form as long as it can be introduced into and expressed in a host cell.
- the polynucleotide may be introduced into a host cell in the form of an expression cassette, which is a gene construct including all elements necessary for self-expression.
- the expression cassette typically includes a promoter, transcription termination signal, ribosomal binding site and translation termination signal operably linked to the polynucleotide.
- the expression cassette may be in the form of an expression vector capable of self replication.
- the polynucleotide may be introduced into a host cell in its own form and operably linked to a sequence required for expression in the host cell.
- the present invention comprises the steps of: (i) culturing the recombinant microorganism to express the polypeptide; And (ii) recovering said polypeptide from said cultured recombinant microorganism or culture.
- the step of culturing the recombinant microorganism is not particularly limited thereto, but is preferably performed by a known batch culture method, continuous culture method, fed-batch culture method, and the like, and the culture conditions are not particularly limited thereto.
- a basic compound e.g. sodium hydroxide, potassium hydroxide or ammonia
- an acidic compound e.g.
- Controllable, oxygen or oxygen-containing gas mixture can be introduced into the culture to maintain aerobic conditions, the incubation temperature can be maintained at 20 to 45 °C, preferably 25 to 40 °C, for about 10 to 160 hours It is preferable to incubate.
- the polypeptide produced by the culture may be secreted into the medium or remain in the cell.
- the culture medium used may include sugars and carbohydrates (e.g. glucose, sucrose, lactose, fructose, maltose, molasses, starch and cellulose), fats and fats (e.g. soybean oil, sunflower seeds) as carbon sources.
- sugars and carbohydrates e.g. glucose, sucrose, lactose, fructose, maltose, molasses, starch and cellulose
- fats and fats e.g. soybean oil, sunflower seeds
- Oils, peanut oils and coconut oils fatty acids (e.g. palmitic acid, stearic acid and linoleic acid), alcohols (e.g. glycerol and ethanol) and organic acids (e.g. acetic acid), etc.
- Nitrogen sources include nitrogen-containing organic compounds such as peptone, yeast extract, gravy, malt extract, corn steep liquor, soybean meal and urea, or inorganic compounds such as ammonium sulfate, ammonium chloride, ammonium phosphate, ammonium carbonate and Ammonium nitrate) and the like can be used individually or in combination;
- As a source of phosphorus, potassium dihydrogen phosphate, dipotassium hydrogen phosphate, a corresponding sodium-containing salt, and the like can be used individually or in combination;
- Other metal salts such as magnesium sulfate or iron sulfate, and essential growth-promoting substances such as amino acids and vitamins.
- the method for recovering the polypeptide produced in the culturing step of the present invention is a method for recovering the desired polypeptide from the culture medium using a suitable method known in the art according to the culture method, for example, batch, continuous or fed-batch culture method, etc. Can be collected.
- the present invention relates to a composition for preventing or treating cancer comprising the polypeptide.
- the present invention relates to a composition for preventing or treating age-related macular degeneration comprising the polypeptide.
- the cancer prevention or treatment may be characterized in that the polypeptide is combined with the vascular endothelial growth factor.
- the prevention or treatment of senile macular degeneration may be characterized in that the polypeptide is combined with the vascular endothelial growth factor.
- vascular endothelial growth factor is a growth factor that induces tumor growth.
- the cancer or tumor in the present invention is colorectal cancer, colon cancer, non-small cell lung cancer, ovarian cancer, This means including multiple myeloma, Castleman's disease, and liver cancer.
- the term "senile macular degeneration” refers to the neural tissue located at the center of the inner retina of the eye, and most of the cells are gathered, the image is formed, and the degeneration occurs in the macula, the neural tissue located at the center of the retina.
- VEGF Vascular endothelial growth factor
- the senile macular degeneration in the present invention includes all kinds of macular degeneration caused by excessive secretion of vascular endothelial cell deformity factor. do.
- the term "treatment” means the administration of the composition to inhibit or alleviate one or more symptoms resulting from cancer or macular degeneration as well as to prevent treatment or progression that reverses the symptoms of the disease.
- prevention refers to any action that inhibits or delays the onset of cancer by administration of the composition.
- the treatment of cancer or macular degeneration is made by combining the polypeptide obtained in the present invention with vascular endothelial growth factor, and significantly inhibits its activity by treating vascular endothelial growth factor to treat cancer or macular degeneration. will be.
- the present inventors constructed a macular degeneration mouse model by laser photocoagulation method to evaluate the therapeutic efficacy of the lipid body according to the invention.
- the polypeptide C2 of SEQ ID NO: 4 was injected into the mouse eye and treated, the effect of macular degeneration of Lipibody was verified through a marked decrease in choroidal neovascularization (FIG. 6).
- composition for treating cancer or macular degeneration comprising the polypeptide of the present invention may further include a pharmaceutically acceptable carrier, and may be formulated with the carrier.
- the term "pharmaceutically acceptable carrier” refers to a carrier or diluent that does not irritate an organism and does not inhibit the biological activity and properties of the administered compound.
- Acceptable pharmaceutical carriers in compositions formulated as liquid solutions are sterile and physiologically compatible, including saline, sterile water, Ringer's solution, buffered saline, albumin injectable solutions, dextrose solution, maltodextrin solution, glycerol, ethanol and One or more of these components may be mixed and used, and other conventional additives such as antioxidants, buffers and bacteriostatic agents may be added as necessary.
- Diluents, dispersants, surfactants, binders and lubricants may also be added in addition to formulate into injectable formulations, pills, capsules, granules or tablets such as aqueous solutions, suspensions, emulsions and the like.
- Cancer preventive or therapeutic composition comprising the polypeptide of the present invention and a pharmaceutically acceptable carrier is applicable to any formulation comprising it as an active ingredient, it can be prepared in oral or parenteral formulations.
- Pharmaceutical formulations of the invention may be oral, rectal, nasal, topical (including the cheek and sublingual), subcutaneous, vaginal or parenteral (intramuscular, subcutaneous). And forms suitable for administration by inhalation or insufflation.
- Oral dosage forms containing the composition of the present invention as an active ingredient include, for example, tablets, troches, lozenges, water-soluble or oily suspensions, preparation powders or granules, emulsions, hard or soft capsules, syrups or elixirs. can do.
- lactose For formulation into tablets and capsules, lactose, saccharose, sorbitol, mannitol, starch, amylopectin, binders such as cellulose or gelatin, excipients such as dicalcium phosphate, disintegrants such as corn starch or sweet potato starch, stearic acid masne It may include a lubricating oil such as calcium, calcium stearate, sodium stearyl fumarate or polyethylene glycol wax, and in the case of a capsule, it may further contain a liquid carrier such as fatty oil in addition to the above-mentioned materials.
- a lubricating oil such as calcium, calcium stearate, sodium stearyl fumarate or polyethylene glycol wax
- a liquid carrier such as fatty oil in addition to the above-mentioned materials.
- Formulations for parenteral administration comprising the composition of the present invention as an active ingredient, for injection, such as subcutaneous injection, intravenous injection or intramuscular injection, a suppository injection method or aerosol for spraying by inhalation through the respiratory system It can be formulated as.
- the compositions of the present invention may be mixed in water with stabilizers or buffers to prepare solutions or suspensions, which may be formulated for unit administration of ampoules or vials.
- solutions or suspensions which may be formulated for unit administration of ampoules or vials.
- solutions or suspensions which may be formulated for unit administration of ampoules or vials.
- a rectal composition such as suppositories or enema, including conventional suppository bases such as cocoa butter or other glycerides.
- a propellant or the like may be combined with the additives to disperse the dispersed dispersion or wet powder.
- the present invention relates to a method for treating cancer or macular degeneration, comprising administering a composition for preventing or treating cancer or macular degeneration comprising the polypeptide.
- the term "administration" means introducing a pharmaceutical composition of the present invention to a patient in any suitable manner.
- the route of administration of the composition of the present invention may be administered via various routes orally or parenterally as long as it can reach the target tissue, and specifically, oral, rectal, topical, intravenous, intraperitoneal, intramuscular, intraarterial, It may be administered in a conventional manner via transdermal, nasal, inhaled, intraocular or intradermal routes.
- the treatment method of the present invention includes administering a composition for preventing or treating cancer or macular degeneration of the present invention in a pharmaceutically effective amount.
- a suitable total daily dose may be determined by the practitioner within the correct medical judgment.
- the specific therapeutically effective amount for a particular patient may be based on the specific composition, including the type and severity of the reaction to be achieved, whether or not other agents are used in some cases, the age, weight, general health, sex and diet of the patient, time of administration, It is desirable to apply differently depending on the route of administration and the rate of release of the composition, the duration of treatment, and the various factors and similar factors well known in the medical arts, including drugs used with or concurrent with the specific composition. Therefore, the effective amount of the composition for preventing or treating cancer or macular degeneration suitable for the purpose of the present invention is preferably determined in consideration of the above-mentioned matters.
- the treatment method of the present invention is applicable to any animal that can cause diseases such as tumor development and angiogenesis due to excessive secretion of vascular endothelial growth factor, the animal is not only humans and primates, but also cattle, pigs And domestic animals such as sheep, horses, dogs, and cats.
- Lipbodies like LRR proteins in nature, are concave due to the curvature of the shape of the entire structure and the modularity of the repeat unit with conserved leucine sequences to maintain the overall protein structure. region and convex region.
- a hypervariable region like the complementarity determining region (CDR) of the antibody, is located to mediate protein-protein interactions.
- convex regions play an important role in maintaining the overall structure of the LRR based on well-conserved sequences.
- a random mutation library was selected by selecting six amino acid residues 47, 49, 50, 69, 71, and 72 located in the concave regions of two consecutive modules (LRR1, LRRV1 module) located in the terminal direction of the amine group. It was constructed, based on the amino acid sequence of SEQ ID NO: 2 (FIG. 1).
- mutagenic primers for the library construction were synthesized to replace the selected amino acids with NNK degenerate codons.
- the primers were used to perform overlap polymerase chain reaction (overlap PCR) on two modules to obtain library DNA, and the phage of SEQ ID NO: 2 described in the inventor's prior patent (Korean Patent No. 1,356,075). Insertion into mid pBEL118M yielded the final library phagemid.
