WO2016164835A1 - Humanized influenza monoclonal antibodies and methods of use thereof - Google Patents

Humanized influenza monoclonal antibodies and methods of use thereof Download PDF

Info

Publication number
WO2016164835A1
WO2016164835A1 PCT/US2016/026800 US2016026800W WO2016164835A1 WO 2016164835 A1 WO2016164835 A1 WO 2016164835A1 US 2016026800 W US2016026800 W US 2016026800W WO 2016164835 A1 WO2016164835 A1 WO 2016164835A1
Authority
WO
WIPO (PCT)
Prior art keywords
antibody
seq
acid sequence
binding
amino acid
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2016/026800
Other languages
English (en)
French (fr)
Inventor
Wayne A. Marasco
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Dana Farber Cancer Institute Inc
Original Assignee
Dana Farber Cancer Institute Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to US15/564,897 priority Critical patent/US11135282B2/en
Priority to CN201680033270.XA priority patent/CN107750253B/zh
Priority to CA2981969A priority patent/CA2981969C/en
Priority to JP2017553107A priority patent/JP6960856B2/ja
Priority to AU2016246065A priority patent/AU2016246065B2/en
Priority to EP16716806.1A priority patent/EP3280730B1/en
Priority to KR1020177032200A priority patent/KR102668588B1/ko
Application filed by Dana Farber Cancer Institute Inc filed Critical Dana Farber Cancer Institute Inc
Publication of WO2016164835A1 publication Critical patent/WO2016164835A1/en
Anticipated expiration legal-status Critical
Priority to IL254951A priority patent/IL254951B/en
Priority to US17/405,748 priority patent/US12076390B2/en
Priority to AU2021225240A priority patent/AU2021225240A1/en
Priority to IL286208A priority patent/IL286208A/en
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/12Viral antigens
    • A61K39/145Orthomyxoviridae, e.g. influenza virus
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12Antivirals
    • A61P31/14Antivirals for RNA viruses
    • A61P31/16Antivirals for RNA viruses for influenza or rhinoviruses
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/08Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from viruses
    • C07K16/10RNA viruses
    • C07K16/108Orthomyxoviridae (F), e.g. influenza virus
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/21Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/33Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/34Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565Complementarity determining region [CDR]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • C07K2317/732Antibody-dependent cellular cytotoxicity [ADCC]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value

Definitions

  • This invention relates generally to influenza neutralizing antibodies and methods for use thereof.
  • influenza pandemic represents one of the greatest acute infectious threats to human health. Vaccination remains the principle means of preventing seasonal and pandemic influenza and its complications.
  • a "universal" influenza vaccine that induces broad immunity against multiple subtypes of influenza viruses has been a long sought goal in medical research.
  • the recent discovery of human broadly neutralizing "heterosubtypic" antibodies binding to a highly conserved hydrophobic pocket on the stem of HA (sBnAb) have reignited efforts to develop such a vaccine.
  • sBnAbs only very low concentrations of sBnAbs are detected in the sera of seasonal influenza or H5N1 vaccines, or in commercial intravenous immunoglobulin (IVIG) preparations.
  • the present invention features an isolated recombinantly produced monoclonal antibody wherein the antibody has the following characteristics:, a heavy chain variable region encoded by the IGHV3-30 germline gene;, binds an epitope in the stem region of a hemaggluitinin (HA) protein; and neutralizes group 1 and group 2 influenza A viruses.
  • a heavy chain variable region encoded by the IGHV3-30 germline gene binds an epitope in the stem region of a hemaggluitinin (HA) protein
  • HA hemaggluitinin
  • the monoclonal antibody has one or more of the following characteristics:, a light chain variable region encoded by the IGLV1-44 germline gene; a heavy chain CDR 3 comprising the amino acid sequence of SEQ ID NO: 9; binds uncleaved HAO; prevents HAO cleavage; and/or binds a conformational epitope defined by amino acids 18, 19, 20, 21, 36, 38, 39, 41, 42, 45, 45, 49 and 53 of an HA2 polypeptide when numbered in accordance with SEQ ID NO: 18
  • the present invention features an isolated monoclonal antibody that neutralizes an influenza virus comprising: a heavy chain comprising a CDR1 comprising the amino acid sequence of SEQ ID NO:7; a CDR2 comprising the amino acid sequence of SEQ ID NO: 8 and a CDR3 comprising the amino acid sequence of SEQ ID NO:9; and a light chain comprising a CDR1 comprising the amino acid sequence of SEQ ID NOs: 10 or SEQ ID NO: 14; a CDR2 comprising the amino acid sequence of SEQ ID NO: 11 ; and a CDR3 comprising the amino acid sequence of SEQ ID NO: 12 or SEQ ID NO: 13.
  • the present invention also features an isolated monoclonal antibody wherein said antibody comprises, a VH amino acid sequence of SEQ ID NO: 2 and a VL amino acid sequence of SEQ ID NO: 4 or SEQ ID NO: 6; a VH amino acid sequence of SEQ ID NO: 2 and a VL amino acid sequence of SEQ ID NO: 24; or a VH amino acid sequence of SEQ ID NO: 22 and a VL amino acid sequence of SEQ ID NO: 4 or 6.
  • the antibody binds a conformational epitope defined by amino acids 18, 19, 20, 21, 36, 38, 39, 41, 42, 45, 45, 49 and 53 of an HA2 polypeptide.
  • the antibody is a single chain Fv antibody, an F a fragment, an F a - fragment, or an F (ab ' ) 2 fragment.
  • the antibody is linked to a therapeutic agent.
  • the therapeutic agent is a toxin, a radiolabel, a siRNA, a small molecule, or a cytokine.
  • the present invention also features a composition comprising any of the antibodies disclosed herein, and a carrier.
  • the present invention provides a nucleic acid sequence comprising a nucleic acid sequence selected from SEQ ID NOs: 1, 3, and 5.
  • the present invention provides a vector comprising nucleic acid sequence selected from SEQ ID NOs: 1, 2, 3, 4, 5 and 6.
  • the present invention provides a cell comprising the vector comprising nucleic acid sequences 1, 2, 3, 4, or 6.
  • the present invention further provides a cell producing any of the antibodies disclosed herein.
  • the present invention further provides a method for treating a disease or disorder caused by an influenza virus, by administering to a person at risk of suffering from said disease or disorder, a therapeutically effective amount of any of the monoclonal antibodies described herein.
  • the method further includes administering an antiviral agent.
  • Fig. 1A is a schematic that depicts the isolation of broadly neutralizing Abs against influenza viruses from human memory B cell repertoire. Representative fluorescence-labeled cell sorting (FACS) data are also presented. The FACS data indicate the frequency of H3-reactive memory B cells isolated from total PBMCs.
  • Fig. IB depicts a phylogenetic tree of the 18 HA subtypes of influenza A viruses based on amino-acid sequences. Group 1 subtypes and group 2 subtypes are indicated in the schematic. The amino acid distance scale bar denotes a distance of 0.1.
  • Fig. 2 is a series of FACS graphs that depict 3114 binding to a broad range of group 1 and group 2 HAs.
  • 293T cells were transiently transfected with different HA- expressing plasmids, followed by staining with the purified scFvFc antibodies and APC- labeled mouse anti-human Fc antibody.
  • Binding of 3114 (red line), F10 (group 1-specific, green line), CR8020 (group 2-specific, blue line), FI6v3 (group 1 & 2 specific, purple line), CR9114 (group 1 & 2 specific, orange line), and irrelevant mAb Fm-6 (anti-SARS virus, grey filled histogram) were analyzed by flow cytometry.
  • Fig. 3 is a series of graphs that depicts 3114 IgGl (A) binding (K ⁇ j values) or scFvFc Ab (B) binding (K ⁇ j values) to recombinant HAs that are representative of group 1 (red) or group 2 (blue) subtypes.
  • Fig. 4 is a series of graphs that depicts 3114 IgGl neutralization (A) (IC5 0 values) or 3114 scFvFc Ab neutralization (IC5 0 values) of infectious viruses of group 1 (red) or group 2 (blue) subtypes. 3114 was represented by squares; anti-group 1 mAb F10 was represented by triangles. Graphs used for IC50 values were determined by averaging neutralization titer of 2-3 independent experiments.
  • Fig. 5 is a graph that depicts 3114 IgGl neutralization (A) (IC50 values) or 3114 scFvFc neutralization (B) (IC5 0 values) of pseudoviruses representative of group 1 or group 2 subtypes. These data represent average neutralization titers of 2-3 independent experiments. In Fig.5 B anti -group 1 mAb F10 scFvFc was used for reference.
  • Fig. 6 is a series of graphs that depicts the survival rate (A) of mice exposed to influenza virus and administered purified IgGs intraperioneally at one of the following concentrations, 5, 20, or 25 mg.
  • Fig. 6B is a series of graphs that depict changes in body weight composition in mice that were exposed to influenza virus and administered the specified antibody concentrations indicated.
  • groups of 5 mice were treated with 20/25 or 5 mg/kg doses of purified IgGs given intraperitoneally 24h before lethal challenge by i.n. inoculation with H7N7-NL219, H7N9-AH13, H3N2-BR07 or H5N1- VN04 influenza viruses (-10 LD50).
  • Fig. 7 is a gel that shows the results from a Trypsin Cleavage Inhibition Assay in which no antibody, 3114 or Fm-6 (an IgGl control) was used.
  • H3-BR07 recombinant H3-histidine
  • Tris-HCl buffer pH 8.0 containing 100 ⁇ g/mL Trypsin-ultra (New England Biolabs, USA) at 37°C. Trypsin digestion was inhibited at several time-points by addition of 1% BSA. Samples were run on 12% reduced SDS-PAGE and blotted using a HisProbe-HRP Abs.
  • Fig. 8 is a series of schematics and graphs that depict 3114 IgGl prevented low-pH triggered conformational rearrangements on surface-expressed H3-A268 and H3- BR07.
  • the conformation rearrangements of surface-expressed H3 were detected by FACS staining of 3114 (solid bars) and the head binding control mAb E730 (open bars). Binding is expressed as the percentage of binding to untreated HA (HAO).
  • H3 was pretreated without mAb, with 3114, or with control Ab, Fm-6 IgGl before exposure of the cleaved HAs to pH 4.9. Data represent mean + SD of three independent experiments.
  • FIG. 9A and 9B demonstrate that 3114 mediates Antibody-Dependent Cellular Cytotoxicity (ADCC).
  • Fig. 9A is a graph that depicts the results of the ADCC based assay. 3114 and other anti-stem bnAbs, FI6v3, CR9114, 39.29, F10 and CR8020 induced ADCC in H3- and H5-expressed 293T cells. For these assays, l x l0 4 /well H3 or H5-expressed 293T cells were attached to the plates prior to assay, and the medium was then replaced with low IgG serum assay buffer (RPMI 1640 with 0.5% low IgG FBS).
  • RPMI 1640 low IgG serum assay buffer
  • Fig. 9B is a series of graphs that depict 3114 and other anti-stem bnAbs, FI6v3, CR9114, 39.29, F10 and CR8020 induced ADCC in H3- and H5-expressed 293T cells.
  • Fig. 10 is a series of graphs that depict 3114 cross-competes for the binding of other anti-stem bnAbs, FI6v3, CR9114, 39.29, F10 and CR8020 to H3 or H5.
  • 5 ⁇ g/ml H3-BR07 or H5-VN04 protein was immobilized on ELISA plates and were incubated with a 2-fold serial dilution of 3114 Fab ranging in concentration from 80 nM to 0.3 nM ; these were further mixed with other scFvFc Abs at 5 nM.
  • the binding of scFvFc Abs was detected using HRP conjugated anti-human CH2 antibodies.
  • Fig. 11 depicts an amino acid sequence alignment of 3114 and other germline heavy chain (A, C) or light chain regions (B, D). The corresponding V, D and J sequences were determined using the IMGT database and are shown for comparison.
  • Figs. 12A and 12B is a series of schematics depicting the superimposition of the 3114 model with three VH3-30 BnAbs, 39.29 (from 4KVN), FI6 (from 3ZTJ) and Mab3.1 (4PY8).
  • a protein model schematic is depicted that shows the relative positioning of the heavy and light chain as well as the heavy CDRs of the 3114 antibody. The heavy chain is shown in green and the light chain is in grey.
  • the heavy chain CDRs in Fig. 12 are color coded as follows: 3114 HCDRs as blue, HCDR1 of other BnAbs are red, HCDR2 are magenta and HCDR3 are cyan.
  • the bnAbs are displayed in ribbon representations.
  • the heavy chain is in blue and the light chain is in cyan.
  • the HCDR3s are highlighted with 3114 in red, FI6v3 in magenta, 39.29 in yellow and MAb 3.1 in green.
  • Figs. 13 A-D are a series schematics that depict modeling of 3114 and docking with H3/H5.
  • the 3114 epitope structure on the stalk of H3 trimer models is depicted in Fig. 13A.