- the obtained library was introduced into E. coli XL1-Blue by electroporation to obtain a transformant, thereby constructing a library having a diversity of 1.0 ⁇ 10 8 level.
- Example 2-1 Polypeptide Screening for VEGF Binding Through Panning of Lipibody Libraries
- a polypeptide capable of binding to VEGF was selected and purified.
- VEGF was added to immunotubes at a concentration of 100 ⁇ g / ml and coated at 4 ° C. for 12 hours.
- the coated immunotubes were washed three times with PBS and blocked with PBS solution (TPBSA) containing 1% BSA and 0.05% Tween 20 for 2 hours at 4 ° C.
- the purified phages were then added to the coated immunotubes at a concentration of 10 12 cfu / ml and allowed to react at room temperature for 2 hours.
- ELISA was performed using phages selected by the method of Example 2-1 using 96-well plates coated with VEGF and BSA, so that 8 absorbents having an absorbance of VEGF (OD 450 ) more than 10 times higher than those of BSA. Candidates were selected (FIG. 2), their respective amino acid sequences were identified, and clones with the same amino acid sequence were excluded. As a result, a total of six types of Lipibodi sequences were identified from the selected phage, and as a result of measuring dissociation constants for VEGF using surface plasmon resonance for all six types of Lipibodies, all clones were specific for VEGF. It was confirmed that binding to (Fig. 3).
- amino acid 47 isoleucine is substituted with valine, leucine, methionine, 49 asparagine is substituted with tyrosine, methionine, 50 asparagine is substituted with arginine, glutamine, 69 alanine valine, It was confirmed that it was substituted with isoleucine or phenylalanine, glycine 71 was replaced with leucine, isoleucine or phenylalanine, and glycine 72 was replaced with glutamine, valine or arginine.
- anti-VEGF monoclonal antibody binds to the site and prevents VEGF from interacting with the VEGF receptor, thereby effectively inhibiting the activity of VEGF and exhibiting high therapeutic efficacy.
- ELISA was performed using a total of six kinds of Lipbodies obtained in Example 2-1. As a result, all six types of Lipbodies did not bind to BSA, but confirmed specific binding ability to VEGF (FIG. 4). In addition, as a result of the addition of soluble VEGF (soluble VEGF) in the plate coated with VEGF, it was confirmed that the lipid body selected in the aqueous solution effectively binds to VEGF once again by decreasing the signal of ELISA.
- soluble VEGF soluble VEGF
- a competitive ELISA with bevacizumab an anti-VEGF monoclonal antibody known to bind VEGF to a site that interacts with the VEGF receptor, results in a reduction of binding signal by bevacizumab in all lipidobodies.
- the epitope of the six kinds of lipid body was confirmed that the site VEGF interacts with the VEGF receptor (Fig. 4).
- clone C2 had the highest binding force to VEGF of 10.6 nM among the six types of Lipbodies obtained in Example 2-1.
- the binding capacity of bevacizumab, an anti-VEGF monoclonal antibody currently used for therapeutic purposes, to VEGF is known to be several nM. Therefore, we attempted to develop a mutant of lipidi with improved binding ability to have the same therapeutic efficacy as bevacizumab.
- choroidal neovascularization CNV
- a macular degeneration mouse model was constructed by inducing choroidal neovascularization in the eye of a mouse by laser photocoagulation.
- Polypeptide C2 SEQ ID NO: 4
- F fluorescein angiography
- ICGA indocyanine green angiography
- FA represents bleeding due to blood vessels and abnormal neovascularization of the retina and choroid
- ICGA represents choroidal neovascularization.
- the degree of macular degeneration can be measured by dividing the value measured by FA (Leaky area) by the value measured by ICGA (CNV area). As a result, it was confirmed that the Leaky area / CNV area value in the group treated with C2 was significantly reduced. Also, as the amount of C2 increased, the leaky area / CNV area value was further reduced (FIG. 6).
- CNV volume In order to obtain CNV volume, the eyes of macular degeneration model mice were extracted and subjected to immunohistochemistry using an antibody binding to CD31, a marker of vascular endothelial cells. As a result, it can be seen that the CNV volume is significantly reduced in the group treated with C2, and also the CNV volume is significantly decreased as the amount of the treated C2 increases (FIG. 6).
- novel polypeptides that bind to VEGF of the present invention can bind to VEGF and inhibit its activity, which is useful for the development of agents for the prevention or treatment of various diseases associated with VEGF.
Landscapes
- Chemical & Material Sciences (AREA)
- Health & Medical Sciences (AREA)
- Organic Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Biochemistry (AREA)
- Genetics & Genomics (AREA)
- Molecular Biology (AREA)
- Biophysics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Gastroenterology & Hepatology (AREA)
- Zoology (AREA)
- Toxicology (AREA)
- General Chemical & Material Sciences (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Engineering & Computer Science (AREA)
- Ophthalmology & Optometry (AREA)
- Peptides Or Proteins (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Abstract
본 발명은 혈관내피세포 성장인자와 특이적으로 결합 가능한 신규한 폴리펩타이드, 상기 폴리펩타이드를 코딩하는 폴리뉴클레오타이드, 상기 폴리뉴클레오타이드를 포함하는 벡터, 상기 발현벡터가 도입된 재조합 미생물, 상기 재조합 미생물 이용한 상기 폴리펩타이드의 제조방법, 상기 폴리펩타이드를 포함하는 암 예방 또는 치료용 조성물 및 상기 폴리펩타이드를 포함하는 암 예방 또는 치료용 조성물을 투여하는 것을 포함하는, 암을 예방 또는 치료하는 방법에 관한 것이다. 본 발명의 폴리펩타이드는 혈관내피세포 성장인자에 결합하여 그의 활성을 억제할 수 있으므로, 혈관내피세포 성장인자와 연관된 다양한 질환의 예방 또는 치료용 제제로 널리 활용될 수 있다.
Description
본 발명은 혈관내피세포 성장인자와 결합할 수 있는 신규한 폴리펩타이드 및 이의 용도에 관한 것으로, 보다 구체적으로 본 발명은 혈관내피세포 성장인자와 결합하여 그의 활성을 저해할 수 있는 폴리펩타이드, 상기 폴리펩타이드를 코딩하는 폴리뉴클레오타이드, 상기 폴리뉴클레오타이드를 포함하는 벡터, 상기 벡터로 형질전환된 숙주세포, 숙주세포 내에서 벡터를 발현시켜서 상기 폴리펩타이드를 생산하는 방법 및 상기 폴리펩타이드를 포함하는 암 또는 노인성 황반변성의 예방 또는 치료용 조성물에 관한 것이다.
항체 치료제는 화학제재에 비해 적은 부작용과 높은 치료 효능 때문에 글로벌 제약기업과 생명공학 기업들이 개발에 집중 투자를 하여 현재 다수의 항체 치료제가 임상에 사용되고 있으며 많은 치료제 후보가 임상실험 중에 있다.
그러나 항체 치료제는 생산 비용이 비싸고 기존 특허 장벽을 벗어나기 힘들뿐만 아니라 분자량이 커서 세포내 침투가 어렵고 기대만큼 실제 환자의 치료 효과가 높지 않은 문제점이 있기 때문에, 최근 항체 치료제를 대체하기 위한 인공항체의 개발이 활발하게 진행되고 있다. 이러한 인공항체 골격 단백질은 항체 치료제와 달리 암 조직 내로 침투되는 효율에 크게 향상되어 결과적으로 치료 효과를 향상 시킬 수 있다는 장점이 많은 연구를 통해 밝혀지고 있다.
이러한 배경 하에, 본 발명자들은 기존의 항체를 대체할 수 있는 비 항체 단백질 골격 (non-antibody protein scaffold)인 리피바디 (repebody)를 성공적으로 개발하였다. 리피바디는 크기가 항체의 1/5 수준이고 대장균에서 대량생산 되며 동물 실험결과 면역원성이 거의 없음을 확인하였다(대한민국 등록특허 제1,517,960호). 또한 열 및 pH 안정성이 매우 우수하고 표적 물질에 대한 결합력을 pico-mole 수준까지 매우 용이하게 증대시킬 수 있으며 표적 물질에 대한 특이성이 매우 탁월함을 입증한 바가 있다(대한민국 등록특허 제1,356,076호, 대한민국 공개특허 제10-2013-0007380호).
혈관내피세포 성장인자 (Vascular endothelial growth factor; VEGF)는 전이성 결장직장암을 포함한 다양한 암 세포에서 과발현 되어 신생혈관의 생성을 유도함으로써 종양의 성장과 전이를 촉진시키는 질환유발인자이다. VEGF의 과발현은 종양 뿐 아니라 노인성 황반변성 (age-related macular degeneration)과 같은 혈관 관련 질환의 유발인자로 보고되었다. 이렇듯, VEGF의 과발현이 다양한 질환과 관련되어 있어, VEGF를 표적으로 하는 치료제 개발 연구가 활발하게 진행되고 있는 실정이다.
현재 VEGF를 표적으로 하는 약물로는 항암제인 단클론항체인 베바시주맙 (Bevacizumab)이 있으나, 다른 단클론 항체 신약에 비해 결합력 및 치료효능이 낮은 것으로 보고되고 있다. 이를 극복하고자 화학요법 (Chemotherapy)과 병용하여 사용하는 등 새로운 치료법의 개발 및 신약 개발이 시도되고 있다. 또 다른 VEGF를 표적하는 약물로는 베바시주맙의 개량체인 라니비주맙 (Ranibizumab)이 있으며, 이는 노인성 황반변성의 치료제로 사용되고 있으나, 치료 효능의 한계가 있는 것으로 보고되었다. 따라서, 기존 약물이 가진 한계를 극복한 새로운 개념의 VEGF 표적 치료제의 개발이 절실히 요구되고 있다.
본 발명자들은 상기 리피바디 골격을 이용하여 다양한 질환 관련 표적 단백질들에 대한 특이적인 결합 단백질 (Specific protein binder)을 성공적으로 제조하고, 세포 기반의 방법으로 생물학적인 저해효과가 있음을 검증하였으나(대한민국 등록특허 제10-1,517,960호), 이에 대한 응용연구는 아직 시작 단계에 불과하여, 추가적인 연구를 활발히 진행하고 있다.