  • Fig. 13B depicts the complex structures of IGVH3-30-derived bnAbs with HAs.
  • the epitope residues on the HAs are displayed in surface representation and the CDR loops of bnAbs are shown are shown as ribbons.
  • HA1 of HA monomer is in wheat, HA2 is in salmon, and epitope residues are labeled as red.
  • the key residues L38 and K39 are colored in yellow.
  • Heavy chain CDRs of bnAbs are in blue and light chain CDRs are in cyan.
  • 3114 was homology modeled using the antibody-modeling module in BioLuminate and the model was superimposed to H3/FI6v3 complex structure before docking with RosettaDock.
  • Other three IGHV3-30 bnAbs, FI6v3, 39.29 and MAb 3.1 were downloaded from Protein Data Bank.
  • Fig. 13C depicts the interaction of D94 in 3114 with H3/H5.
  • H3 is shown in cyan with K39 shown as stick;
  • H5 is shown in green with E39 shown in stick;
  • 3114 is shown in orange in H3/3I14 model and in yellow in H5/3I14 model with D94 shown as stick.
  • 13D depicts the interactions of G31 of the 3114 light chain with H3 in the H3/3I14 complex model.
  • the helix A of HA2 domain of H3 is shown as ribbon in cyan; the light chain of 3114 is shown as ribbon in orange; the main chain atoms of G31 are shown in stick and the side chain atoms of Q42 and D46 of H3 HA2 are shown in stick; the distance between G31 and H3 are illustrated by green dash lines and labeled in black.
  • Fig. 14 depicts a sequence alignment (A) and structure superposition of H3/3I14 and H5/3I14 models (B).
  • Figs. 15A-15F is a graph and a table that depicts K ⁇ j binding values of 3114 WT and the VLD94N IgGl variants binding to recombinant H5-VN04 (A) and H3-PE09 (B). Green or blue curves are the experimental trace obtained from biolayer interferometry experiments, and red curves are the best global fits to the data used to calculate the K ⁇ j values. Affinity measurements (Kd values) for the binding curves are reported in Table 4. 3114 WT bound purified H5-VN04 with Kj value at 1.15 nM, while 3114 VLD94N mutant bound H5-VN04 with 10-fold higher affinity at 0.19 nM.
  • Fig. 15 C-F are a series of graphs that depict 3114 scFvFc binding to recombinant Ha.
  • Fig. 16A-D are a series of graphs that depict neutralization values of 3114 WT and VLD94N mutant IgGl following incubation with pseudotyped virus H5N1-VN04 and infectious virus H3N2-BR07. Depicted in Figs. 16C and 16D, the 3114 (black) and VLD94N variant (red) neutralized pseudotyped virus H5N1-VN04 (C) and H3N2-BR07 virus (D). This data represent average neutralization titers of 2-3 independent experiments.
  • Fig. 17 is a series of graphs that depict 3114 scFvFc Ab neutralized influenza viruse infection and HA-pseudotyped luciferase reporter viruses.
  • MAb 3114 black
  • Anti -group 1 mAb F10 red
  • the data represent average neutralization titers from 2-3 independent experiments.
  • Fig. 18 is a series of flow cytometry graphs that depicts binding of 3I14-WT yeast in comparison to binding of the engineered 3114 yeast-CDR library to H5.
  • the 3114 yeast-CDR library was engineered using yeast display for variants that increase binding to H5.
  • Fig. 19 is a graph that depicts 3114 scFvFc Ab binding to full-length or HA1 of recombinant H3-PE09.
  • Fig. 20 is a series of graphs that depict binding of the 3114 IgGl variants to recombinant HI, H3 and H5. Blue curves are the experimental trace obtained from biolayer interferometry experiments, and red curves are the best global fits to the data used to calculate the IQs presented in Table 7.
  • Influenza A is a negative-sense, single-stranded RNA virus, with an eight- segment genome encoding 10 proteins. It belongs to the family Orthomyxoviridae which includes the genera of influenza virus A, B and C as defined by the antigenicity of the nucleocapsid and matrix proteins. Generally, influenza A virus is associated with more severe disease in humans. Influenza A virus is further subtyped by two surface proteins, hemagglutinin (HA) which attaches the virion to the host cell for cell entry, and neuraminidase (NA) which facilitates the spread of the progeny virus by cleaving the host sialic acid attached to the progeny virus or cell surface.
  • HA hemagglutinin
  • NA neuraminidase
  • HA subtypes and 9 NA subtypes which make up all subtypes of influenza A viruses by various combinations of HA and NA. All combinations of the 16 HA and 9 NA virus subtypes are found in water fowl. Of the hundreds of strains of avian influenza A viruses, only four are known to have caused human infections: H5N1, H7N3, H7N7 and H9N2. In general, human infection with these viruses has resulted in mild symptoms and very little severe illness: there has been only one fatal case of pneumonia caused by H7N7. However, the exception is the highly pathogenic H5N1 virus, for which there is no natural immunity in humans.
  • RNA polymerase and the selective pressure of host immunity can lead to the accumulation of mutations and change in surface antigenicity of these proteins. This antigenic change is called antigenic drift.
  • shuffling of gene segments can occur if two different subtypes of influenza A virus infect the same cell. For example, if a human H3N2 virus and an avian H5N1 virus co-infect a human or other member of a mammalian species, such an event can produce a novel H5N2. This novel virus can then be efficiently transmitted from human to human because all of most of the gene segments come from the human virus.
  • Influenza virus hemagglutinin is the most variable antigen of influenza virus, and is responsible for virus entry into cells. It is synthesized as a trimeric precursor polypeptide HA0 which is post-translationally cleaved to two polypeptides HAl and HA2 linked by a single disulphide bond. The HAl chain of HA is responsible for the attachment of virus to the cell surface. HA2 mediates the fusion of viral and cell membranes in endosomes, allowing the release of the ribonucleoprotein complex into the cytoplasm. In contrast to HAl, the HA2 molecule represents a relatively conserved part of HA.
  • a second immunogenic influenza protein is neuraminidase (NA).
  • This tetrameric glycoprotein is responsible for releasing virions from surface sialic acid on producer cells, and may also have a role in promoting access to target cells in the airways.
  • neutralizing antibodies against NA are protective in animals and man, there is a paucity of data on their mechanisms of action.
  • a recent report on the crystal structure of Nl neuraminidase demonstrated the presence of a cavity adjacent to its active site that may be exploited to develop new anti-influenza drugs, including antibodies. This finding is particularly important in light of the reports of emergence of drug resistance to oseltamivir (Tamiflu) and zanamivir (Relenza) for H5N1 viruses.
  • the HA molecule of the H3 subtype was characterized by sequencing the HA of antigenic drift variants and escape mutants, and the antigenic epitopes were mapped on the molecule's three-dimensional structure. Since then, the antigenic sites on HI, H2 and H5 of an avian pathogenic virus were mapped on the three-dimensional structures of H3. After the outbreak of H5N1 infection in humans in Hong Kong in 1997 and the isolation of H9N2 virus from human cases in 1999, the X-ray structures of both proteins were solved. However, antigenic drift of the 1997 swine isolate (A/Duck/Singapore/3/97) that was used to solve the structure, and more recently isolated highly pathogenic strains, is significant. Indeed, there are 28 minor changes and two potentially major changes between the swine isolate (A/Duck/Singapore/3/97) and the HPAI H5N1 strain (A/Vietnaml 203/04).
  • HPAI H5N1 strain (A/Vietnaml 203/04) is a member of clade 1. Viruses in each of these clades are distributed in non-overlapping geographic regions of Asia. The H5N1 viruses from Indochina are tightly clustered within clade 1, whereas H5N1 isolated from several surrounding countries are distinct from clade 1 isolates, and belong in a more divergent clade 2. Clade 1 viruses were isolated from humans and birds in Vietnam, Thailand and Cambodia but only from birds in Laos and Malaysia.
  • the clade 2 viruses were found in viruses isolated exclusively from birds in China, Indonesia, Japan, and South Korea.
  • the most recent epidemiologic studies analyzed 82 H5N1 viruses isolated from poultry throughout Indonesia and Vietnam, as well as 11 human isolates from southern Vietnam together with sequence data available in public databases, to address questions relevant to virus introduction, endemicity and evolution 36 .
  • Phylogenetic analysis showed that all viruses from Indonesia form a distinct sublineage of H5N1 genotype Z viruses, suggesting that this outbreak likely originated from a single introduction via spread throughout the country during the past two years.
  • Continued virus activities in Indonesia were attributed to transmission via poultry movement within the country, rather than through repeated introductions by bird migration.
  • H5N1 viruses have evolved over time into geographically distinct groups within each country.
  • Escape mutants of H5 HAs can be clustered into three epitopes; site 1 : an exposed loop (HA1 140-145) that overlaps antigenic sites A of H3 and Ca2 of H 2 ; site 2: HA1 residues 156 and 157 that corresponds to antigenic site B in H3 serotypes; and 3) HA1 129-133, which is restricted to the Sa site in HI HAs and H9 serotypes.
  • site 1 an exposed loop (HA1 140-145) that overlaps antigenic sites A of H3 and Ca2 of H 2
  • site 2 HA1 residues 156 and 157 that corresponds to antigenic site B in H3 serotypes
  • 3) HA1 129-133 which is restricted to the Sa site in HI HAs and H9 serotypes.
  • residues include five in antigenic sites A and E (positions 83, 86, 138, 140 and 141); two involved in receptor binding (positions 129 and 175); and positions 156 is a site for potential N-linked glycosylation that is near the receptor-binding site.
  • positions 156 is a site for potential N-linked glycosylation that is near the receptor-binding site.
  • Antigen-specific memory B cells were isolated from human PBMCs using tetramerized H3 (A/Brisbane/10/2007) hemagglutinin (HA) trimers.
  • the H3-reactive single memory B cells were sorted into plates and stimulated in vitro. More than 40% sorted B cells produced on average 200 ng/ml IgG in the supernatant after 14 days.
  • anti-influenza antibodies FI6v3, CR9114, 39.39, MAb 1.12 and CT149 are capable of neutralizing human influenza A viruses from both group 1 and group 2.
  • the antibodies of the present invention e.g. 3114, were isolated from memory B-cells.
  • long-lived plasma cells produce neutralizing antibodies, specifically recalling the original virus, whereas the memory B cells contribute by producing high-affinity neutralizing antibodies specific for the variant virus by re-entering germinal centers.
  • memory B cells have a broader repertoire of antigen specificity than long-lived plasma cells. It is considered essential for a long-lasting, broadly efficacious vaccine to develop the stable population of memory B cells and elicit potent bnAb responses. Accordingly the antibodies of the present invention will have greater therapeutic utility than the other known anti-influenza antibodies.
  • the antibody of the invention binds surface-expressed HAs across serotypes of both group 2 (H3, H4, H7, H14 and H15) and group 1 (HI, H2, H5, H6, H8, H9, HI 1, H12 and H16) influenza A.
  • the binding affinity (Kd) of the antibodies of the invention is between about lpM to ⁇ , between about lpM to InM or between about InM to ⁇ ⁇ .
  • the antibody has binding affinity to group 1 (HI, H5, and H9) and group 2 (H3, H4, H7 and H17) of between about lpM to ⁇ ⁇ .
  • the binding affinity to group 1 (HI, H5, and H9) and group 2 (H3, H4, H7 and HI 7) the Kd is about O.OlnM to ⁇ .
  • the antibody has a binding affinity to group 2 HAs (H3, H4, H7 and H14) of between about lpM to ⁇ for group 2 influenza A viruses.
  • the binding affinity to group 2 HAs (H3, H4, H7 and H14) the Kd is ⁇ lnM.
  • 3114 bound purified HA proteins of different subtypes that belong to group 2 (H3, H4, H7 and H14) and group 1 (HI, H5 and H9) with dissociation constants (IQ) ranging from 0.01 nM to 10 nM and to all tested group 2 HAs (H3, H4, H7 and HI 4) with high affinity (mean K ⁇ j ⁇ 0.1 nM).
  • IQ dissociation constants
  • This lower binding affinity to H5 influenza viral subtypes is unlike other broadly neutralizing antibodies previously describe such as FI6v3 and 39.29.
  • the antibody of the invention neutralizes influenza A virus .
  • neutralize or “neutralization” is meant cause a reduction in viral infectivity by the binding of the antibody to the viral particles, thus blocking a step in the replication cycle of the virus that precedes virally encoded transcription or synthesis.
  • the antibody may neutralize virus by various mechanisms, for example, the antibody may neutralize a virus by interfering with a virion binding to a receptor, block uptake into cells, prevent uncoating of the genomes in endosomes, or can cause the virus particles to aggregate, or lyse.
  • the antibody of the invention neutralizes across serotypes of both group 2 and group 1 influenza A virus.
  • the antibody of the invention has a half maximal inhibitory concentration (IC50) of between about 0.001 to 5 ⁇ g/mL "1 , between about 0.001 to 4 ⁇ g/mL "1 or between about 0.001 to 3 ⁇ g/mL "1 .
  • IC50 half maximal inhibitory concentration
  • the antibody has an IC50 of between about 0.03 to 2 ⁇ g/mL, between about 0.03 to 1.0 ⁇ g/mL "1 .
  • the antibody has an IC50 of between about 0.001 to O ⁇ g/mL "1 , between about 0.001 to 0.05 ⁇ g/mL "1 , or between about 0.001 to 0.03 ⁇ g/mL "1 . Even more preferably, the antibody has a IC50 of between about 0.01 and 0.5 ⁇ g/mL “1 , between about 0.1 and 0.5 ⁇ g/mL "1 ,and between about 0.2 and 0.5 ⁇ g/mL “1 . Preferably, the antibody has a IC50 of between about 0.05 and 0.008 ⁇ g/mL "1 , and between about 0.04 and 0.008 ⁇ g/mL "1 .
  • the antibody has a IC50 of between about 0.03 to 1.08 ⁇ g/mL "1 , between about 0.007 to 0.027 ⁇ g ml "1 , between about 0.225 and 0.413 ⁇ g ml _1 or between about 0.040 and 0.008 ⁇ g ml "1
  • the antibody of the invention of neutralize group 2 viruses e.g.
  • the antibody of the invention also neutralizes pseudoviruses H7N1-FPN and H7N1-NL219 strains.
  • the antibodies of the invention neutralizes group 1 HI stains (H1-CA09 and H1-PR8) and pseudoviruses H5- VN04 and H5-HK97
  • the antibody of the invention has prophylactic efficacy against both group 1 and group 2 influenza A viruses in vivo.
  • the antibody of the invention provides 50%, 60%, 70%, 80%, 90%, 95% or 100% prophylactic protection against viral infection.
  • the antibody of the invention fully protects from H7N7-NL219 or H7N9-AH13 challenge 80% protection against a H3N2-BR07 challenge and 60% protection against a H5N1-VN04 challenge.
  • the antibody of the invention prevents cleavage of immature HA0. If the
  • HA0 protein is not cleaved to form HA1 and HA2, virus-host membrane fusion cannot occur. Therefore influenza viruses with uncleaved HA are not infectious.
  • the abtibodies of the invention are useful for blocking influenza infection and there for may be used in combination with other anti-viral agent, such as for example Tamiflu.
  • the antibody of the invention binds uncleaved HA precursor
  • HA0 HA1 protein and the two mature forms HA1 protein and HA2 protein
  • the antibody of the invention prevents low pH-triggered HA conformational rearrangements.
  • the antibody mediates Fc-dependent viral clearance.
  • the antibody enhances antibody-dependent cellular cytotoxicity (ADCC).
  • ADCC antibody-dependent cellular cytotoxicity
  • the antibody engages an Fc-dependent immune-mediated mechanism for in vivo protection.
  • variable heavy chain of the antibody of the invention is encoded by the IGHV3-30 germline gene.
  • the variable light chain of the antibody is encoded by the IGLV1-44 germline gene.
  • IGHV3-30 antibodies use HCDR3 to form a hydrophobic core that contributes to HA binding.
  • the antibody has a rearranged heavy chain such as to produce a long complementarity determining region 3 (HCDR3).
  • the length of the long HCDR3 can be between about 12 to 30 amino acids (e.g. 12, 13, 14, 15, 16, 17, 18, 19, 20,
  • the long HCDR 3 is about 23 amino acids in length.
  • the long HCDR3 uses the IGHD3- 22*01 DH segment flanked by large N-additions at both VH and IGHJ4*02 junctions.
  • the antibody has somatic mutations in the variable heavy chain and/or the variable light chain.
  • the number of somatic mutations in the variable heavy chain can be between about 2 to 30 (e.g. 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21,
  • the number of somatic mutations in the variable heavy chain is about 15.
  • the number of somatic mutations in the variable light chain can be between about 2 and 15 (e.g. 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15). In some embodiments, the number of somatic mutations is about 7.
  • the antibodies of the invention bind a conformational epitope defined by amino acids residues 18, 19, 20, 21, 36, 38, 39, 41, 42, 45, 46, 49 and 53 of HA2 when numbered in accordance with SEQ ID NO: 18.
  • the antibodies of the invention bind a conformational epitope defined by amino acids residues 18, 19, 20, 21, 38, 39, 41, 42, 45, 46, 47, 48, 49 and 50 of HA2 when numbered in accordance with SEQ ID NO: 18.
  • the antibody binds HAL
  • 3I14VLD94N This high affinity variant of 3114 is referred to herein as 3I14VLD94N and was produced by an Aspartic acid (D) to Asparagine (N) amino acid substitution in the 3114 VH at amino acid position 9.
  • VLD94L substitution allows for or increases the antibody's binding to H5.
  • the increase in binding affinity to H5 is between about 5 to 15-fold compared to wild- type 3114.
  • the Kd for the 3I14V L D94N to H5-VN04 is about less than 0.2 nM.
  • Additional structure based engineering can increase the binding affinity to H5 Specifically, increases binding affinity to H5 is achieved by substitution of glycine (G) at residue 31 in the LCDR1 with another amino acid.
  • glycine (G) at residue 31 can be substituted with a serine (S).
  • nucleic acid and amino acid sequence of the neutralizing influenza antibodies according to the invention are provided below:
  • V H chain of 3114 (SEQ ID NO: l)
  • V L chain of 3114 (SEQ ID NO:3)
  • V H chain of 3114 (SEQ ID NO: 2)
  • V L chain of 3114 (SEQ ID NO:4)
  • V L chain of 3I14V L D94N (SEQ ID NO:5)
  • V L chain of 3I14V L D94N (SEQ ID NO:6)
  • X can be any amino acid other than glycine.
  • X is a serine.
  • H2N2 HA2 amino acid sequence— SEQ ID NO: 17 GLFGAIAGFIEGGWQGMVDGWYGYHHSNDQGSGYAADKESTQKAFDGITN KVNSVIEKMNTQFEAVGKEFGNLERRLENLNKRMEDGFLDVWTYNAELLVL MENERTLDFHDSNVK LYDKVRMQLRDNVKELGNGCFEFYHKCDDECMNS VK GTTDYPKYEEESKLNRNEIKGVKLSSMGVYQILAIYATVAGSLSLAIMM
  • antibody refers to immunoglobulin molecules and immunologically active portions of immunoglobulin (Ig) molecules, i.e. , molecules that contain an antigen binding site that specifically binds (immunoreacts with) an antigen.
  • immunoglobulin immunoglobulin
  • immunoglobulin immunoglobulin molecules
  • an antigen binding site that specifically binds (immunoreacts with) an antigen.
  • specifically binds" or “immunoreacts with” is meant that the antibody reacts with one or more antigenic determinants of the desired antigen and does not react with other polypeptides.
  • Antibodies include, but are not limited to, polyclonal, monoclonal, chimeric, dAb (domain antibody), single chain, F a , F a - and F (ab ' ) 2 fragments, scFvs, and F ⁇ expression libraries.
  • a single chain Fv (“scFv”) polypeptide molecule is a covalently linked VH : :VL heterodimer, which can be expressed from a gene fusion including VH- and VL- encoding genes linked by a peptide-encoding linker.
  • VH VH
  • VL VL heterodimer
  • a number of methods have been described to discern chemical structures for converting the naturally aggregated, but chemically separated, light and heavy polypeptide chains from an antibody V region into an scFv molecule, which will fold into a three dimensional structure substantially similar to the structure of an antigen- binding site. See, e.g., U.S. Patent Nos. 5,091,513; 5,132,405; and 4,946,778.
  • the light chain may be a kappa chain or a lambda chain.
  • the antibody is IgGi or IgGi.
  • the antibody is a chimeric antibody.
  • Chimeric antibodies are produced by pairing mature antibody heavy chain with germline light chain (mHgL) or by pairing germline heavy chain with mature light chain (gHmL).
  • the chimeric antibodies have increased binding affinity (Kd) in comparison to the wild type (WT) antibody.
  • the binding affinity of the mHgL and gHmL chimeric variants to certain viruses can have a binding affinity of about less than O.OOlnM.
  • the binding affinity (Kd) of the mHgL and gHmL chimeric variants is less than is found in the WT antibody (e.g. for viruses H5-VN04 and H3-PE09).
  • the binding affinity of the mHgL and gHmL chimeric variants is about the same as the binding affinity of the WT antibody.
  • antigen binding site or "binding portion” refers to the part of the immunoglobulin molecule that participates in antigen binding.
  • the antigen binding site is formed by amino acid residues of the N-terminal variable ("V") regions of the heavy ("H") and light (“L”) chains.
  • V N-terminal variable
  • H heavy
  • L light
  • FR framework regions
  • hypervariable regions of a light chain and the three hypervariable regions of a heavy chain are disposed relative to each other in three dimensional space to form an antigen-binding surface.
  • the antigen-binding surface is complementary to the three-dimensional surface of a bound antigen, and the three hypervariable regions of each of the heavy and light chains are referred to as "complementarity-determining regions,” or "CDRs.”
  • epitopic includes any protein determinant capable of specific binding to an immunoglobulin, an scFv, or a T-cell receptor. Epitopic
  • determinants usually consist of chemically active surface groupings of molecules such as amino acids or sugar side chains and usually have specific three dimensional structural characteristics, as well as specific charge characteristics.
  • antibodies may be raised against N-terminal or C-terminal peptides of a polypeptide.
  • immunological binding and “immunological binding properties” refer to the non-covalent interactions of the type which occur between an immunoglobulin molecule and an antigen for which the immunoglobulin is specific.
  • the strength, or affinity of immunological binding interactions can be expressed in terms of the dissociation constant (K ⁇ j) of the interaction, wherein a smaller K ⁇ j represents a greater affinity.
  • Immunological binding properties of selected polypeptides can be quantified using methods well known in the art.
  • One such method entails measuring the rates of antigen- binding site/antigen complex formation and dissociation, wherein those rates depend on the concentrations of the complex partners, the affinity of the interaction, and geometric parameters that equally influence the rate in both directions.
  • both the "on rate constant” (K ⁇ , N ) and the “off rate constant” (K O H) can be determined by calculation of the concentrations and the actual rates of association and dissociation. (See Nature 361 : 186-87 (1993)).
  • the ratio of K o g- /K ⁇ , n enables the cancellation of all parameters not related to affinity, and is equal to the dissociation constant K ⁇ j.
  • An antibody of the present invention is said to specifically bind to a influenza epitope when the equilibrium binding constant (K ⁇ j) is 1 ⁇ , preferably 100 nM, more preferably 10 nM, and most preferably 100 pM to about 1 pM, as measured by assays such as radioligand binding assays or similar assays known to those skilled in the art.
  • K ⁇ j equilibrium binding constant
  • influenza protein e.g. , HA or neuramindase
  • HA or neuramindase a derivative, fragment, analog, homolog or ortholog thereof
  • an immunogen in the generation of antibodies that immunospecifically bind these protein components.
  • a human monoclonal antibody has the same specificity as a human monoclonal antibody of the invention by ascertaining whether the former prevents the latter from binding to the HA protein of the influenza virus. If the human monoclonal antibody being tested competes with the human monoclonal antibody of the invention, as shown by a decrease in binding by the human monoclonal antibody of the invention, then it is likely that the two monoclonal antibodies bind to the same, or to a closely related, epitope.
  • Another way to determine whether a human monoclonal antibody has the specificity of a human monoclonal antibody of the invention is to pre-incubate the human monoclonal antibody of the invention with the influenza HA protein, with which it is normally reactive, and then add the human monoclonal antibody being tested to determine if the human monoclonal antibody being tested is inhibited in its ability to bind the HA protein. If the human monoclonal antibody being tested is inhibited then, in all likelihood, it has the same, or functionally equivalent, epitopic specificity as the monoclonal antibody of the invention. Screening of human monoclonal antibodies of the invention, can be also carried out by utilizing the influenza virus and determining whether the test monoclonal antibody is able to neutralize the influenza virus.
  • Antibodies can be purified by well-known techniques, such as affinity chromatography using protein A or protein G, which provide primarily the IgG fraction of immune serum. Subsequently, or alternatively, the specific antigen which is the target of the immunoglobulin sought, or an epitope thereof, may be immobilized on a column to purify the immune specific antibody by immunoaffinity chromatography. Purification of immunoglobulins is discussed, for example, by D. Wilkinson (The Engineer, published by The Engineer, Inc., Philadelphia PA, Vol. 14, No. 8 (April 17, 2000), pp. 25-28).
  • the complementarity determining regions (CDRs) of the monoclonal antibody are identical in all the molecules of the population.
  • MAbs contain an antigen binding site capable of immunoreacting with a particular epitope of the antigen characterized by a unique binding affinity for it.