이러한 배경 하에서, 본 발명자들은 상기 리피바디 골격을 이용하여 다양한 암과 노인성 황반변성의 중요한 표적 단백질인 VEGF에 특이적으로 결합하는 단백질을 성공적으로 확보하기 위해 예의 노력한 결과, 리피바디의 구조적 특징인 모듈성과 전체구조분석을 통해 구축한 무작위한 돌연변이 라이브러리를 바탕으로 VEGF에 대해 특이적인 결합력을 갖는 신규한 폴리펩타이드를 선별하였다. 또한, 단백질복합체 구조를 기본으로 예측한 유익한 돌연변이(beneficial mutation)를 통해 VEGF에 선택적으로 결합하는 신규한 리피바디인 폴리펩타이드를 제조 및 선별하였으며, 상기 리피바디가 VEGF에 선택적으로 결합 가능함을 확인하고, 본 발명을 완성하였다.
발명의 요약
본 발명의 목적은 VEGF와 특이적인 결합을 통해 그의 생물학적 활성을 억제할 수 있는 신규한 폴리펩타이드, 상기 폴리펩타이드를 코딩하는 폴리뉴클레오타이드, 상기 폴리뉴클레오타이드를 포함하는 벡터, 상기 벡터가 도입되어 있는 재조합 미생물 및 상기 재조합 미생물을 이용하여 상기 폴리펩타이드의 제조방법을 제공하는 것이다.
본 발명의 다른 목적은 상기 폴리펩타이드를 함유하는 암 예방 또는 치료용 조성물 및 상기 폴리펩타이드를 함유하는 암 또는 노인성 황반변성의 치료용 조성물을 투여하는 것을 포함하는, 암 또는 노인성 황반변성을 치료하는 방법을 제공하는 것이다.
상기 목적을 달성하기 위해, 본 발명은 알파 나선형 캡핑 모티프 (capping mofit)를 가지는 LRR (Leucine rich repeat) 패밀리 단백질의 N-말단과 VLR(Variable Lymphocyte Receptor) 단백질의 변형된 반복모듈 및 VLR 단백질의 C-말단이 융합되어 있는 혈관내피세포 정장인자(Vascular endothelial growth factor, VEGF)에 선택적으로 결합하는 폴리펩타이드로, 서열번호 2로 표시되는 아미노산 서열에서 44번, 47번, 49번, 50번, 69번, 71번 및 72번으로 이루어진 군으로부터 선택되는 하나 또는 둘 이상의 위치의 아미노산이 변이된 것을 특징으로 하는, VEGF에 선택적으로 결합하는 폴리펩타이드를 제공한다.
본 발명은 또한, 상기 폴리펩타이드를 코딩하는 폴리뉴클레오타이드 및 상기 폴리뉴클레오티드를 포함하는 재조합벡터를 제공한다.
본 발명은 또한, 상기 폴리뉴클레오타이드 또는 상기 재조합벡터가 포함되어 있는 재조합 미생물을 제공한다.
본 발명은 또한, 상기 재조합 미생물을 배양하여 상기 폴리펩타이드를 발현시키는 단계 및 상기 배양된 재조합 미생물 또는 배양물로부터 상기 폴리펩타이드를 회수하는 단계를 포함하는 폴리펩타이드의 제조방법을 제공한다.
본 발명은 또한, 상기 폴리펩타이드를 유효성분으로 함유하는 암 예방 또는 암 치료용 조성물을 제공한다.
도 1은 VEGF와 특이적으로 결합하는 폴리펩타이드를 선별하기 위하여 무작위적인 라이브러리를 구축한 아미노산 잔기들을 표시한 리피바디(repebody)의 전체 구조를 나타내는 개략도이다.
도 2는 본 발명에서 구축한 파지 라이브러리를 이용하여, VEGF에 대한 파지 디스플레이의 바이오 패닝을 수행한 결과이다. BSA 대비 VEGF에 대한 효소면역측정법 (ELISA)에 의한 결합 신호를 평균화 (Normalization)를 하였으며, 이때 10배 이상의 신호가 증가한 클론을 VEGF에 대해 특이적인 결합력을 갖는 리피바디 클론으로 정의하였다.
도 3은 상기 도 2에서 얻어진 특이적인 결합을 하는 클론들의 VEGF에 대한 결합력을 표면 플라스몬 공명 (Surface plasmon resonance; SPR)으로 확인한 실험 결과를 나타내는 도면 및 도표이다.
도 4는 ELISA를 통해 VEGF에 대한 특이적인 결합여부를 확인한 결과이다. 모든 클론이 BSA에는 결합하지 않지만 VEGF에 대해서는 특이적으로 결합함을 확인할 수 있다. 이때, 경쟁자로 넣어준 항 VEGF 단클론항체인 베바시주맙 (Bevacizumab)로 인해 VEGF의 ELISA 신호가 감소한 것으로 보아 모든 클론이 베바시주맙과 유사한 항원결정부위 (epitope)를 갖는다고 추정할 수 있다.
도 5는 결합력을 증대시키기 위해 위치 지정 돌연변이를 수행하여 결합력이 증대된 클론들의 VEGF에 대한 결합력을 표면 플라스몬 공명으로 확인한 실험 결과를 나타내는 도면 및 도표이다.
도 6은 황반변성 마우스모델에 VEGF에 결합하는 폴리펩타이드 C2 (서열번호 4)와 대조군 (PBS)를 안구 내 주사로 처리한 후, 신생혈관 형성의 차이를 비교함으로써 C2의 치료효능을 검증한 실험 결과이다.
발명의 상세한 설명 및 바람직한
구현예
다른 식으로 정의되지 않는 한, 본 명세서에서 사용된 모든 기술적 및 과학적 용어들은 본 발명이 속하는 기술 분야에서 숙련된 전문가에 의해서 통상적으로 이해되는 것과 동일한 의미를 갖는다. 일반적으로, 본 명세서에서 사용된 명명법은 본 기술 분야에서 잘 알려져 있고 통상적으로 사용되는 것이다.
본 발명의 용어 “혈관내피세포 성장인자 (vascular endothelial growth factor)”는 신호 전달 단백질로, 내피 세포의 성장, 증식 및 이동에 관여함으로써 혈관 신생 및 혈관투과성 증가에 필수적인 역할을 하는 것으로 알려져 있다. 세포 내에서 VEGF의 과발현은 과도한 혈관 신생 및 혈관투과성 증가를 유발하며, 이러한 현상은 결장직장암, 유방암, 폐암 그리고 노인성 황반변성 등 다양한 암과 혈관 질환에서 발견되고 있다.
본 발명자들은 혈관내피세포 성장인자(VEGF)와 선택적으로 결합하여 그를 효과적으로 고정화 또는 정제할 수 있는 신규한 폴리펩타이드(리피바디)를 개발하기 위하여, 알파 나선형 캡핑 모티프 (capping mofit)를 가지는 LRR (Leucine rich repeat) 패밀리 단백질의 N-말단과 가변림프구 수용체 (VLR; Variable Lymphocyte Receptor) 단백질의 변형된 반복모듈 및 VLR 단백질의 C-말단이 융합된, 폴리펩타이드의 반복 모듈을 무작위적으로 포함하는 라이브러리를 구축하였다(도 1). 상기 라이브러리에 포함된 폴리펩타이드는 서열번호 1의 폴리뉴클레오티드 서열에 의하여 코딩되거나 또는 서열번호 1의 폴리뉴클레오티드 서열과 75%, 바람직하게는 85%, 보다 바람직하게는 90%, 더욱 바람직하게는 95% 이상의 상동성을 갖는 폴리뉴클레오티드 서열에 의하여 코딩될 수 있다.
또한, 상기 라이브러리는 상기 폴리뉴클레오타이드를 포함하는 파지미드의 형태가 될 수 있다. 본 발명의 용어 "파지미드"란, 대장균을 숙주로 하는 바이러스인 파지로 부터 유래된 원형의 폴리뉴클레오타이드 분자를 의미하는데, 번식과 증식에 필요한 단백질 및 표면 단백질들의 서열이 포함되어 있다. 재조합 파지미드는 당해 기술 분야에서 잘 알려진 유전자 재조합 기술을 이용하여 제조할 수 있으며, 부위-특이적 DNA 절단 및 연결은 당해 기술 분야에서 일반적으로 알려진 효소 등을 사용하여 수행될 수 있다. 상기 파지미드는 프로모터, 오퍼레이터, 개시코돈, 종결코돈, 인핸서 같은 발현 조절 요소 외에도 분비를 위한 신호 서열 또는 리더 서열을 포함할 수 있고, 주로 원하는 단백질을 파지의 표면 단백질과 융합하여 파지 표면에 표지하기 위한 방법에 사용될 수 있다. 파지미드의 프로모터는 주로 유도성이며, 숙주 세포를 선택하기 위한 선택성 마커를 포함할 수도 있다. 본 발명의 목적상 상기 파지미드는 상기 라이브러리를 구성하는 폴리펩타이드를 코딩하는 폴리뉴클레오타이드르를 발현 및 분비하기 위한 신호 서열 또는 리더 서열인 MalEss, DsbAss 또는 PelBss를 포함하고, 파지의 표면에 재조합 단백질의 발현을 확인하기 위한 히스티딘-태그와 파지 표면으로의 발현을 위한 M13 파지의 표면 단백질의 일종인 gp3 도메인을 인코딩하는 폴리뉴클레오타이드를 포함하는 본 발명자의 선행 특허 (대한민국 등록특허 제1,346,075호)에 기술된 서열번호 2의 폴리뉴클레오타이드가 될 수 있으나, 특별히 이에 제한되지는 않는다.