  • Monoclonal antibodies can be prepared using hybridoma methods, such as those described by Kohler and Milstein, Nature, 256:495 (1975).
  • a hybridoma method a mouse, hamster, or other appropriate host animal, is typically immunized with an immunizing agent to elicit lymphocytes that produce or are capable of producing antibodies that will specifically bind to the immunizing agent.
  • the lymphocytes can be immunized in vitro.
  • the immunizing agent will typically include the protein antigen, a fragment thereof or a fusion protein thereof.
  • peripheral blood lymphocytes are used if cells of human origin are desired, or spleen cells or lymph node cells are used if non-human mammalian sources are desired.
  • the lymphocytes are then fused with an immortalized cell line using a suitable fusing agent, such as polyethylene glycol, to form a hybridoma cell (Goding, Monoclonal Antibodies: Principles and Practice. Academic Press, (1986) pp. 59-103).
  • Immortalized cell lines are usually transformed mammalian cells, particularly myeloma cells of rodent, bovine and human origin. Usually, rat or mouse myeloma cell lines are employed.
  • the hybridoma cells can be cultured in a suitable culture medium that preferably contains one or more substances that inhibit the growth or survival of the unfused, immortalized cells.
  • a suitable culture medium that preferably contains one or more substances that inhibit the growth or survival of the unfused, immortalized cells.
  • the culture medium for the hybridomas typically will include hypoxanthine, aminopterin, and thymidine ("HAT medium"), which substances prevent the growth of HGPRT-deficient cells.
  • Preferred immortalized cell lines are those that fuse efficiently, support stable high level expression of antibody by the selected antibody-producing cells, and are sensitive to a medium such as HAT medium. More preferred immortalized cell lines are murine myeloma lines, which can be obtained, for instance, from the Salk Institute Cell Distribution Center, San Diego, California and the American Type Culture Collection, Manassas, Virginia. Human myeloma and mouse-human heteromyeloma cell lines also have been described for the production of human monoclonal antibodies. (See Kozbor, J. Immunol, 133:3001 (1984); Brodeur et al, Monoclonal Antibody Production Techniques and Applications, Marcel Dekker, Inc., New York, (1987) pp. 51-63)).
  • the culture medium in which the hybridoma cells are cultured can then be assayed for the presence of monoclonal antibodies directed against the antigen.
  • the binding specificity of monoclonal antibodies produced by the hybridoma cells is determined by immunoprecipitation or by an in vitro binding assay, such as
  • RIA radioimmunoassay
  • ELISA enzyme-linked immunoabsorbent assay
  • Suitable culture media for this purpose include, for example, Dulbecco's Modified Eagle's Medium and RPMI-1640 medium.
  • the hybridoma cells can be grown in vivo as ascites in a mammal.
  • the monoclonal antibodies secreted by the subclones can be isolated or purified from the culture medium or ascites fluid by conventional immunoglobulin purification procedures such as, for example, protein A-Sepharose, hydroxylapatite chromatography, gel electrophoresis, dialysis, or affinity chromatography.
  • Monoclonal antibodies can also be made by recombinant DNA methods, such as those described in U.S. Patent No. 4,816,567.
  • DNA encoding the monoclonal antibodies of the invention can be readily isolated and sequenced using conventional procedures (e.g. , by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of murine antibodies).
  • the hybridoma cells of the invention serve as a preferred source of such DNA.
  • the DNA can be placed into expression vectors, which are then transfected into host cells such as simian COS cells, Chinese hamster ovary (CHO) cells, or myeloma cells that do not otherwise produce immunoglobulin protein, to obtain the synthesis of monoclonal antibodies in the recombinant host cells.
  • host cells such as simian COS cells, Chinese hamster ovary (CHO) cells, or myeloma cells that do not otherwise produce immunoglobulin protein, to obtain the synthesis of monoclonal antibodies in the recombinant host cells.
  • the DNA also can be modified, for example, by substituting the coding sequence for human heavy and light chain constant domains in place of the homologous murine sequences (see U.S. Patent No. 4,816,567; Morrison, Nature 368, 812-13 (1994)) or by covalently joining to the immunoglobulin coding sequence all or part of the coding sequence for a non-immunoglobulin polypeptide.
  • non-immunoglobulin polypeptide can be substituted for the constant domains of an antibody of the invention, or can be substituted for the variable domains of one
  • Fully human antibodies are antibody molecules in which the entire sequence of both the light chain and the heavy chain, including the CDRs, arise from human genes. Such antibodies are termed “human antibodies”, or “fully human antibodies” herein.
  • Human monoclonal antibodies can be prepared by using trioma technique; the human B-cell hybridoma technique (see Kozbor, et al, 1983 Immunol Today 4: 72); and the EBV hybridoma technique to produce human monoclonal antibodies (see Cole, et al, 1985 In: MONOCLONAL ANTIBODIES AND CANCER THERAPY, Alan R. Liss, Inc., pp. 77-96). Human monoclonal antibodies may be utilized and may be produced by using human hybridomas (see Cote, et al, 1983. Proc Natl Acad Sci USA 80: 2026-2030) or by transforming human B-cells with Epstein Barr Virus in vitro (see Cole, et al, 1985 In: MONOCLONAL
  • human antibodies can also be produced using additional techniques, including phage display libraries. (See Hoogenboom and Winter, J. Mol. Biol, 227:381 (1991); Marks et al, J. Mol. Biol, 222:581 (1991)).
  • human antibodies can be made by introducing human immunoglobulin loci into transgenic animals, e.g., mice in which the endogenous immunoglobulin genes have been partially or completely inactivated. Upon challenge, human antibody production is observed, which closely resembles that seen in humans in all respects, including gene rearrangement, assembly, and antibody repertoire. This approach is described, for example, in U.S. Patent Nos.
  • Human antibodies may additionally be produced using transgenic nonhuman animals which are modified so as to produce fully human antibodies rather than the animal's endogenous antibodies in response to challenge by an antigen.
  • transgenic nonhuman animals which are modified so as to produce fully human antibodies rather than the animal's endogenous antibodies in response to challenge by an antigen.
  • the endogenous genes encoding the heavy and light immunoglobulin chains in the nonhuman host have been incapacitated, and active loci encoding human heavy and light chain immunoglobulins are inserted into the host's genome.
  • the human genes are incorporated, for example, using yeast artificial chromosomes containing the requisite human DNA segments.
  • An animal which provides all the desired modifications is then obtained as progeny by crossbreeding intermediate transgenic animals containing fewer than the full complement of the modifications.
  • the preferred embodiment of such a nonhuman animal is a mouse, and is termed the
  • XenomouseTM as disclosed in PCT publications WO 96/33735 and WO 96/34096.
  • This animal produces B cells which secrete fully human immunoglobulins.
  • the antibodies can be obtained directly from the animal after immunization with an immunogen of interest, as, for example, a preparation of a polyclonal antibody, or alternatively from immortalized B cells derived from the animal, such as hybridomas producing monoclonal antibodies.
  • the genes encoding the immunoglobulins with human variable regions can be recovered and expressed to obtain the antibodies directly, or can be further modified to obtain analogs of antibodies such as, for example, single chain Fv (scFv) molecules.
  • scFv single chain Fv
  • U.S. Patent No. 5,939,598 An example of a method of producing a nonhuman host, exemplified as a mouse, lacking expression of an endogenous immunoglobulin heavy chain is disclosed in U.S. Patent No. 5,939,598. It can be obtained by a method, which includes deleting the J segment genes from at least one endogenous heavy chain locus in an embryonic stem cell to prevent rearrangement of the locus and to prevent formation of a transcript of a rearranged immunoglobulin heavy chain locus, the deletion being effected by a targeting vector containing a gene encoding a selectable marker; and producing from the embryonic stem cell a transgenic mouse whose somatic and germ cells contain the gene encoding the selectable marker.
  • One method for producing an antibody of interest is disclosed in U.S. Patent No. 5,916,771.
  • This method includes introducing an expression vector that contains a nucleotide sequence encoding a heavy chain into one mammalian host cell in culture, introducing an expression vector containing a nucleotide sequence encoding a light chain into another mammalian host cell, and fusing the two cells to form a hybrid cell.
  • the hybrid cell expresses an antibody containing the heavy chain and the light chain.
  • the antibody can be expressed by a vector containing a DNA segment encoding the single chain antibody described above.
  • Vectors can include vectors, liposomes, naked DNA, adjuvant-assisted DNA, gene gun, catheters, etc.
  • Vectors include chemical conjugates such as described in WO 93/64701, which has targeting moiety (e.g. a ligand to a cellular surface receptor), and a nucleic acid binding moiety (e.g. polylysine), viral vector (e.g. a DNA or RNA viral vector), fusion proteins such as described in PCT/US 95/02140 (WO 95/22618) which is a fusion protein containing a target moiety (e.g. an antibody specific for a target cell) and a nucleic acid binding moiety (e.g.
  • retroviral vectors include moloney murine leukemia viruses. DNA viral vectors are preferred. These vectors include pox vectors such as orthopox or avipox vectors, herpesvirus vectors such as a herpes simplex I virus (HSV) vector (see Geller, A. I. et al, J. Neurochem, 64:487 (1995); Lim, F., et al, in DNA Cloning: Mammalian Systems, D. Glover, Ed. (Oxford Univ.
  • HSV herpes simplex I virus
  • Pox viral vectors introduce the gene into the cells cytoplasm.
  • Avipox virus vectors result in only a short term expression of the nucleic acid.
  • Adenovirus vectors, adeno-associated virus vectors and herpes simplex virus (HSV) vectors are preferred for introducing the nucleic acid into neural cells.
  • the adenovirus vector results in a shorter term expression (about 2 months) than adeno-associated virus (about 4 months), which in turn is shorter than HSV vectors.
  • the particular vector chosen will depend upon the target cell and the condition being treated.
  • the introduction can be by standard techniques, e.g. infection, transfection, transduction or transformation. Examples of modes of gene transfer include e.g., naked DNA, CaP0 4 precipitation, DEAE dextran, electroporation, protoplast fusion, lipofection, cell microinjection, and viral vectors.
  • the vector can be employed to target essentially any desired target cell.
  • stereotaxic injection can be used to direct the vectors (e.g. adenovirus, HSV) to a desired location.
  • the particles can be delivered by intracerebroventricular (icv) infusion using a minipump infusion system, such as a SynchroMed Infusion System.
  • icv intracerebroventricular
  • a method based on bulk flow, termed convection has also proven effective at delivering large molecules to extended areas of the brain and may be useful in delivering the vector to the target cell. (See Bobo et al, Proc. Natl. Acad. Sci. USA 91 :2076-2080 (1994);
  • These vectors can be used to express large quantities of antibodies that can be used in a variety of ways. For example, to detect the presence ofan influenza virus in a sample. The antibody can also be used to try to bind to and disrupt influenza virus cell membrane fusion. [00102] Techniques can be adapted for the production of single-chain antibodies specific to an antigenic protein of the invention (see e.g. , U.S. Patent No. 4,946,778). In addition, methods can be adapted for the construction of F a expression libraries (see e.g.
  • Antibody fragments that contain the idiotypes to a protein antigen may be produced by techniques known in the art including, but not limited to: (i) an F (ab ')2 fragment produced by pepsin digestion of an antibody molecule; (ii) an F a fragment generated by reducing the disulfide bridges of an F (ab ')2 fragment; (iii) an F a fragment generated by the treatment of the antibody molecule with papain and a reducing agent and (iv) F v fragments.
  • Heteroconjugate antibodies are also within the scope of the present invention.
  • Heteroconjugate antibodies are composed of two covalently joined antibodies. Such antibodies have, for example, been proposed to target immune system cells to unwanted cells (see U.S. Patent No. 4,676,980), and for treatment of HIV infection (see WO
  • the antibodies can be prepared in vitro using known methods in synthetic protein chemistry, including those involving crosslinking agents.
  • immunotoxins can be constructed using a disulfide exchange reaction or by forming a thioether bond.
  • suitable reagents for this purpose include iminothiolate and methyl-4-mercaptobutyrimidate and those disclosed, for example, in U.S. Patent No. 4,676,980.
  • ADCC complement-mediated cell killing and antibody-dependent cellular cytotoxicity
  • the invention also pertains to immunoconjugates comprising an antibody conjugated to a cytotoxic agent such as a toxin (e.g. , an enzymatically active toxin of bacterial, fungal, plant, or animal origin, or fragments thereof), or a radioactive isotope (i.e., a radioconjugate).
  • a cytotoxic agent such as a toxin (e.g. , an enzymatically active toxin of bacterial, fungal, plant, or animal origin, or fragments thereof), or a radioactive isotope (i.e., a radioconjugate).
  • Enzymatically active toxins and fragments thereof that can be used include diphtheria A chain, nonbinding active fragments of diphtheria toxin, exotoxin A chain (from Pseudomonas aeruginosa), ricin A chain, abrin A chain, modeccin A chain, alpha-sarcin, Aleurites fordii proteins, dianthin proteins, Phytolaca americana proteins (PAPI, PAPII, and PAP-S), momordica charantia inhibitor, curcin, crotin, sapaonaria officinalis inhibitor, gelonin, mitogellin, restrictocin, phenomycin, enomycin, and the tricothecenes.
  • a variety of radionuclides are available for the production of
  • radioconjugated antibodies examples include 212 Bi, m I, m In, 90 Y, and 186 Re.
  • Conjugates of the antibody and cytotoxic agent are made using a variety of bifunctional protein-coupling agents such as N-succinimi dy 1-3 -(2-pyridyldi thiol) propionate (SPDP), iminothiolane (IT), bifunctional derivatives of imidoesters (such as dimethyl adipimidate HCL), active esters (such as disuccinimidyl suberate), aldehydes (such as glutareldehyde), bis-azido compounds (such as bis (p-azidobenzoyl)
  • SPDP N-succinimi dy 1-3 -(2-pyridyldi thiol) propionate
  • IT iminothiolane
  • imidoesters such as dimethyl adipimidate HCL
  • active esters such as disuccinimidyl suberate
  • aldehydes such as glutareldehyde
  • bis-azido compounds such
  • a ricin immunotoxin can be prepared as described in Vitetta et al., Science 238: 1098 (1987). Carbon- 14-labeled
  • MX-DTPA l-isothiocyanatobenzyl-3-methyldiethylene triaminepentaacetic acid
  • Coupling may be accomplished by any chemical reaction that will bind the two molecules so long as the antibody and the other moiety retain their respective activities.
  • This linkage can include many chemical mechanisms, for instance covalent binding, affinity binding, intercalation, coordinate binding and complexation.
  • the preferred binding is, however, covalent binding.
  • Covalent binding can be achieved either by direct condensation of existing side chains or by the incorporation of extemal bridging molecules.
  • Many bivalent or polyvalent linking agents are useful in coupling protein molecules, such as the antibodies of the present invention, to other molecules.
  • representative coupling agents can include organic compounds such as thioesters, carbodiimides, succinimide esters, diisocyanates, glutaraldehyde, diazobenzenes and hexamethylene diamines.
  • organic compounds such as thioesters, carbodiimides, succinimide esters, diisocyanates, glutaraldehyde, diazobenzenes and hexamethylene diamines.
  • Preferred linkers are described in the literature. (See, for example, Ramakrishnan, S. et al, Cancer Res. 44:201-208 (1984) describing use of MBS (M-maleimidobenzoyl-N- hydroxysuccinimide ester). See also, U.S. Patent No. 5,030,719, describing use of halogenated acetyl hydrazide derivative coupled to an antibody by way of an oligopeptide linker.
  • MBS M-maleimidobenzoyl-N- hydroxysuccinimide ester
  • linkers include: (i) EDC (l-ethyl-3-(3-dimethylamino-propyl) carbodiimide hydrochloride; (ii) SMPT (4-succinimidyloxycarbonyl-alpha-methyl-alpha- (2-pridyl-dithio)-toluene (Pierce Chem. Co., Cat. (21558G); (iii) SPDP (succinimidyl-6 [3- (2-pyridyldithio) propionamido]hexanoate (Pierce Chem.
  • linkers described above contain components that have different attributes, thus leading to conjugates with differing physio-chemical properties.
  • sulfo- NHS esters of alkyl carboxylates are more stable than sulfo-NHS esters of aromatic carboxylates.
  • NHS-ester containing linkers are less soluble than sulfo-NHS esters.
  • the linker SMPT contains a sterically hindered disulfide bond, and can form conjugates with increased stability.
  • Disulfide linkages are in general, less stable than other linkages because the disulfide linkage is cleaved in vitro, resulting in less conjugate available.
  • Sulfo- NHS in particular, can enhance the stability of carbodimide couplings.
  • Carbodimide couplings (such as EDC) when used in conjunction with sulfo-NHS, forms esters that are more resistant to hydrolysis than the carbodimide coupling reaction alone.
  • the antibodies disclosed herein can also be formulated as immunoliposomes.
  • Liposomes containing the antibody are prepared by methods known in the art, such as described in Epstein et al, Proc. Natl. Acad. Sci. USA, 82: 3688 (1985); Hwang et al., Proc. Natl Acad. Sci. USA, 77: 4030 (1980); and U.S. Pat. Nos. 4,485,045 and 4,544,545. Liposomes with enhanced circulation time are disclosed in U.S. Patent No. 5,013,556.
  • Particularly useful liposomes can be generated by the reverse-phase evaporation method with a lipid composition comprising phosphatidylcholine, cholesterol, and PEG-derivatized phosphatidylethanolamine (PEG-PE). Liposomes are extruded through filters of defined pore size to yield liposomes with the desired diameter.
  • Fab' fragments of the antibody of the present invention can be conjugated to the liposomes as described in Martin et al, J. Biol. Chem, 257: 286-288 (1982) via a disulfide-interchange reaction.
  • Methods for the screening of antibodies that possess the desired specificity include, but are not limited to, enzyme linked immunosorbent assay (ELISA) and other immunologically mediated techniques known within the art.
  • ELISA enzyme linked immunosorbent assay
  • Antibodies directed against a influenza virus protein such as HA (or a fragment thereof) may be used in methods known within the art relating to the localization and/or quantitation of a influenza virus protein (e.g., for use in measuring levels of the influenza virus protein within appropriate physiological samples, for use in diagnostic methods, for use in imaging the protein, and the like).
  • antibodies specific to an influenza virus protein, or derivative, fragment, analog or homolog thereof, that contain the antibody derived antigen binding domain are utilized as pharmacologically active compounds (referred to hereinafter as "Therapeutics").
  • An antibody specific for an influenza virus protein of the invention can be used to isolate an influenza virus polypeptide by standard techniques, such as
  • Antibodies directed against an influenza virus protein can be used diagnostically to monitor protein levels in tissue as part of a clinical testing procedure, e.g., to, for example, determine the efficacy of a given treatment regimen. Detection can be facilitated by coupling (i.e., physically linking) the antibody to a detectable substance.
  • detectable substances include various enzymes, prosthetic groups, fluorescent materials, luminescent materials, bioluminescent materials, and radioactive materials.
  • suitable enzymes include horseradish peroxidase, alkaline phosphatase, D-galactosidase, or acetylcholinesterase; examples of suitable prosthetic group complexes include
  • fluorescent materials include umbelliferone, fluorescein, fluorescein isothiocyanate, rhodamine, dichlorotriazinylamine fluorescein, dansyl chloride or phycoerythrin; an example of a luminescent material includes luminol; examples of bioluminescent materials include luciferase, luciferin, and
  • radioactive material examples include I, I, S or H.
  • Antibodies of the invention may be used as therapeutic agents. Such agents will generally be employed to treat or prevent an influenza virus -related disease or pathology (e.g., bird flu) in a subject.
  • An antibody preparation preferably one having high specificity and high affinity for its target antigen, is administered to the subject and will generally have an effect due to its binding with the target.
  • Administration of the antibody may abrogate or inhibit or interfere with the internalization of the virus into a cell. In this case, the antibody binds to the target and masks a binding site of the naturally occurring ligand, thereby blocking fusion the virus to the cell membrane inhibiting internalization of the virus.
  • a therapeutically effective amount of an antibody of the invention relates generally to the amount needed to achieve a therapeutic objective. As noted above, this may be a binding interaction between the antibody and its target antigen that, in certain cases, interferes with the functioning of the target.
  • the amount required to be administered will furthermore depend on the binding affinity of the antibody for its specific antigen, and will also depend on the rate at which an administered antibody is depleted from the free volume other subject to which it is administered.
  • Common ranges for therapeutically effective dosing of an antibody or antibody fragment of the invention may be, by way of nonlimiting example, from about 0.1 mg/kg body weight to about 50 mg/kg body weight. Common dosing frequencies may range, for example, from twice daily to once a week.
  • Antibodies specifically binding an influenza virus protein or a fragment thereof of the invention, as well as other molecules identified by the screening assays disclosed herein, can be administered for the treatment of an influenza virus -related disorders in the form of pharmaceutical compositions.
  • Principles and considerations involved in preparing such compositions, as well as guidance in the choice of components are provided, for example, in Remington: The Science And Practice Of Pharmacy 19th ed. (Alfonso R. Gennaro, et al., editors) Mack Pub.
  • the smallest inhibitory fragment that specifically binds to the binding domain of the target protein is preferred.
  • peptide molecules can be designed that retain the ability to bind the target protein sequence.
  • Such peptides can be synthesized chemically and/or produced by recombinant DNA technology. (See, e.g., Marasco et al., Proc. Natl. Acad. Sci. USA, 90: 7889-7893 (1993)).
  • the formulation can also contain more than one active compound as necessary for the particular indication being treated, preferably those with complementary activities that do not adversely affect each other.
  • the composition can comprise an agent that enhances its function, such as, for example, a cytotoxic agent, cytokine, chemotherapeutic agent, or growth-inhibitory agent.
  • an agent that enhances its function such as, for example, a cytotoxic agent, cytokine, chemotherapeutic agent, or growth-inhibitory agent.
  • Such molecules are suitably present in combination in amounts that are effective for the purpose intended.
  • the active ingredients can also be entrapped in microcapsules prepared, for example, by coacervation techniques or by interfacial polymerization, for example, hydroxymethylcellulose or gelatin-microcapsules and poly-(methylmethacrylate) microcapsules, respectively, in colloidal drug delivery systems (for example, liposomes, albumin microspheres, microemulsions, nano-particles, and nanocapsules) or in macroemulsions.
  • colloidal drug delivery systems for example, liposomes, albumin microspheres, microemulsions, nano-particles, and nanocapsules
  • formulations to be used for in vivo administration must be sterile. This is readily accomplished by filtration through sterile filtration membranes.
  • sustained-release preparations can be prepared. Suitable examples of sustained-release preparations include semipermeable matrices of solid hydrophobic polymers containing the antibody, which matrices are in the form of shaped articles, e.g. , films, or microcapsules. Examples of sustained-release matrices include polyesters, hydrogels (for example, poly(2-hydroxyethyl-methacrylate), or poly(vinylalcohol)), polylactides (U.S. Pat. No. 3,773,919), copolymers of L-glutamic acid and y
  • ethyl-L-glutamate non-degradable ethylene-vinyl acetate
  • degradable lactic acid-gly colic acid copolymers such as the LUPRON DEPOTTM (injectable microspheres composed of lactic acid-gly colic acid copolymer and leuprolide acetate)
  • LUPRON DEPOTTM injectable microspheres composed of lactic acid-gly colic acid copolymer and leuprolide acetate
  • poly-D-(-)-3-hydroxybutyric acid While polymers such as ethylene-vinyl acetate and lactic acid-gly colic acid enable release of molecules for over 100 days, certain hydrogels release proteins for shorter time periods.
  • An antibody according to the invention can be used as an agent for detecting the presence of an influenza virus (or a protein or a protein fragment thereof) in a sample.
  • the antibody contains a detectable label.
  • Antibodies can be polyclonal, or more preferably, monoclonal.
  • An intact antibody, or a fragment thereof e.g., F a , scFv, or F (ab)2
  • the term "labeled" with regard to the probe or antibody is intended to encompass direct labeling of the probe or antibody by coupling (i. e.
  • biological sample is intended to include tissues, cells and biological fluids isolated from a subject, as well as tissues, cells and fluids present within a subject. Included within the usage of the term “biological sample”, therefore, is blood and a fraction or component of blood including blood serum, blood plasma, or lymph.
  • the detection method of the invention can be used to detect an analyte mRNA, protein, or genomic DNA in a biological sample in vitro as well as in vivo.
  • in vitro techniques for detection of an analyte mRNA include Northern hybridizations and in situ hybridizations.
  • in vitro techniques for detection of an analyte protein include enzyme linked immunosorbent assays (ELISAs), Western blots, immunoprecipitations, and immunofluorescence.
  • ELISAs enzyme linked immunosorbent assays
  • Western blots Western blots
  • immunoprecipitations immunoprecipitations
  • immunofluorescence immunofluorescence
  • in vitro techniques for detection of an analyte genomic DNA include Southern hybridizations. Procedures for conducting immunoassays are described, for example in "ELISA: Theory and Practice: Methods in Molecular Biology", Vol. 42, J. R. Crowther (Ed.) Human Press, Totowa, NJ, 1995;
  • analyte protein in vivo techniques for detection of an analyte protein include introducing into a subject a labeled anti-analyte protein antibody.
  • the antibody can be labeled with a radioactive marker whose presence and location in a subject can be detected by standard imaging techniques.
  • compositions suitable for administration can be incorporated into pharmaceutical compositions suitable for administration.
  • Such compositions typically comprise the antibody or agent and a pharmaceutically acceptable carrier.