본 발명자들은 상기 파지미드를 포함하는 라이브러리를 이용한 파지 디스플레이 방법을 사용하여, 서열번호 2로 표시되는 아미노산 서열에서 47번, 49번, 50번, 69번, 71번 및 72번으로 이루어진 군으로부터 선택되는 하나 또는 둘 이상의 위치의 아미노산이 변이되어, VEGF에 대한 결합력이 우수한 리피바디 형태의 신규한 폴리펩타이드(서열번호 3 내지 8)를 선별하고(도 2), 선별된 폴리펩타이드의 결합력을 측정하였으며(도 3), 상기 폴리펩타이드들이 혈관내피세포 성장인자에 특이적으로 결합하는 것을 확인하였다(도 4).
이후, 결합력을 증대시키기 위하여 상기 폴리펩타이드의 44번 아미노산에 위치지정 돌연변이(site directed mutagenesis)를 수행한 결과, 혈관내피세포 성장인자에 대한 결합력이 획기적으로 증가한 신규한 폴리펩타이드(서열번호 9 내지 10)를 선별하였다(도 5).
따라서, 본 발명은 일 관점에서, 알파 나선형 캡핑 모티프 (capping mofit)를 가지는 LRR (Leucine rich repeat) 패밀리 단백질의 N-말단과 VLR(Variable Lymphocyte Receptor) 단백질의 변형된 반복모듈 및 VLR 단백질의 C-말단이 융합되어 있는 혈관내피세포 정장인자(Vascular endothelial growth factor, VEGF)에 선택적으로 결합하는 폴리펩타이드로, 서열번호 2로 표시되는 아미노산 서열에서 44번, 47번, 49번, 50번, 69번, 71번 및 72번으로 이루어진 군으로부터 선택되는 하나 또는 둘 이상의 위치의 아미노산이 변이된 것을 특징으로 하는, VEGF에 선택적으로 결합하는 폴리펩타이드에 관한 것이다.
본 발명에 있어서, 상기 알파 나선형 캡핑 모티프 (capping mofit)를 가지는 LRR 패밀리 단백질의 N-말단은 인터날린 단백질의 N-말단인 것을 특징으로 할 수 있고, 상기 인터날린 단백질은 바람직하게는 인터날린 A, 인터날린 B, 인터날린 C, 인터날린 H 및 인터날린 J로 이루어진 군에서 선택되는 것을 특징으로 할 수 있으며, 더욱 바람직하게는 인터날린 B 단백질인 것을 특징으로 할 수 있다.
본 발명의 용어 "인터날린 B 단백질"이란, 리스테리아 (Listeria) 균주에서 발현되는 LRR 패밀리 단백질의 일종을 의미하는데, 다른 소수성 코어가 전 분자에 걸쳐서 일정하게 분포되어 있는 다른 LRR 패밀리 단백질들과는 다른 유형의 N-말단 구조 때문에 미생물에서도 안정적으로 발현되는 것으로 알려져 있다. 이러한 인터날린 단백질의 N-말단은 반복 모듈의 접힘 (Folding)에 가장 중요한 N-말단 부위가 미생물 유래일 뿐 아니라 그 형태가 알파 나선을 포함하는 더욱 안정적인 구조를 포함하므로, 미생물에서 LRR 패밀리 단백질들의 안정적인 발현을 위하여 효과적으로 사용될 수 있다.
본 발명의 용어, "인터날린 단백질의 N-말단"은 단백질의 수용성 발현 및 접힘에 있어서 필요한 인터날린 단백질의 N-말단을 의미하며 알파 나선형 캡핑 모티프 (capping motif) 및 인터날린 단백질의 반복 모듈을 의미한다. 인터날린 단백질의 N-말단은 단백질의 수용성 발현 및 접힘에 있어서 필요한 인터날린 단백질의 N-말단은 제한 없이 포함되나, 그 예로 알파 나선형 캡핑 모티프인 "ETITVSTPIKQIFPDDAFAETIKANLKKKSVTDAVTQNE" 및 반복 모듈을 포함할 수 있다. 바람직하게 반복 모듈 패턴은 "LxxLxxLxLxxN"을 포함할 수 있다. 상기 반복 모듈 패턴 중 L은 알라닌, 글리신, 페닐알라닌, 티로신, 루이신, 이소루이신, 발린 또는 트립토판; N은 아스파라진, 글루타민, 세린, 시스테인 또는 트레오닌, x는 친수성 아미노산을 의미한다. 인터날린 단백질의 N-말단은 융합될 수 있는 LRR 패밀리 단백질의 종류에 따라 높은 구조 유사도를 갖는 N-말단이 선택될 수 있으며 결합 에너지 등의 계산을 통해 가장 안정적인 아미노산을 선택하여 해당 모듈의 아미노산의 변이가 가능하다.
본 발명의 용어 "가변 림프구 수용체 (Variable Lymphocyte Receptor, VLR)"란, 먹장어와 칠성 장어에서 발현되는 LRR 패밀리 단백질의 일종을 의미하는데, 먹장어와 칠성 장어에서 면역 기능을 수행하는 단백질로서 다양한 항원 물질에 결합할 수 있는 골격으로 유용하게 사용될 수 있다. 상기 인터날린 B 단백질의 N-말단 및 VLR 단백질이 융합된 폴리펩타이드는 인터날린 B 단백질이 융합되지 않은 VLR 단백질보다 수용성 및 발현양이 증가하므로, 이를 기반으로 한 신규한 단백질 치료제의 제조에 사용될 수 있다.
본 발명의 용어 "LRR (Leucine rich repeat) 단백질"이란, 루이신이 일정한 위치에 반복되는 모듈의 조합으로 이루어진 단백질을 의미하는 것으로, (i) 하나 이상의 LRR 반복 모듈을 갖고 있고, (ii) 상기 LRR 반복 모듈은 20 내지 30개의 아미노산으로 이루어져 있고, (iii) LRR 반복 모듈은 보존 패턴으로 "LxxLxxLxLxxN"을 갖고 있으며, 여기서 L은 알라닌, 글리신, 페닐알라닌, 티로신, 루이신, 이소루이신, 발린 및 트립토판과 같은 소수성 아미노산을, N은 아스파라진, 글루타민, 세린, 시스테인 또는 쓰레오닌을, x는 모든 종류의 20가지의 아미노산을 의미하며, (iv) LRR 패밀리 단백질은 말발굽과 같은 삼차원 구조를 갖는 구조를 갖고 있는 단백질을 의미한다. 본 발명의 LRR 패밀리 단백질은 이미 그 서열이 알려져 있거나, 생체에서 새로 유도된 mRNA나 cDNA를 이용하여 찾아낸 것뿐 아니라, 컨센서스 디자인 (Consensus design) 등의 설계를 통하여 자연계에 알려지지 않은 서열을 가지면서 반복모듈의 골격 구조가 있는 변이체를 모두 포함할 수 있다.
본 발명의 용어 "리피바디 (Repebody)"란, LRR 구조를 갖는 상기 인터날린의 N-말단과 상기 VLR의 구조의 유사성을 바탕으로 융합하여 컨센서스 디자인으로 최적화시킨 폴리 폴리펩타이드이다. 리피바디 단백질은 구조상 오목한 지역 (Concave) 와 볼록한 지역 (Convex) 으로 나누어 질 수 있다. 여기서 오목한 지역은 서열의 다양성이 높으며 단백질 상호작용에 중요한 부위로 알려져 있다. 이와 반대로 볼록한 지역은 보존성이 높은 서열을 바탕으로 단백질의 전체구조를 안정하게 유지하는 역할을 수행한다. 리피바디 단백질은 반복 모듈을 갖는 LRR 패밀리에 속하는 모든 단백질을 상기 방법으로 수용성 발현 및 단백질의 생물리화학적 성질을 향상 시킨 모든 융합 LRR 패밀리 단백질을 모두 포함할 수 있다.
본 발명에 있어서, 상기 폴리펩타이드는 서열번호 3 내지 10 중 어느 하나의 아미노산 서열로 구성되는 것을 특징으로 할 수 있다.
본 발명에 있어서, 상기 폴리펩타이드는 혈중내피세포 성장인자(VEGF)에 결합하여 그의 활성을 저해하는 것을 특징으로 할 수 있다.
본 발명은 다른 관점에서, 상기 폴리펩타이드를 코딩하는 폴리뉴클레오타이드에 관한 것이다.
본 발명에서 있어서, 상기 폴리뉴클레오타이드는 특별히 이에 제한되지 않으나, 상기 서열번호 3 내지 10 중 어느 하나의 아미노산 서열을 코딩하는 폴리뉴클레오타이드가 될 수 있고, 상기 폴리뉴클레오타이드와 70% 이상, 보다 바람직하게는 80% 이상, 보다 바람직하게는 90% 이상의 상동성을 가지는 염기 서열을 가지는 폴리뉴클레오타이드일 수 있으나, 특별히 이에 제한되지는 않는다.
본 발명은 다른 관점에서, 상기 폴리뉴클레오타이드를 포함하는 벡터에 관한 것이다.
본 발명의 용어 "벡터"는 적합한 숙주 내에서 목적 단백질을 발현시킬 수 있도록 적합한 조절 서열에 작동 가능하게 연결된 상기 목적 단백질을 암호화하는 폴리뉴클레오타이드의 염기서열을 함유하는 DNA 제조물을 의미한다. 상기 조절 서열은 전사를 개시할 수 있는 프로모터, 그러한 전사를 조절하기 위한 임의의 오퍼레이터 서열, 적합한 mRNA 리보좀 결합 부위를 코딩하는 서열, 및 전사 및 해독의 종결을 조절하는 서열을 포함한다. 벡터는 적당한 숙주 내로 형질 전환된 후, 숙주 게놈과 무관하게 복제되거나 기능할 수 있으며, 게놈 그 자체에 통합될 수 있다.
본 발명에서 사용되는 벡터는 숙주 중에서 복제 가능한 것이면 특별히 한정되지 않으며 당 업계에 알려진 임의의 벡터를 이용할 수 있다. 통상 사용되는 벡터의 예로는 천연 상태이거나 재조합된 상태의 플라스미드, 파지미드, 코스미드, 바이러스 및 박테리오파지를 들 수 있다. 예를 들어, 파지 벡터 또는 코스미드 벡터로서 pWE15, M13, λMBL3, λMBL4, λIXII, λASHII, λAPII, λt10, λt11, Charon4A, 및 Charon21A 등을 사용할 수 있으며, 플라스미드 벡터로서 pBR계, pUC계, pBluescriptII계, pGEM계, pTZ계, pCL계 및 pET계 등을 사용할 수 있다. 본 발명에서 사용 가능한 벡터는 특별히 제한되는 것이 아니며 공지된 발현 벡터를 사용할 수 있다. 바람직하게는 pACYC177, pACYC184, pCL, pECCG117, pUC19, pBR322, pMW118, pCC1BAC, pET-21a, pET-32a 벡터 등을 사용할 수 있다. 가장 바람직하게는 pET-21a, pET-32a 벡터를 사용할 수 있다.
본 발명은 다른 관점에서, 상기 폴리뉴클레오타이드 또는 상기 폴리뉴클레오타이드를 포함하는 벡터가 도입되어 있는 재조합 미생물에 관한 것이다.
본 발명의 용어 "재조합 미생물"이란, 하나 이상의 목적 단백질을 암호화하는 유전자를 갖는 벡터가 숙주세포에 도입되어 목적 단백질을 발현시키도록 형질이 감염된 세포를 의미하며, 진핵세포, 원핵세포 등의 모든 세포가 될 수 있는데, 특별히 이에 제한되지 않으나, 대장균, 스트렙토미세스, 살모넬라 티피뮤리움 등의 박테리아 세포; 효모 세포; 피치아 파스토리스 등의 균류 세포; 드로조필라, 스포도프테라 Sf9 세포 등의 곤충 세포; CHO, COS, NSO, 293, 보우 멜라노마 세포 등의 동물 세포; 또는 식물 세포가 될 수 있다. 본 발명에서 사용 가능한 숙주세포는 특별히 제한되는 것이 아니나, 바람직하게는 대장균을 숙주 세포로 사용할 수 있다. 가장 바람직하게는 대장균 BL21(DE3), OrigamiB(DE3)를 숙주 세포로 사용할 수 있다.
본 발명에서 용어 "형질전환"이란, 표적 단백질을 암호화하는 폴리뉴클레오타이드를 포함하는 벡터를 숙주 세포 내에 도입하여 숙주 세포 내에서 상기 폴리뉴클레오타이드가 암호화하는 단백질이 발현할 수 있도록 하는 것을 의미한다. 형질 전환된 폴리뉴클레오타이드는 숙주 세포 내에 발현될 수 있기만 한다면, 숙주세포의 염색체 내에 삽입되어 위치하거나 염색체 외에 위치하든지 상관없이 이들 모두를 포함한다. 또한, 상기 폴리뉴클레오타이드는 표적 단백질을 암호화하는 DNA 및 RNA를 포함한다. 상기 폴리뉴클레오타이드는 숙주 세포 내로 도입되어 발현될 수 있는 것이면, 어떠한 형태로 도입되는 것이든 상관없다. 예를 들면, 상기 폴리뉴클레오타이드는, 자체적으로 발현되는데 필요한 모든 요소를 포함하는 유전자 구조체인 발현 카세트 (Expression cassette)의 형태로 숙주세포에 도입될 수 있다. 상기 발현 카세트는 통상 상기 폴리뉴클레오타이드에 작동 가능하게 연결되어 있는 프로모터(promoter), 전사 종결 신호, 리보좀 결합부위 및 번역 종결신호를 포함한다. 상기 발현 카세트는 자체 복제가 가능한 발현 벡터 형태일 수 있다. 또한, 상기 폴리뉴클레오타이드는 그 자체의 형태로 숙주세포에 도입되어, 숙주세포에서 발현에 필요한 서열과 작동 가능하게 연결되어 있는 것일 수도 있다.
본 발명은 다른 관점에서, (i) 상기 재조합 미생물을 배양하여 상기 폴리펩타이드를 발현시키는 단계; 및 (ii) 상기 배양된 재조합 미생물 또는 배양물로부터 상기 폴리펩타이드를 회수하는 단계를 포함하는 폴리펩타이드의 제조방법에 관한 것이다.
본 발명에 있어서, 상기 재조합 미생물을 배양하는 단계는 특별히 이에 제한되지 않으나, 공지된 회분식 배양방법, 연속식 배양방법, 유가식 배양방법 등에 의해 수행됨이 바람직하고, 배양조건은 특별히 이에 제한되지 않으나, 염기성 화합물(예: 수산화나트륨, 수산화칼륨 또는 암모니아) 또는 산성 화합물(예: 인산 또는 황산)을 사용하여 적정 pH(pH 5 내지 9, 바람직하게는 pH 6 내지 8, 가장 바람직하게는 pH 6.8)를 조절할 수 있고, 산소 또는 산소-함유 가스 혼합물을 배양물에 도입시켜 호기성 조건을 유지할 수 있으며, 배양온도는 20 내지 45℃, 바람직하게는 25 내지 40℃를 유지할 수 있고, 약 10 내지 160 시간동안 배양함이 바람직하다. 상기 배양에 의하여 생산된 상기 폴리펩타이드는 배지중으로 분비되거나 세포내에 잔류할 수 있다.
아울러, 사용되는 배양용 배지는 탄소 공급원으로는 당 및 탄수화물(예: 글루코오스, 슈크로오스, 락토오스, 프럭토오스, 말토오스, 몰라세, 전분 및 셀룰로오스), 유지 및 지방(예: 대두유, 해바라기씨유, 땅콩유 및 코코넛유), 지방산(예: 팔미트산, 스테아르산 및 리놀레산), 알콜(예: 글리세롤 및 에탄올) 및 유기산(예: 아세트산) 등을 개별적으로 사용하거나 또는 혼합하여 사용할 수 있고; 질소 공급원으로는 질소-함유 유기 화합물(예: 펩톤, 효모 추출액, 육즙, 맥아 추출액, 옥수수 침지액, 대두 박분 및 우레아), 또는 무기 화합물(예: 황산암모늄, 염화암모늄, 인산암모늄, 탄산암모늄 및 질산암모늄) 등을 개별적으로 사용하거나 또는 혼합하여 사용할 수 있으며; 인 공급원으로서 인산 이수소칼륨, 인산수소이칼륨, 이에 상응하는 나트륨 함유 염 등을 개별적으로 사용하거나 또는 혼합하여 사용할 수 있고; 기타 금속염(예: 황산마그네슘 또는 황산철), 아미노산 및 비타민과 같은 필수성장-촉진 물질을 포함할 수 있다.
본 발명의 상기 배양 단계에서 생산된 폴리펩타이드를 회수하는 방법은 배양방법, 예를 들어 회분식, 연속식 또는 유가식 배양 방법 등에 따라 당해 분야에 공지된 적합한 방법을 이용하여 배양액으로부터 목적하는 폴리펩타이드를 수집할 수 있다.
본 발명은 다른 관점에서, 상기 폴리펩타이드를 포함하는 암 예방 또는 치료용 조성물에 관한 것이다.
본 발명은 또다른 관점에서, 상기 폴리펩타이드를 포함하는 노인성 황반변성 예방 또는 치료용 조성물에 관한 것이다.
본 발명에 있어서, 상기 암 예방 또는 치료는 상기 폴리펩타이드가 혈관내피 성장인자와 결합하여 이루어지는 것을 특징으로 할 수 있다.
본 발명에 있어서, 상기 노인성 황반변성 예방 또는 치료는 상기 폴리펩타이드가 혈관내피 성장인자와 결합하여 이루어지는 것을 특징으로 할 수 있다.
본 발명에서 용어 "암" 또는 "종양"은 신체 조직의 자율적인 과잉 성장에 의해 비정상적으로 자라난 덩어리를 의미하는 것이다. 혈관내피세포 성장인자(VEGF)는 종양의 증식을 유도하는 성장 인자인바, 본 발명에서의 암 또는 종양은, 혈관내피세포 정장인자가 과량 분비되는 결장직장암, 대장암, 비소세포폐암, 난소암, 다발성 골수종, 캐슬만씨 병, 간암등을 모두 포함하는 것을 의미한다.
본 발명에서 용어 “노인성 황반변성”은 눈의 안쪽 망막의 중심부에 위치한 신경조직을 황반이라고 하는데, 시세포의 대부분이 모여 있고, 물체의 상이 맺히며, 망막 중심부에 위치한 신경조직인 황반부에 변성이 일어나 시력장애를 일으키는 질환을 의미한다. 혈관내피세포 성장인자(VEGF)는 망막에서 신생혈관의 생성을 유도하는 성장 인자인바, 본 발명에서의 노인성 황반변성은, 혈관내피세포 정장인자가 과량 분비되어 발생한 모든 종류의 황반변성을 포함하는 것을 의미한다.
본 발명에서 용어 "치료"란 조성물의 투여로 암이나 황반변성으로부터 야기된 하나 또는 그 이상의 증상을 억제하거나 완화하는 것뿐만 아니라 질환의 증상을 반전시키는 치료 또는 진행을 방지하는 것을 의미한다. 본 발명에서 용어 "예방"이란 조성물의 투여로 암을 억제시키거나 발병을 지연시키는 모든 행위를 의미한다. 본 발명에서 암 또는 황반변성의 치료는 본 발명에서 확보한 폴리펩타이드가 혈관내피세포 성장인자와 결합하여 이루어지는 것으로, 혈관내피세포 성장인자에 결합하여 그의 활성을 유의하게 억제하여 암 또는 황반변성을 치료하는 것이다.
본 발명의 선행 특허(대한민국 등록특허, 제1,517,960호)에서는 인터루킨-6와 결합할 수 있는 신규한 리피바디가 비소세포폐암에 대하여 유의미한 항암 작용을 한다는 것을 확인하였다. 따라서, 본 발명에 따른 혈관내피세포 성장인자와 특이적으로 결합하는 리피바디 역시, 혈관내피세포 성장인자의 과발현에 의해 발생하는 암의 예방 또는 치료에도 사용될 수 있음은 당업자에게 자명하다.