  • pharmaceutically acceptable carrier is intended to include any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like, compatible with pharmaceutical administration. Suitable carriers are described in the most recent edition of Remington's Pharmaceutical Sciences, a standard reference text in the field, which is incorporated herein by reference. Preferred examples of such carriers or diluents include, but are not limited to, water, saline, ringer's solutions, dextrose solution, and 5% human serum albumin.
  • Liposomes and non-aqueous vehicles such as fixed oils may also be used.
  • the use of such media and agents for pharmaceutically active substances is well known in the art. Except insofar as any conventional media or agent is incompatible with the active compound, use thereof in the compositions is contemplated. Supplementary active compounds can also be incorporated into the compositions.
  • a pharmaceutical composition of the invention is formulated to be compatible with its intended route of administration.
  • routes of administration include parenteral, e.g. , intravenous, intradermal, subcutaneous, oral (e.g. , inhalation), transdermal (i.e., topical), transmucosal, and rectal administration.
  • Solutions or suspensions used for parenteral, intradermal, or subcutaneous application can include the following components: a sterile diluent such as water for injection, saline solution, fixed oils, polyethylene glycols, glycerine, propylene glycol or other synthetic solvents; antibacterial agents such as benzyl alcohol or methyl parabens; antioxidants such as ascorbic acid or sodium bisulfite;
  • chelating agents such as ethylenediaminetetraacetic acid (EDTA); buffers such as acetates, citrates or phosphates, and agents for the adjustment of tonicity such as sodium chloride or dextrose.
  • the pH can be adjusted with acids or bases, such as hydrochloric acid or sodium hydroxide.
  • the parenteral preparation can be enclosed in ampoules, disposable syringes or multiple dose vials made of glass or plastic.
  • compositions suitable for injectable use include sterile aqueous solutions (where water soluble) or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersion.
  • suitable carriers include physiological saline, bacteriostatic water, Cremophor EL (BASF, Parsippany, N.J.) or phosphate buffered saline (PBS).
  • the composition must be sterile and should be fluid to the extent that easy syringeability exists. It must be stable under the conditions of manufacture and storage and must be preserved against the contaminating action of microorganisms such as bacteria and fungi.
  • the carrier can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyethylene glycol, and the like), and suitable mixtures thereof.
  • the proper fluidity can be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants.
  • microorganisms can be achieved by various antibacterial and antifungal agents, for example, parabens, chlorobutanol, phenol, ascorbic acid, thimerosal, and the like.
  • isotonic agents for example, sugars, polyalcohols such as manitol, sorbitol, sodium chloride in the composition.
  • Prolonged absorption of the injectable compositions can be brought about by including in the composition an agent which delays absorption, for example, aluminum monostearate and gelatin.
  • Sterile injectable solutions can be prepared by incorporating the active compound in the required amount in an appropriate solvent with one or a combination of ingredients enumerated above, as required, followed by filtered sterilization.
  • dispersions are prepared by incorporating the active compound into a sterile vehicle that contains a basic dispersion medium and the required other ingredients from those enumerated above.
  • methods of preparation are vacuum drying and freeze-drying that yields a powder of the active ingredient plus any additional desired ingredient from a previously
  • Oral compositions generally include an inert diluent or an edible carrier. They can be enclosed in gelatin capsules or compressed into tablets. For the purpose of oral therapeutic administration, the active compound can be incorporated with excipients and used in the form of tablets, troches, or capsules. Oral compositions can also be prepared using a fluid carrier for use as a mouthwash, wherein the compound in the fluid carrier is applied orally and swished and expectorated or swallowed. Pharmaceutically compatible binding agents, and/or adjuvant materials can be included as part of the composition.
  • the tablets, pills, capsules, troches and the like can contain any of the following ingredients, or compounds of a similar nature: a binder such as microcrystalline cellulose, gum tragacanth or gelatin; an excipient such as starch or lactose, a disintegrating agent such as alginic acid, Primogel, or corn starch; a lubricant such as magnesium stearate or Sterotes; a glidant such as colloidal silicon dioxide; a sweetening agent such as sucrose or saccharin; or a flavoring agent such as peppermint, methyl salicylate, or orange flavoring.
  • a binder such as microcrystalline cellulose, gum tragacanth or gelatin
  • an excipient such as starch or lactose, a disintegrating agent such as alginic acid, Primogel, or corn starch
  • a lubricant such as magnesium stearate or Sterotes
  • a glidant such as colloidal silicon dioxide
  • the compounds are delivered in the form of an aerosol spray from pressured container or dispenser which contains a suitable propellant, e.g. , a gas such as carbon dioxide, or a nebulizer.
  • a suitable propellant e.g. , a gas such as carbon dioxide, or a nebulizer.
  • Systemic administration can also be by transmucosal or transdermal means.
  • penetrants appropriate to the barrier to be permeated are used in the formulation.
  • penetrants are generally known in the art, and include, for example, for transmucosal administration, detergents, bile salts, and fusidic acid derivatives.
  • Transmucosal administration can be accomplished through the use of nasal sprays or suppositories.
  • the active compounds are formulated into ointments, salves, gels, or creams as generally known in the art.
  • the compounds can also be prepared in the form of suppositories (e.g. , with conventional suppository bases such as cocoa butter and other glycerides) or retention enemas for rectal delivery.
  • suppositories e.g. , with conventional suppository bases such as cocoa butter and other glycerides
  • retention enemas for rectal delivery.
  • the active compounds are prepared with carriers that will protect the compound against rapid elimination from the body, such as a controlled release formulation, including implants and microencapsulated delivery systems.
  • a controlled release formulation including implants and microencapsulated delivery systems.
  • Biodegradable, biocompatible polymers can be used, such as ethylene vinyl acetate, polyanhydrides, polygly colic acid, collagen, polyorthoesters, and polylactic acid. Methods for preparation of such formulations will be apparent to those skilled in the art.
  • the materials can also be obtained commercially from Alza Corporation and Nova Pharmaceuticals, Inc.
  • Liposomal suspensions (including liposomes targeted to infected cells with monoclonal antibodies to viral antigens) can also be used as pharmaceutically acceptable carriers. These can be prepared according to methods known to those skilled in the art, for example, as described in U.S. Patent No. 4,522,811.
  • Dosage unit form refers to physically discrete units suited as unitary dosages for the subject to be treated; each unit containing a predetermined quantity of active compound calculated to produce the desired therapeutic effect in association with the required pharmaceutical carrier.
  • the specification for the dosage unit forms of the invention are dictated by and directly dependent on the unique characteristics of the active compound and the particular therapeutic effect to be achieved, and the limitations inherent in the art of compounding such an active compound for the treatment of individuals.
  • compositions can be included in a container, pack, or dispenser together with instructions for administration.
  • the invention provides methods (also referred to herein as “screening assays") for identifying modulators, i.e. , candidate or test compounds or agents (e.g. , peptides, peptidomimetics, small molecules or other drugs) that modulate or otherwise interfere with the fusion of an influenza virus to the cell membrane. Also provided are methods of indentifying compounds useful to treat influenza infection. The invention also provides a modulator, i.e. , candidate or test compounds or agents (e.g. , peptides, peptidomimetics, small molecules or other drugs) that modulate or otherwise interfere with the fusion of an influenza virus to the cell membrane. Also provided are methods of indentifying compounds useful to treat influenza infection. The invention also provides methods (also referred to herein as “screening assays") for identifying modulators, i.e. , candidate or test compounds or agents (e.g. , peptides, peptidomimetics, small molecules or other drugs) that modulate or otherwise interfere with the fusion
  • the invention provides assays for screening candidate or test compounds which modulate the interaction between the influenza virus and the cell membrane.
  • the test compounds of the invention can be obtained using any of the numerous approaches in combinatorial library methods known in the art, including:
  • biological libraries spatially addressable parallel solid phase or solution phase libraries; synthetic library methods requiring deconvolution; the "one-bead one-compound” library method; and synthetic library methods using affinity chromatography selection.
  • the biological library approach is limited to peptide libraries, while the other four approaches are applicable to peptide, non-peptide oligomer or small molecule libraries of compounds. (See, e.g., Lam, 1997. Anticancer Drug Design 12: 145).
  • a "small molecule” as used herein, is meant to refer to a composition that has a molecular weight of less than about 5 kD and most preferably less than about 4 kD.
  • Small molecules can be, e.g. , nucleic acids, peptides, polypeptides, peptidomimetics, carbohydrates, lipids or other organic or inorganic molecules.
  • Libraries of chemical and/or biological mixtures, such as fungal, bacterial, or algal extracts, are known in the art and can be screened with any of the assays of the invention.
  • a candidate compound is introduced to an antibody- antigen complex and determining whether the candidate compound disrupts the antibody- antigen complex, wherein a disruption of this complex indicates that the candidate compound modulates the interaction between an influenza virus and the cell membrane.
  • At least one HA protein is provided, which is exposed to at least one neutralizing monoclonal antibody. Formation of an antibody-antigen complex is detected, and one or more candidate compounds are introduced to the complex. If the antibody-antigen complex is disrupted following introduction of the one or more candidate compounds, the candidate compounds is useful to treat an influenza virus - related disease or disorder, e.g. bird flu.
  • the at least one influenza virus protein may be provided as an influenza virus molecule.
  • test compounds can be labeled with 125 1, 5 S, 14 C, or H, either directly or indirectly, and the radioisotope detected by direct counting of radioemission or by scintillation counting.
  • test compounds can be enzymatically-labeled with, for example, horseradish peroxidase, alkaline phosphatase, or luciferase, and the enzymatic label detected by determination of conversion of an appropriate substrate to product.
  • the assay comprises contacting an antibody-antigen complex with a test compound, and determining the ability of the test compound to interact with the antigen or otherwise disrupt the existing antibody-antigen complex.
  • determining the ability of the test compound to interact with the antigen and/or disrupt the antibody-antigen complex comprises determining the ability of the test compound to preferentially bind to the antigen or a biologically-active portion thereof, as compared to the antibody.
  • the assay comprises contacting an antibody-antigen complex with a test compound and determining the ability of the test compound to modulate the antibody-antigen complex. Determining the ability of the test compound to modulate the antibody-antigen complex can be accomplished, for example, by determining the ability of the antigen to bind to or interact with the antibody, in the presence of the test compound.
  • the antibody may be a an influenza virus neutralizing antibody.
  • the antigen may be a HA protein, or a portion thereof.
  • the ability of a candidate compound to interfere with the binding between the monoclonal antibodies of the invention and the HA protein indicates that the candidate compound will be able to interfere with or modulate the fusion of the influenza virus and the cell membrane Moreover, because the binding of the HA protein to cell is responsible for influenza virus entry into cells such candidate compounds will also be useful in the treatment of a influenza virus related disease or disorder, e.g. bird flu..
  • the screening methods disclosed herein may be performed as a cell-based assay or as a cell-free assay.
  • the cell-free assays of the invention are amenable to use of both the soluble form or the membrane-bound form of the HA proteins and fragments thereof.
  • solubilizing agents include non-ionic detergents such as n-octylglucoside, n-dodecylglucoside,
  • n-dodecylmaltoside octanoyl-N-methylglucamide, decanoyl-N-methylglucamide, Triton ® X-100, Triton ® X-l 14, Thesit ® , Isotridecypoly(ethylene glycol ether) n ,
  • a fusion protein can be provided that adds a domain that allows one or both of the proteins to be bound to a matrix.
  • GST-antibody fusion proteins or GST-antigen fusion proteins can be adsorbed onto glutathione sepharose beads (Sigma Chemical, St.
  • the test compound for example, Louis, MO or glutathione derivatized microtiter plates, that are then combined with the test compound, and the mixture is incubated under conditions conducive to complex formation (e.g., at physiological conditions for salt and pH). Following incubation, the beads or microtiter plate wells are washed to remove any unbound components, the matrix immobilized in the case of beads, complex determined either directly or indirectly. Alternatively, the complexes can be dissociated from the matrix, and the level of antibody-antigen complex formation can be determined using standard techniques.
  • the antibody or the antigen can be immobilized utilizing conjugation of biotin and streptavidin.
  • Biotinylated antibody or antigen molecules can be prepared from biotin-NHS (N-hydroxy-succinimide) using techniques well-known within the art (e.g., biotinylation kit, Pierce Chemicals, Rockford, 111.), and immobilized in the wells of streptavidin-coated 96 well plates (Pierce Chemical).
  • antibodies reactive with the antibody or antigen of interest can be derivatized to the wells of the plate, and unbound antibody or antigen trapped in the wells by antibody conjugation.
  • Methods for detecting such complexes include immunodetection of complexes using such other antibodies reactive with the antibody or antigen.
  • the invention further pertains to novel agents identified by any of the aforementioned screening assays and uses thereof for treatments as described herein.
  • Antibodies of the present invention can be detected by appropriate assays, e.g., conventional types of immunoassays.