그러나 아직까지, 리피바디가 황반변성 치료제로서의 효과가 있는지는 전혀 알려진 바가 없다. 이에, 본 발명자들은 발명에 따른 리피바디의 치료 효능을 평가하기 위하여 레이저 광응고화 (laser photocoagulation) 방법으로 황반변성 마우스모델을 구축하였다. 서열번호 4의 폴리펩타이드 C2를 마우스 안구 내로 주사하여 처리하였을 때, 맥락막 신생혈관 생성이 현저하게 감소하는 것을 통해 리피바디의 황반변성 치료제 효능을 검증하였다 (도6).
본 발명의 상기 폴리펩타이드를 포함하는 암 또는 황반변성 치료용 조성물은 약학적으로 허용 가능한 담체를 추가로 포함할 수 있으며, 담체와 함께 제제화될 수 있다.
본 발명에서 용어, "약학적으로 허용 가능한 담체"란 생물체를 자극하지 않고 투여 화합물의 생물학적 활성 및 특성을 저해하지 않는 담체 또는 희석제를 말한다. 액상 용액으로 제제화되는 조성물에 있어서 허용되는 약제학적 담체로는, 멸균 및 생체에 적합한 것으로서, 식염수, 멸균수, 링거액, 완충 식염수, 알부민 주사용액, 덱스트로즈 용액, 말토 덱스트린 용액, 글리세롤, 에탄올 및 이들 성분 중 1 성분 이상을 혼합하여 사용할 수 있으며, 필요에 따라 항산화제, 완충액, 정균제 등 다른 통상의 첨가제를 첨가할 수 있다. 또한 희석제, 분산제, 계면활성제, 결합제 및 윤활제를 부가적으로 첨가하여 수용액, 현탁액, 유탁액 등과 같은 주사용 제형, 환약, 캡슐, 과립 또는 정제로 제제화할 수 있다.
본 발명의 상기 폴리펩타이드 및 약학적으로 허용 가능한 담체를 포함하는 암 예방 또는 치료용 조성물은 이를 유효성분으로 포함하는 어떠한 제형으로도 적용가능하며, 경구용 또는 비경구용 제형으로 제조할 수 있다. 본 발명의 약학적 제형은 구강(oral), 직장(rectal), 비강(nasal), 국소(topical; 볼 및 혀 밑을 포함), 피하, 질(vaginal) 또는 비경구(parenteral; 근육내, 피하 및 정맥내를 포함) 투여에 적당한 것 또는 흡입 (inhalation) 또는 주입(insufflation)에 의한 투여에 적당한 형태를 포함한다.
본 발명의 조성물을 유효성분으로 포함하는 경구 투여용 제형으로는, 예를 들어 정제, 트로키제, 로렌지, 수용성 또는 유성현탁액, 조제분말 또는 과립, 에멀젼, 하드 또는 소프트 캡슐, 시럽 또는 엘릭시르제로 제제화할 수 있다. 정제 및 캡슐 등의 제형으로 제제화하기 위해, 락토오스, 사카로오스, 솔비톨, 만니톨, 전분, 아밀로펙틴, 셀룰로오스 또는 젤라틴과 같은 결합제, 디칼슘 포스페이트와 같은 부형제, 옥수수 전분 또는 고구마 전분과 같은 붕괴제, 스테아르산 마스네슘, 스테아르산 칼슘, 스테아릴푸마르산 나트륨 또는 폴리에틸렌글리콜 왁스와 같은 윤활유를 포함할 수 있으며, 캡슐제형의 경우 상기 언급한 물질 외에도 지방유와 같은 액체 담체를 더 함유할 수 있다.
본 발명의 조성물을 유효성분으로 포함하는 비경구 투여용 제형으로는, 피하주사, 정맥주사 또는 근육내 주사 등의 주사용 형태, 좌제 주입방식 또는 호흡기를 통하여 흡입이 가능하도록 하는 에어로졸제 등 스프레이용으로 제제화할 수 있다. 주사용 제형으로 제제화하기 위해서는 본 발명의 조성물을 안정제 또는 완충제와 함께 물에서 혼합하여 용액 또는 현탁액으로 제조하고, 이를 앰플 또는 바이알의 단위 투여용으로 제제화할 수 있다. 좌제로 주입하기 위해서는, 코코아버터 또는 다른 글리세라이드 등 통상의 좌약 베이스를 포함하는 좌약 또는 관장제와 같은 직장투여용 조성물로 제제화할 수 있다. 에어로졸제 등의 스프레이용으로 제형화하는 경우, 수분산된 농축물 또는 습윤 분말이 분산되도록 추진제 등이 첨가제와 함께 배합될 수 있다.
또 하나의 양태로서, 본 발명은 상기 폴리펩타이드를 포함하는 암 또는 황반변성의 예방 또는 치료용 조성물을 투여하는 것을 포함하는, 암 또는 황반변성을 치료하는 방법에 관한 것이다.
본 발명에서 용어, "투여"는 어떠한 적절한 방법으로 환자에게 본 발명의 약제학적 조성물을 도입하는 것을 의미한다. 본 발명의 조성물의 투여 경로는 목적 조직에 도달할 수 있는 한 경구 또는 비경구의 다양한 경로를 통하여 투여될 수 있으며, 구체적으로, 구강, 직장, 국소, 정맥내, 복강내, 근육내, 동맥내, 경피, 비측내, 흡입, 안구 내 또는 피내경로를 통해 통상적인 방식으로 투여될 수 있다.
본 발명의 치료방법은 본 발명의 암 또는 황반변성의 예방 또는 치료용 조성물을 약학적 유효량으로 투여하는 것을 포함한다. 적합한 총 1일 사용량은 올바른 의학적 판단범위 내에서 처치의에 의해 결정될 수 있다는 것은 당업자에게 자명한 일이다. 특정 환자에 대한 구체적인 치료적 유효량은 달성하고자 하는 반응의 종류와 정도, 경우에 따라 다른 제제가 사용되는지의 여부를 비롯한 구체적 조성물, 환자의 연령, 체중, 일반 건강 상태, 성별 및 식이, 투여 시간, 투여 경로 및 조성물의 분비율, 치료기간, 구체적 조성물과 함께 사용되거나 동시 사용되는 약물을 비롯한 다양한 인자와 의약 분야에 잘 알려진 유사 인자에 따라 다르게 적용하는 것이 바람직하다. 따라서 본 발명의 목적에 적합한 암 또는 황반변성의 예방 또는 치료용 조성물의 유효량은 전술한 사항을 고려하여 결정하는 것이 바람직하다.
또한, 본 발명의 치료 방법은 혈관내피세포 성장인자의 과도한 분비로 인하여 종양 발달과 신생혈관생성 등의 질병이 발생할 수 있는 임의의 동물에 적용가능하며, 동물은 인간 및 영장류뿐만 아니라, 소, 돼지, 양, 말, 개 및 고양이 등의 가축을 포함한다.
이하 첨부된 실시예를 들어 본 발명을 보다 상세히 설명한다. 그러나 이러한 실시예는 본 발명의 기술적 사상의 내용과 범위를 쉽게 설명하기 위한 예시일 뿐, 이에 의해 본 발명의 기술적 범위가 한정되거나 변경되는 것은 아니다. 또한, 이러한 예시에 기초하여 본 발명의 기술적 사상의 범위 안에서 다양한 변형과 변경이 가능함은 당업자에게는 당연할 것이다.
실시예 1: 단백질 구조 기반의 리피바디 라이브러리 구축
리피바디는 자연계에 존재하는 LRR 단백질들과 마찬가지로 보존된 루이신 서열을 갖는 반복 단위체 (Repeat unit)가 연속적으로 연결되어 전체 단백질 구조를 유지하는 모듈성과 전체 구조의 모양의 곡률로 인한 오목한 지역 (concave region)과 볼록한 지역 (convex region)으로 구별되는 구조적 특징을 갖는다. 상기 오목한 지역에는 항체의 상보결정지역 (complementarity determining region; CDR)처럼 초가변영역 (hypervariable region)이 위치하여, 단백질-단백질 상호작용을 매개한다. 또한, 볼록한 지역은 잘 보존되어 있는 서열을 바탕으로 LRR의 전체 구조를 유지하는데 중요한 역할을 한다. 이러한 리피바디의 단백질 구조를 분석하여 하기의 같은 방식으로 무작위적인 라이브러리를 설계하였다.
구체적으로, 아민기말단 방향에 위치한 연속적인 두 개의 모듈 (LRR1, LRRV1 module)의 오목한 지역에 위치하는 여섯 아미노산 잔기 47, 49, 50, 69, 71, 그리고 72번을 선택하여 무작위적인 돌연변이 라이브러리를 구축하였으며, 이는 서열번호 2의 아미노산 서열을 바탕으로 한다(도 1).
그런 다음, 상기 선택한 아미노산을 NNK 동의코돈 (degenerate codon)으로 치환하도록, 라이브러리 구축을 위한 돌연변이 유발 프라이머 (mutagenic primer)를 합성하였다.
이어, 상기 프라이머들을 이용하여 두 모듈에 대한 겹침 중합효소 연쇄 반응 (overlap PCR)을 수행하며 라이브러리 DNA를 수득하고, 본 발명자의 선행 특허 (대한민국 등록특허 제1,356,075호)에 기술된 서열번호 2의 파지미드 pBEL118M에 삽입하여 최종적인 라이브러리 파지미드를 확보하였다.
상기 확보된 라이브러리를 전기천공법 (electroporation)으로 대장균 XL1-Blue에 도입하여 형질전환체를 수득함으로써, 1.0x108 수준의 다양성을 갖는 라이브러리를 구축하였다.