  • a an assay can be performed in which a influenza protein (e.g., HA1, HA 2 or neuraminidase) or fragment thereof is affixed to a solid phase. Incubation is maintained for a sufficient period of time to allow the antibody in the sample to bind to the immobilized polypeptide on the solid phase. After this first incubation, the solid phase is separated from the sample. The solid phase is washed to remove unbound materials and interfering substances such as non-specific proteins which may also be present in the sample.
  • a influenza protein e.g., HA1, HA 2 or neuraminidase
  • the solid phase containing the antibody of interest bound to the immobilized polypeptide is subsequently incubated with a second, labeled antibody or antibody bound to a coupling agent such as biotin or avidin.
  • This second antibody may be another anti -influenza antibody or another antibody.
  • Labels for antibodies are well-known in the art and include radionuclides, enzymes (e.g. maleate dehydrogenase, horseradish peroxidase, glucose oxidase, catalase), fluors (fluorescein isothiocyanate, rhodamine, phycocyanin, fluorescarmine), biotin, and the like.
  • the labeled antibodies are incubated with the solid and the label bound to the solid phase is measured. These and other immunoassays can be easily performed by those of ordinary skill in the art.
  • An exemplary method for detecting the presence or absence of a influenza virus (in a biological sample involves obtaining a biological sample from a test subject and contacting the biological sample with a labeled monoclonal or scFv antibody according to the invention such that the presence of the influenza virus is detected in the biological sample.
  • the term "labeled”, with regard to the probe or antibody is intended to encompass direct labeling of the probe or antibody by coupling (i.e., physically linking) a detectable substance to the probe or antibody, as well as indirect labeling of the probe or antibody by reactivity with another reagent that is directly labeled.
  • indirect labeling include detection of a primary antibody using a fluorescently-labeled secondary antibody and end-labeling of a DNA probe with biotin such that it can be detected with fluorescently-labeled streptavidin.
  • biological sample is intended to include tissues, cells and biological fluids isolated from a subject, as well as tissues, cells and fluids present within a subject.
  • the detection method of the invention can be used to detect an influenza virus in a biological sample in vitro as well as in vivo.
  • in vitro techniques for detection of an influenza virus include enzyme linked immunosorbent assays (ELISAs), Western blots, immunoprecipitations, and
  • in vivo techniques for detection of an influenza virus include introducing into a subject a labeled anti-influenza virus antibody.
  • the antibody can be labeled with a radioactive marker whose presence and location in a subject can be detected by standard imaging techniques.
  • the biological sample contains protein molecules from the test subject.
  • One preferred biological sample is a peripheral blood leukocyte sample isolated by conventional means from a subject.
  • the invention also encompasses kits for detecting the presence of an influenza virus in a biological sample.
  • the kit can comprise: a labeled compound or agent capable of detecting an influenza virus (e.g., an anti -influenza scFv or monoclonal antibody) in a biological sample; means for determining the amount of an influenza virus in the sample; and means for comparing the amount of an influenza virus in the sample with a standard.
  • the compound or agent can be packaged in a suitable container.
  • the kit can further comprise instructions for using the kit to detect an influenza virus in a sample.
  • Passive immunization has proven to be an effective and safe strategy for the prevention and treatment of viral diseases. (See Keller et al, Clin. Microbiol. Rev. 13:602- 14 (2000); Casadevall, Nat. Biotechnol. 20: 114 (2002); Shibata et al, Nat. Med. 5:204-10 (1999); and Igarashi et al, Nat. Med. 5:211-16 (1999), each of which are incorporated herein by reference)). Passive immunization using neutralizing human monoclonal antibodies could provide an immediate treatment strategy for emergency prophylaxis and treatment of influenza such as bird flu while the alternative and more time-consuming development of vaccines and new drugs in underway.
  • Subunit vaccines potentially offer significant advantages over conventional immunogens. They avoid the safety hazards inherent in production, distribution, and delivery of conventional killed or attenuated whole-pathogen vaccines. Furthermore, they can be rationally designed to include only confirmed protective epitopes, thereby avoiding suppressive T epitopes (see Steward et al, J. Virol. 69:7668 (1995)) or immunodominant B epitopes that subvert the immune system by inducing futile, non-protective responses (e.g. "decoy” epitopes). (See Garrity et al, J. Immunol. 159:279 (1997)).
  • an added advantage of using an antigen-Ig chimera is that either the variable or the Fc region of the antigen-Ig chimera can be used for targeting professional antigen-presenting cells (APCs).
  • APCs professional antigen-presenting cells
  • recombinant Igs have been generated in which the complementarity-determining regions (CDRs) of the heavy chain variable gene (VH) are replaced with various antigenic peptides recognized by B or T cells.
  • CDRs complementarity-determining regions
  • VH heavy chain variable gene
  • Such antigen-Ig chimeras have been used to induce both humoral and cellular immune responses. (See Bona et al, Immunol. Today 19: 126-33 (1998)).
  • one group has developed a "troybody” strategy in which peptide antigens are presented in the loops of the Ig constant (C) region and the variable region of the chimera can be used to target IgD on the surface of B-cells or MHC class II molecules on professional APCs including B-cells, dendritic cells (DC) and macrophages.
  • C constant
  • DC dendritic cells
  • macrophages See Lunde et al, Biochem. Soc. Trans. 30:500-6 (2002)).
  • An antigen-Ig chimera can also be made by directly fusing the antigen with the Fc portion of an IgG molecule.
  • You et al, Cancer Res. 61 :3704-l 1 (2001) were able to obtain all arms of specific immune response, including very high levels of antibodies to hepatitis B virus core antigen using this method.
  • DNA vaccines are stable, can provide the antigen an opportunity to be naturally processed, and can induce a longer-lasting response. Although a very attractive immunization strategy, DNA vaccines often have very limited potency to induce immune responses. Poor uptake of injected DNA by professional APCs, such as dendritic cells (DCs), may be the main cause of such limitation. Combined with the antigen-Ig chimera vaccines, a promising new DNA vaccine strategy based on the enhancement of APC antigen presentation has been reported (see Casares, et al, Viral Immunol. 10: 129-36 (1997); Gerloni et al, Nat. Biotech. 15:876-81 (1997); Gerloni et al., DNA Cell Biol.
  • DNA vaccine encoding an antigen (Ag)-Ig chimera.
  • Ag-Ig fusion proteins Upon immunization, Ag-Ig fusion proteins will be expressed and secreted by the cells taking up the DNA molecules. The secreted Ag-Ig fusion proteins, while inducing B-cell responses, can be captured and internalized by interaction of the Fc fragment with FcDRs on DC surface, which will promote efficient antigen presentation and greatly enhance antigen-specific immune responses.
  • DNA encoding antigen-Ig chimeras carrying a functional anti-MHC II specific scFv region gene can also target the immunogens to all three types of APCs.
  • the immune responses could be further boosted with use of the same protein antigens generated in vitro (i.e. , "prime and boost"), if necessary.
  • specific cellular and humoral immune responses against infection of influenza virus were accomplished through intramuscular (i.m.) injection of a DNA vaccine. (See Casares et al, Viral. Immunol. 10: 129-36 (1997)).
  • compositions are provided herein, which generally comprise mixtures of one or more monoclonal antibodies or ScFvs and combinations thereof.
  • the prophylactic vaccines can be used to prevent an influenza virus infection and the therapeutic vaccines can be used to treat individuals following an influenza virus infection.
  • Prophylactic uses include the provision of increased antibody titer to an influenza virus in a vaccination subject. In this manner, subjects at high risk of contracting influenza can be provided with passive immunity to an influenza virus
  • cytokines can be administered in conjunction with ancillary immunoregulatory agents.
  • cytokines including, but not limited to, IL-2, modified IL-2 (Cysl25 ⁇ Serl25), GM-CSF, IL-12, ⁇ - interferon, IP- 10, ⁇ , and RANTES.
  • the vaccines of the present invention have superior immunoprotective and immunotherapeutic properties over other anti-viral vaccines
  • the invention provides a method of immunization, e.g., inducing an immune response, of a subject.
  • a subject is immunized by administration to the subject a composition containing a membrane fusion protein of a pathogenic enveloped virus.
  • the fusion protein is coated or embedded in a biologically compatible matrix.
  • the fusion protein is glycosylated, e.g. contains acarbohydrate moiety.
  • the carbohydrate moiety may be in the form of a monosaccharide, disaccharide(s).
  • oligosaccharide(s), polysaccharide(s), or their derivatives e.g. sulfo- or phospho- substituted.
  • the carbohydrate is linear or branched.
  • the carbohydrate moiety is N-linked or O-linked to a polypeptide.
  • N-linked glycosylation is to the amide nitrogen of asparagine side chains and
  • O-linked glycosylation is to the hydroxy oxygen of serine and threonine side chains.
  • the carbohydrate moiety is endogenous to the subject being vaccinated. Alternatively, the carbohydrate moiety is exogenous to the subject being vaccinated.
  • the carbohydrate moiety are carbohydrate moieties that are not typically expressed on polypeptides of the subject being vaccinated.
  • the carbohydrate moieties are plant-specific carbohydrates. Plant specific carbohydrate moieties include for example N- linked glycan having a core bound al,3 fucose or a core bound ⁇ 1,2 xylose.
  • the carbohydrate moiety are carbohydrate moieties that are expressed on polypeptides or lipids of the subject being vaccinate. For example many host cells have been genetically engineered to produce human proteins with human-like sugar attachments.
  • the fusion protein is a trimeric hemagglutinin protein.
  • the hemagglutinin protein is produced in a non-mammalian cell such as a plant cell.
  • the subject is at risk of developing or suffering from a viral infection.
  • Enveloped viruses include for example, epstein-barr virus, herpes simplex virus, type 1 and 2, human cytomegalovirus, human herpesvirus, type 8, varicella zoster virus, hepatitis B virus, hepatitis C virus, human immunodeficiency virus, influenza virus, measles virus, mumps virus, parainfluenza virus, respiratory syncytial virus, rabies virus, and rubella virus.
  • Cancer is diagnosed for example by physical exam, biopsy, blood test, or x-ray.
  • the subject is e.g. , any mammal, e.g., a human, a primate, mouse, rat, dog, cat, cow, horse, pig, a fish or a bird.
  • the treatment is administered prior to diagnosis of the infection. Alternatively, treatment is administered after diagnosis.
  • Efficaciousness of treatment is determined in association with any known method for diagnosing or treating the particular disorder or infection. Alleviation of one or more symptoms of the disorder indicates that the compound confers a clinical benefit.
  • a vaccine candidate targeting humoral immunity must fulfill at least three criteria to be successful: it must provoke a strong antibody response ("immunogenicity”); a significant fraction of the antibodies it provokes must cross-react with the pathogen ("immunogenic fitness”); and the antibodies it provokes must be protective. While immunogenicity can often be enhanced using adjuvants or carriers, immunogenic fitness and the ability to induce protection (as evidenced by neutralization) are intrinsic properties of an antigen which will ultimately determine the success of that antigen as a vaccine component.
  • Immunogenic fitness is defined as the fraction of antibodies induced by an antigen that cross-react with the pathogen. (See Matthews et al, J. Immunol. 169:837 (2002)). It is distinct from immunogenicity, which is gauged by the titer of all of the antibodies induced by an antigen, including those antibodies that do not cross-react with the pathogen. Inadequate immunogenic fitness has probably contributed to the disappointing track record of peptide vaccines to date. Peptides that bind with high affinity to antibodies and provoke high antibody titers frequently lack adequate immunogenic fitness, and, therefore, they fail as potential vaccine components. Therefore, it is important to include immunogenic fitness as one of the criteria for selecting influenza vaccine candidates.
  • a common explanation for poor immunogenic fitness is the conformational flexibility of most short peptides. Specifically, a flexible peptide may bind well to antibodies from patients, and elicit substantial antibody titers in naive subjects. However, if the peptide has a large repertoire of conformations, a preponderance of the antibodies it induces in naive subjects may fail to cross-react with the corresponding native epitope on intact pathogen.
  • APFs Like short peptides, some APFs may be highly flexible and, therefore may fail as vaccine components. The most immunogenically fit APFs are likely to consist of self- folding protein subdomains that are intrinsically constrained outside the context of the whole protein.
  • immunogenic fitness is primarily a property of the APF itself, and not of the responding immune system, immunogenic fitness can be evaluated in an animal model (e.g. in mice) even though ultimately the APF will have to perform in humans.
  • the immunogenic fitness achieved by APFs is evaluated by immunosorption of anti-APF sera with purified spike or membrane protein, in a procedure analogous to that described in Matthews et al, J. Immunol. 169:837 (2002).
  • IgG is purified from sera collected from mice that have been immunized.
  • Purified, biotinylated proteins (as appropriate, depending on the particular APF with which the mice were immunized) are mixed with the mouse IgG and incubated. Streptavidin-coated sepharose beads are then added in sufficient quantity to capture all of the biotinylated protein, along with any bound IgG.