실시예 2: 무작위적인 파지 라이브러리를 통한 VEGF와 특이적으로 결합하는 폴리펩타이드 선별
실시예 2-1: 리피바디 라이브러리의 패닝 과정을 통한 VEGF와 결합하는 폴리펩타이드 선별
상기 실시예 1에서 구축한 라이브러리를 사용하여 VEGF에 결합할 수 있는 폴리펩타이드를 선별하여 정제하였다. VEGF와 결합할 수 있는 후보를 선별하기 위하여, VEGF를 면역튜브 (Immuno-tube)에 100 ㎍/㎖의 농도로 가하고, 4℃에서 12시간동안 코팅하였다. 상기 코팅된 면역튜브를 PBS로 3회 세척하고, 1% BSA와 0.05% Tween 20을 포함하는 PBS 용액 (TPBSA)으로 4℃에서 2시간동안 블로킹 (Blocking) 하였다. 그런 다음, 상기 정제된 파지를 1012 cfu/ml의 농도로 상기 코팅된 면역튜브에 가하고, 상온에서 2시간 반응시켰다. 반응이 종료된 후, 0.05% Tween 20을 포함하는 PBS 용액 (TPBS)으로 총 2분간 5번씩 및 PBS로 2번 세척하였다. 마지막으로, 1ml의 0.2M Glycine-HCl (pH 2.2)를 상기 면역튜브에 가하고, 상온에서 13분간 반응시킴으로써, VEGF와 결합할 수 있는 리피바디 후보를 표면에 발현시킨 파지를 용출시켰다. 상기 용출액에 60㎕의 1.0M Tris-HCl (pH 9.0)를 가하여 중화시키고, 숙주세포인 10ml 대장균 XL1-Blue 용액 (OD600 = 0.5)에 가한 다음, 2xYT 플레이트에 도말하는 바이오패닝 (Bio-panning) 과정을 동일하게 4회 반복하여 수행하였다. 그 결과, 각 패닝 과정을 통해 VEGF와 특이적으로 결합하는 파지가 농축됨을 확인하였다. 상기 결과는 VEGF와 결합하는 라이브러리 파지가 특이적으로 증가함을 의미하는 것으로 분석되었다.
실시예 2-2: 선별된 리피바디의 VEGF에 대한 특이적인 결합여부 확인 및 서열 분석
상기 실시예 2-1의 방법을 통하여 선별된 파지를 VEGF와 BSA가 코팅된 96-웰 플레이트를 이용하여 ELISA를 수행함으로써, BSA 대비 VEGF의 흡광도(OD450)가 10배 이상 높은 8개의 리피바디 후보들을 선별하고(도 2), 이들 각각의 아미노산 서열을 확인한 후, 동일한 아미노산 서열을 갖는 클론을 제외 하였다. 그 결과, 상기 선별된 파지에서 총 6 종류의 리피바디 서열을 확인하였으며, 6 종류의 리피바디에 대하여 표면 플라스몬 공명을 이용하여 VEGF에 대한 해리상수를 측정한 결과, 모든 클론이 VEGF에 특이적으로 결합하는 것을 확인하였다(도 3). 즉, 47번 아미노산인 이소루이신이 발린, 루이신, 메티오닌으로 치환되고, 49번 아스파라진이 타이로신, 메티오닌으로 치환되며, 50번 아스파라진이 아르지닌, 글루타민으로 치환되고, 69번 알라닌이 발린, 이소루이신 또는 페닐알라닌으로 치환되며, 71번 글리신이 루이신, 이소루이신 또는 페닐알라닌으로 치환되고, 72번 글리신은 글루타민, 발린 또는 아르지닌으로 치환되었음을 확인하였다.
상기 결과는 VEGF와 결합하는데 중요한 역할을 수행하는 잔기가 존재함을 의미하는 것으로 분석되었다.
실시예 2-3: 선별된 리피바디의 항원결정부위 확인
상기 실시예 2-1에서 확보한 VEGF에 결합하는 리피바디 중에서 VEGF가 VEGF 수용체 (VEGF receptor)와 상호작용하는 부위에 결합하는 리피바디를 선별하는 것은 매우 중요하다. 현재 항 VEGF 단클론항체는 상기 부위에 결합을 하여 VEGF가 VEGF 수용체와 상호작용하지 못하게 함으로써 VEGF의 활성을 효과적으로 억제하여 높은 치료 효능을 나타내고 있다.
이러한 배경하에, 상기 실시예 2-1를 통해 얻어진 총 6 종류의 리피바디를 이용하여 ELISA를 수행하였다. 그 결과, 6 종류의 리피바디 모두 BSA에는 결합하지 않으나, VEGF에는 결합하는 특이적인 결합능을 확인하였다(도 4). 또한 VEGF를 코팅한 플레이트에서 수용성 VEGF(soluble VEGF)를 첨가한 결과, ELISA의 신호가 감소됨을 통해서 다시 한 번 수용액 상에서도 선발된 리피바디가 VEGF에 효과적으로 결합함을 확인하였다. 마지막으로, VEGF가 VEGF 수용체와 상호작용하는 부위에 결합하는 것으로 알려진 항 VEGF 단클론항체인 베바시주맙 (Bevacizumab)과의 경쟁적 ELISA를 수행한 결과, 모든 리피바디가 베바시주맙에 의해 결합신호가 감소하는 것으로 확인됨에 따라 6 종류의 리피바디의 항원결정부위가 VEGF가 VEGF 수용체와 상호작용하는 부위임을 확인할 수 있었다(도 4).
실시예 3: 위치 지정 돌연변이 수행을 통한 리피바디의 VEGF에 대한 결합력 증대 수행
상기 실시예 2-1에서 확보한 6 종류의 리피바디 중 클론 C2가 VEGF에 대한 결합력이 10.6nM로 가장 높음을 확인하였다. 현재 치료 목적으로 사용 중인 항 VEGF 단클론항체인 베바시주맙의 VEGF에 대한 결합력은 수 nM 수준으로 알려져 있다. 따라서, 베바시주맙과 동등한 치료 효능을 갖기 위해서 결합력이 향상된 리피바디의 돌연변이체를 개발하고자 하였다.
구체적으로, 상기 실시예 1에서 무작위적인 라이브러리를 구축한 6개의 잔기 주변의 잔기들에 위치 지정 돌연변이를 시켰다. 그 결과, 리피바디 A1과 C2의 44번 아미노산인 아스파라긴산이 글리신으로 바뀐 돌연변이체 A1-D44G와 C2-D44G의 결합력이 각각 4.94nM과 7.62nM로 향상되었음을 확인하였다(도 5).
실시예 4: 황반변성 마우스모델에 대한 폴리펩타이드의 영향 분석
황반변성의 맥락막 혈관신생 (choroidal neovascularization; CNV)에 대한 폴리펩타이드의 효과를 확인하기 위하여 레이저 광응고화 (laser photocoagulation)로 마우스의 눈에서 맥락막 혈관신생을 유발하여 황반변성 마우스모델을 구축하였다. 이후 폴리펩타이드 C2 (서열번호 4)를 각각 25 μg과 50 μg을 안구 내 주사하였다. 대조군으로는 PBS를 사용하였다. 안구 내 주사 후 7일 뒤, confocal scanning laser ophthalmoscope를 이용하여 얻은 fluorescein angiography (FA)와 indocyanine green angiography (ICGA) 이미지를 분석하였다. 이때, FA는 망막과 맥락막의 혈관 및 비정상적 신생혈관 생성으로 인한 출혈을 나타내며, ICGA는 맥락막 신생혈관을 나타낸다. FA로 측정된 값 (Leaky area)을 ICGA로 측정된 값 (CNV area)으로 나눠줌으로써 황반변성의 정도를 측정할 수 있다. 그 결과, C2를 처리한 군에서의 Leaky area/CNV area 값이 확연하게 줄어드는 것을 확인할 수 있었다. 또한 처리한 C2의 양이 증가할수록 Leaky area/CNV area 값이 더욱 줄어드는 것을 확인할 수 있었다(도 6).
CNV 부피를 구하기 위해, 황반변성 모델 마우스의 안구를 적출하여 혈관내피세포의 마커인 CD31에 결합하는 항체를 이용한 면역조직화학 (immunohistochemistry) 검사를 수행하였다. 그 결과, C2를 처리한 군에서 CNV 부피가 확연히 줄어드는 것을 확인할 수 있으며, 또한 처리한 C2의 양이 증가할수록 CNV 부피가 현저하게 줄어드는 것을 확인할 수 있었다(도 6).
이상으로 본 발명 내용의 특정한 부분을 상세히 기술하였는 바, 당업계의 통상의 지식을 가진 자에게 있어서 이러한 구체적 기술은 단지 바람직한 실시 양태일 뿐이며, 이에 의해 본 발명의 범위가 제한되는 것이 아닌 점은 명백할 것이다. 따라서, 본 발명의 실질적인 범위는 첨부된 청구항들과 그것들의 등가물에 의하여 정의된다고 할 것이다.
본 발명의 VEGF에 결합하는 신규한 폴리펩타이드는 VEGF에 결합하여 그의 활성을 억제할 수 있으므로 VEGF와 연관된 다양한 질환의 예방 또는 치료용 제제의 개발에 유용하다.
전자파일 첨부하였음.
Claims (15)
- 알파 나선형 캡핑 모티프 (capping mofit)를 가지는 LRR (Leucine rich repeat) 패밀리 단백질의 N-말단과 VLR(Variable Lymphocyte Receptor) 단백질의 변형된 반복모듈 및 VLR 단백질의 C-말단이 융합되어 있는 혈관내피세포 정장인자(Vascular endothelial growth factor, VEGF)에 선택적으로 결합하는 폴리펩타이드로, 서열번호 2로 표시되는 아미노산 서열에서 44번, 47번, 49번, 50번, 69번, 71번 및 72번으로 이루어진 군으로부터 선택되는 하나 또는 둘 이상의 위치의 아미노산이 변이된 것을 특징으로 하는, 혈관내피세포 성장인자에 선택적으로 결합하는 폴리펩타이드.
- 제1항에 있어서, 상기 알파 나선형 캡핑 모티프 (capping mofit)를 가지는 LRR 패밀리 단백질의 N-말단은 인터날린 단백질의 N-말단인 것을 특징으로 하는, 혈관내피세포 성장인자에 선택적으로 결합하는 폴리펩타이드.
- 제2항에 있어서, 상기 인터날린 단백질은 인터날린 A, 인터날린 B, 인터날린 C, 인터날린 H 및 인터날린 J로 이루어진 군에서 선택되는 것을 특징으로 하는, 혈관내피세포 성장인자에 선택적으로 결합하는 폴리펩타이드.
- 제3항에 있어서, 상기 인터날린 단백질은 인터날린 B 단백질인 것을 특징으로 하는, 혈관내피세포 성장인자에 선택적으로 결합하는 폴리펩타이드.
- 제1항에 있어서,상기 VLR 단백질의 변형된 반복모듈은 하기의 반복 모듈 패턴을 포함하는 것을 특징으로 하는, 혈관내피세포 성장인자에 선택적으로 결합하는 폴리펩타이드:LxxLxxLxLxxN상기 패턴에서,L은 알라닌, 글리신, 페닐알라닌, 티로신, 루이신, 이소루이신, 발린 또는 트립토판이고;N은 아스파라진, 글루타민, 세린, 시스테인 또는 트레오닌이며 및x는 모든 종류의 20개의 아미노산이다.
- 제1항에 있어서, 상기 폴리펩타이드는 서열번호 3 내지 10 중 어느 하나의 아미노산 서열로 구성되는 것을 특징으로 하는, 혈관내피세포 성장인자에 선택적으로 결합하는 폴리펩타이드.
- 제1항에 있어서, 상기 폴리펩타이드는 혈관내피세포 성장인자에 결합하여 그의 활성을 저해하는 것을 특징으로 하는 폴리펩타이드.
- 제1항의 폴리펩타이드를 코딩하는 폴리뉴클레오타이드.
- 제8항의 폴리뉴클레오타이드를 포함하는 벡터.
- 제8항의 폴리뉴클레오타이드 또는 제9항의 벡터가 도입되어 있는 재조합 미생물.
- 다음의 단계를 포함하는 혈관내피세포 성장인자에 특이적으로 결합하는 폴리펩타이드의 제조방법:(i) 제10항의 재조합 미생물을 배양하여 제1항의 폴리펩타이드를 발현시키는 단계; 및(ii) 상기 배양된 재조합 미생물 또는 배양물로부터 제1항의 폴리펩타이드를 회수하는 단계.
- 제1항 내지 제7항의 폴리펩타이드를 유효성분으로 함유하는 암 예방 또는 암 치료용 조성물.
- 제12항에 있어서, 상기 암 예방 또는 치료는 상기 폴리펩타이드가 혈관내피 성장인자와 결합하여 이루어지는 것인 암 예방 또는 치료용 조성물.
- 제1항 내지 제7항의 폴리펩타이드를 유효성분으로 함유하는 노인성 황반변성 예방 또는 노인성 황반변성 치료용 조성물.
- 제14항에 있어서, 상기 노인성 황반변성 예방 또는 치료는 상기 폴리펩타이드가 혈관내피 성장인자와 결합하여 이루어지는 것인 노인성 황반변성 예방 또는 치료용 조성물.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US15/737,937 US10508138B2 (en) | 2015-06-19 | 2015-09-16 | Polypeptide capable of binding to vascular endothelial growth factor, and use thereof |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| KR10-2015-0087476 | 2015-06-19 | ||
| KR20150087476 | 2015-06-19 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2016204341A1 true WO2016204341A1 (ko) | 2016-12-22 |
Family
ID=57546066
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/KR2015/009710 Ceased WO2016204341A1 (ko) | 2015-06-19 | 2015-09-16 | 신규한 혈관내피세포 성장인자와 결합할 수 있는 폴리펩타이드 및 이의 용도 |
Country Status (3)
| Country | Link |
|---|---|
| US (1) | US10508138B2 (ko) |
| KR (1) | KR101713944B1 (ko) |
| WO (1) | WO2016204341A1 (ko) |
Families Citing this family (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| KR102390931B1 (ko) * | 2020-02-07 | 2022-04-26 | 한국과학기술원 | 보체 단백 분해 산물 C3a와 결합할 수 있는 신규한 폴리펩타이드 및 이의 용도 |
| KR102886400B1 (ko) * | 2025-04-16 | 2025-11-17 | 주식회사 아윈바이오 | 인터날린 단백질 유래 키메릭 펩티드가 아미노 말단에 융합된 수용성 융합 폴리펩티드 및 이의 용도 |
Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20090082274A1 (en) * | 2000-09-08 | 2009-03-26 | Universitat Zurich | Collections of repeat proteins comprising repeat modules |
| KR20110099600A (ko) * | 2010-03-02 | 2011-09-08 | 한국과학기술원 | 인터날린 단백질의 n-말단 및 lrr 패밀리 단백질이 융합된 수용성 융합 폴리펩타이드 및 이의 제조 방법 |
| KR20130098089A (ko) * | 2012-02-27 | 2013-09-04 | 한국과학기술원 | 인터루킨-6와 결합할 수 있는 신규한 폴리펩타이드 |
| KR20140094837A (ko) * | 2013-01-23 | 2014-07-31 | 한국과학기술원 | 신규한 인터루킨-6 결합 폴리펩타이드 및 이의 용도 |
Family Cites Families (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| KR101654890B1 (ko) | 2013-07-10 | 2016-09-07 | 한국과학기술원 | 면역글로불린 g에 대한 리피바디 및 그 용도 |
-
2015
- 2015-09-04 KR KR1020150125413A patent/KR101713944B1/ko active Active
- 2015-09-16 US US15/737,937 patent/US10508138B2/en active Active
- 2015-09-16 WO PCT/KR2015/009710 patent/WO2016204341A1/ko not_active Ceased
Patent Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20090082274A1 (en) * | 2000-09-08 | 2009-03-26 | Universitat Zurich | Collections of repeat proteins comprising repeat modules |
| KR20110099600A (ko) * | 2010-03-02 | 2011-09-08 | 한국과학기술원 | 인터날린 단백질의 n-말단 및 lrr 패밀리 단백질이 융합된 수용성 융합 폴리펩타이드 및 이의 제조 방법 |
| KR20130098089A (ko) * | 2012-02-27 | 2013-09-04 | 한국과학기술원 | 인터루킨-6와 결합할 수 있는 신규한 폴리펩타이드 |
| KR20140094837A (ko) * | 2013-01-23 | 2014-07-31 | 한국과학기술원 | 신규한 인터루킨-6 결합 폴리펩타이드 및 이의 용도 |
Non-Patent Citations (1)
| Title |
|---|
| FAN ET AL.: "Decorin derived Antiangiogenic Peptide LRR5 inhibits Endothelial Cell Migration by Interfering with VEGF-stimulated NO Release", THE INTERNATIONAL JOURNAL OF BIOCHEMISTRY & CELL BIOLOGY, vol. 40, 2008, pages 2120 - 2128, XP023172826 * |
Also Published As
| Publication number | Publication date |
|---|---|
| US10508138B2 (en) | 2019-12-17 |
| US20180170980A1 (en) | 2018-06-21 |
| KR20160149966A (ko) | 2016-12-28 |
| KR101713944B1 (ko) | 2017-03-09 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| EP2867360B1 (en) | Designed ankyrin repeat proteins binding to platelet-derived growth factor | |
| EA013614B1 (ru) | Изолированное антитело к фактору роста нервов (ngf) и способы его применения | |
| JP7456584B2 (ja) | 腫瘍標的化タンパク質又はその断片、それに結合する抗体及びその使用 | |
| WO2015178689A1 (ko) | 상피세포 성장인자 수용체의 세포외 도메인과 결합하는 신규 폴리펩타이드 | |
| WO2016204341A1 (ko) | 신규한 혈관내피세포 성장인자와 결합할 수 있는 폴리펩타이드 및 이의 용도 | |
| US10017570B2 (en) | Repebody for novel interleukin-6 and use thereof | |
| KR102582417B1 (ko) | 인플라마솜 어댑터 단백질(asc)의 중합체화 도메인에 결합하는 신규한 폴리펩타이드 및 이의 용도 | |
| KR102779666B1 (ko) | TGF-β 신호전달을 억제할 수 있는 신규한 펩타이드 및 이의 용도 | |
| US20150133308A1 (en) | Method for improving repebody containing repeat modules | |
| US10287342B2 (en) | Polypeptide for binding to complement protein C5A, and use of same | |
| KR101517196B1 (ko) | 신규한 인터루킨-6 결합 폴리펩타이드 및 이의 용도 | |
| KR102056386B1 (ko) | 브루톤티로신키나아제의 SH2 도메인(Src homology 2 domain)에 선택적으로 결합하는 신규한 폴리펩티드 및 이의 용도 | |
| KR102231974B1 (ko) | 사람의 프로그램된 세포사멸 단백질(pd-1)에 선택적으로 결합하는 신규한 폴리펩티드 및 이의 용도 | |
| KR102280725B1 (ko) | 인간 b 세포 림프종-2 단백질에 선택적으로 결합하는 신규한 폴리펩타이드 및 이의 용도 | |
| KR101482237B1 (ko) | 항 il-6r 및 tnfr2을 포함하는 이중특이적 단백질을 발현하는 미니서클 벡터를 포함하는 자가 면역 질환 치료용 약학 조성물 | |
| KR101510302B1 (ko) | Il-6 수용체를 표적으로 하는 항체가 생성되도록 미니서클 벡터를 통해 형질전환된 줄기세포 치료제 | |
| CN100467487C (zh) | 具有多种功能的多肽 | |
| KR101510831B1 (ko) | 항 il-6r 및 tnfr2을 포함하는 이중특이적 단백질을 발현하는 미니서클 벡터를 포함하는 줄기세포 치료제 | |
| KR102390931B1 (ko) | 보체 단백 분해 산물 C3a와 결합할 수 있는 신규한 폴리펩타이드 및 이의 용도 | |
| KR101466874B1 (ko) | 자가면역 질환의 예방과 치료를 위한 il-6 수용체에 대한 항체를 발현하는 미니서클 | |
| KR101510830B1 (ko) | 생리활성 단백질을 발현하는 미니서클을 이용하여 형질전환된 줄기세포를 통한 치료법 | |
| CN101812135B (zh) | 具有高效升血小板作用的融合蛋白及其制备方法 | |
| EP1602726A2 (en) | Human tachykinin-related splice variants and compositions thereof | |
| EP1385958A2 (en) | Human tachykinin-related splice variants and compositions thereof |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 15895728 Country of ref document: EP Kind code of ref document: A1 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 15737937 Country of ref document: US |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| 122 | Ep: pct application non-entry in european phase |
Ref document number: 15895728 Country of ref document: EP Kind code of ref document: A1 |