  • streptavidin-coated beads are removed by centrifugation at 13,000 rpm in a microcentrifuge, leaving IgG that has been depleted of antibodies directed against the protein, respectively. Mock immunoabsorptions are performed in parallel in the same way, except that biotinylated BSA will be substituted for influenza protein as a mock absorbent.
  • the absorbed antibodies and the mock-absorbed antibodies are titered side-by-side in ELISA against the immunizing APF.
  • the antigen for these ELISAs will be purified APF-GST fusion proteins.
  • the antigen for these ELISAs will be APF-Fc fusion proteins secreted by mammalian cells and purified with protein A.
  • the percentage decrease in the anti-APF titer of absorbed antibodies compared with the mock-absorbed antibodies will provide a measure of the immunogenic fitness of the APF.
  • the invention provides for both prophylactic and therapeutic methods of treating a subject at risk of (or susceptible to) an influenza virus-related disease or disorder.
  • diseases or disorders include but are not limited to, e.g., bird flu.
  • the invention provides methods for preventing an influenza virus -related disease or disorder in a subject by administering to the subject a monoclonal antibody or scFv antibody of the invention or an agent identified according to the methods of the invention.
  • a monoclonal antibody or scFv antibody of the invention or an agent identified according to the methods of the invention For example, scFv and/or monoclonal antibody may be administered in therapeutically effective amounts.
  • two or more anti-influenza antibodies are co-administered.
  • Subjects at risk for an influenza virus -related diseases or disorders include patients who have come into contact with an infected person or who have been exposed to the influenza virus in some other way. Administration of a prophylactic agent can occur prior to the manifestation of symptoms characteristic of the influenza virus -related disease or disorder, such that a disease or disorder is prevented or, alternatively, delayed in its progression.
  • the appropriate agent can be determined based on screening assays described herein.
  • the agent to be administered is a scFv or monoclonal antibody that neutralizes an influenza virus that has been identified according to the methods of the invention.
  • Another aspect of the invention pertains to methods of treating an influenza virus-related disease or disorder in a patient.
  • the method involves administering an agent (e.g., an agent identified by a screening assay described herein and/or an scFv antibody or monoclonal antibody identified according to the methods of the invention), or combination of agents that neutralize the influenza to a patient suffering from the disease or disorder.
  • an agent e.g., an agent identified by a screening assay described herein and/or an scFv antibody or monoclonal antibody identified according to the methods of the invention
  • the antibodies of the invention may be used in combination with other anti-viral agents such as for example Tamiflu.
  • EXAMPLE 1 ISOLATION OF BNABS AGAINST INFLUENZA VIRUSES FROM CULTURES OF SINGLE MEMORY B CELLS
  • FIG. 1 A schematic representation of the broadly neutralizing antibody (BnAb) isolation procedure is depicted in Fig. 1.
  • PBMCs peripheral blood mononuclear cells
  • A/Brisbane/10/07 tetramerized H3
  • H3 binding clones showed heterosubtypic binding to group 1 HI strains and H7/H1 strains, respectively. Only 3.38% H3 -reactive (H3+) clones were found to also bind influenza B.
  • H3+ H3 -reactive clones were found to also bind influenza B.
  • H3N2 A/Brisbane/10/07.
  • One bnAb, 3114, derived from donor 3 that showed H3/H7/H1 cross- reactivity and neutralization was further characterized.
  • 3114 is a highly mutated IGHV3-30-encoded antibody
  • variable regions of heavy chain (VH) and light chain (VL) were recovered from the expanded single cell culture using RT-PCR.
  • 3114 is encoded by the IGHV3-30* 18 and IGLV1-44*01 germline genes.
  • the rearranged heavy chain possesses a long complementarity determining region 3 (HCDR3) (23 amino acids) and uses the IGHD3-22*01 DH segment flanked by large N-additions at both VH and
  • 3114 mAb has 15 variable heavy chain and 7 variable light chain somatic mutations excluding the primer-flanking regions, which are observed in both the framework and CDRs.
  • EXAMPLE 2 3114 CONFERS BINDING AND NEUTRALIZATION TO BOTH GROUP 1 AND GROUP 2 INFLUENZA VIRUSES
  • 3114 bound cell surface-expressed HAs across serotypes of both group 2 (H3, H4, H7, H14 and H15) and group 1 (HI, H2, H5, H6, H8, H9, HI 1, H12 and H16) influenza A viruses by flow cytometry (Fig. 2).
  • 3114 also bound purified HA proteins of different subtypes that belong to group 2 (H3, H4, H7 and H14) and group 1 (HI, H5 and H9) with dissociation constants (Kd) ranging from 0.01 nM to 10 nM (Fig.
  • 3114 bound to all tested group 2 HAs (H3, H4, H7 and H14) with high affinity (mean Kd ⁇ 0.1 nM).
  • H3 and H7 viruses including two reassortant viral strains (A/Wisconsin/67/05 (HA, NA) x A/Puerto Rico/8/34 and A/Aichi/2/68 (HA, NA) x A/Puerto Rico/8/34) and the novel H7N9-AH13 stain with half maximal inhibitory concentration (IC50) values ranging from 0.032 to 1.074 ⁇ g ml-1 (Fig. 4 and Fig. 17). It also neutralized pseudoviruses H7N1-FPN and H7N1-NL219 stains with IC50 values ranging from 0.007 to 0.027 ⁇ g ml-1 (Fig. 5B and Fig.
  • EXAMPLE 3 3114 IGGI BINDING (KD VALUES)
  • association of 3114 IgGI was measured for 600 sec by exposing the sensors to up to 20 concentrations of HAs.
  • dissociation of 3114 IgGI was measured for 900 sec.
  • affinity constants (Kd) were calculated using ForteBio Data Analysis 7.0 software.
  • 3114 bound purified HA protein of different subtypes belonging to Group 1 (HI and H5) and Group 2 (H3, H4, H7 and H14) with Kd values ranging from 0.01 nM and 10 nM (Fig. 3). 3114 bound most of Group 2 HAs (H3, H4, H7 and H14) with high affinity (mean Kd ⁇ 0.1 nM). In contrast, 3114 bound to HI subtypes (H1-CA409, H1-SI06 and Hl- PR8) with high affinity, whereas its affinity for other Group 1 subtypes (H5-VN04 and H5- IN05) was considerably lower (mean Kd > 1 n M).
  • H7-NL219 A Netherlands/219/03 (H7-NL219), A/Canada RV444/04 (H7-CA444) and A/Anhui/1/13 (H7-AH13) were obtained from the NIH BEIR Repository (NIAID, NIH).
  • A/mallard/Astrakhan/263/82 (HI 4- AS 82) were kindly gifted from Dr. R. C. Liddington (Burnham Institute for Medical Research, CA, USA).
  • the IC50 graphs depict the average neutralization titer of 2-3 independent experiments. 3114 was represented as a square, while anti-group 1 mAb F10 IgGI
  • MDCK cells (1.5 ⁇ 10 4 cells per well) were seeded into 96-well tissue culture plates and washed twice with PBS, followed by incubation in DMEM supplemented with 2 ⁇ g/mL trypsin and 0.5% BSA. 100 TCID50 (median tissue culture infectious doses) of virus were mixed in equal volume with two-fold serial dilutions of Ab or antibody containing supernatant in 96-well plates, and incubated for lh at 37°C. After the incubation, the Ab-virus mixture was transfered to confluent MDCK monolayers in duplicate, followed by incubation at 37°C for 21h.
  • TCID50 tissue culture infectious doses
  • IC50 half maximal inhibitory concentration
  • the IC50 graphs depict the average neutralization titer of 2-3 independent experiments. 3114 was represent as square, while anti-group 1 mAb F10 IgGI (represented as triangles) was used as controls.
  • H7N1-FPN and H7N1-NL219 are group 2 pseudoviruses, with IC50 values ranging from 0.032 to 1.336 ⁇ g/ml. It also neutralized group 1 pseudoviruses H5-VN04 and H5-HK97 with IC50 values ranging from 2.137 and 4.601 ⁇ g/ml, respectively (Fig. 5).
  • mice At the dose of 25 mg kg-1 3114 IgGI showed 80% protection against H3N2-BR07 and 60% protection against H5N1-VN04. All surviving mice showed the reversal of weight loss by the end of the observation period (Fig. 6b). Groups of 5 mice were treated intraperitoneally 25 or 5 mg/kg of purified IgGs with 24h before lethal challenged by i.n. inoculation with H3N2 BR07, H5N1 VN04, H7N9 AU13 or H7N7 NL219 influenza viruses. (A) survival rate (%) of mice and (B) body weight change (%) that treated with bnAb 3114 (RED), group 1 control mAb F10 (BLACK) and group 2 control mAb A533 (BLUE).
  • RED survival rate
  • BLACK group 1 control mAb F10
  • BLUE group 2 control mAb A533
  • mice One day prior to the experiment, groups of five female 8-10 week old BALB/c mice were injected with 3114, F10 and A533-IgGl at low concentration of 5 mg/kg and high concentration of 20 or 25 mg/kg by intraperitoneal (i.p.) route in 0.5 mL volume, respectively. 6 groups of mice were intranasally infected 10 LD50 of either mouse-adapted A/Vietnam/1203/04 (H5N1), A/Brisbane/10/07 (H3N2), A Netherlands/219/03 (H7N7) or A/Anhui/1/13 (H7N9). Mice were weighed on the day of virus challenge and then monitored for survival and weighed daily for 14 days or 18 days.
  • mice were treated with varying doses of 3114, F10 (Group 1 control Ab) and A533 (Group 2 control Ab) IgGls 1 day before challengwith a lethal dose of H5N1-VN04, H3N2-BR07, H7N7-NL219 and H7N9-AU13 viruses.
  • Prophylaxis using > 5 mg/kg 3114 IgGl fully protected mice from death after H7N7-NL219 or H7N9-AU13 challenge with minimal body weight loss in the observation period.
  • EXAMPLE 7 3114 BLOCKS TRYPSIN-MEDIATED HA MATURATION AND PH-
  • HA0 conformational changes and membrane fusion of HA 12 ' 14 ' 16 .
  • Cleavage of the precursor HA0 primes HA for subsequent activation of membrane fusion in the acidic endosome environment.
  • Immature HA0 is normally processed by surface protease on respiratory epithelial cells to HA1 and HA2 28 ' 29 which is mimicked experimentally by treatment of HA0 with trypsin 30 . Since 3114 targets the stem domain of HA comprising the HA0 cleavage site and the HA2 N-terminal fusion peptide, we tested whether 3114 could also block trypsin cleavage activation of HA0 or interfere with HA-mediated virus-host membrane fusion.
  • Fig 7 shows that 3114 IgGl but not control anti-SARS IgGl (Fm-6) prevented cleavage of immature HA0.
  • Fig. 8 (upper) illustrates that 3114 binds to both uncleaved HA precursor (HA0) (left) and two mature forms (HA), either after trypsin activation alone (left middle) or when followed by low-pH trigger (right middle). In contrast, it did not bind to dissociated HA2 mediated by DTT reduction (right).
  • EXAMPLE 8 3114 IGGI PREVENTED LOW-PH TRIGGERED CONFORMATIONAL REARRANGEMENTS ON SURFACE-EXPRESSED H3-A268 AND H3-BR07.
  • H3 The conformation rearrangements of surface-expressed H3 were detected by FACS staining of 3114 (solid bars) and the head binding control mAb E730 (open bars) (Fig. 8).
  • the various conformations are indicated above the corresponding graphs and were as follows: uncleaved precursor (HA0); trypsin actived, cleaved (HA); low pH trigger, cleaved (pH 4.9); and DTT reduced, trimeric HA2 (tHA2). Binding is expressed as the percentage of binding to untreated HA (HA0).
  • H3 was pretreated without mAb, with 3114, or with control Ab, Fm-6 before exposure of the cleaved HAs to pH 4.9. Data represent mean + SD of three independent experiments.
  • 3114 bound to both uncleaved HA precursor (HA0) and mature forms (HA) after trypsin activation and low-pH trigger, but didn't bind dissociated HA2 mediated by DTT reduction. While 3114 pre-bound to mature HAs before low-pH trigger, the antibody remained bound after DTT treatment, indicating that 3114 inhibits the pH-dependent HA rearrangements and the subsequent membrane fusion. In addition, pre- binding of 3114 prevented the dissociation of HAl from HA2, because the binding of E730 Ab (anti-HAl) was preserved after DTT treatment.
  • MDCK cells were transfected with full-length recombinant influenza A pcDNA3.1-H3-A268 and H3-BR07 plasmids. After -30 hours of transfection, the cells were detached from the plastic support using 0.2% EDTA/PBS. To measure mAb binding to different HA structural forms and conformations, cell samples were split and stained with 3114 or E730 IgGI (anti-H3 head) after each processing step.
  • Anti-stem bnAbs are reported to efficiently mediate FcyR-dependent cytotoxicity of influenza virus-infected cells 1 , which is considered to be a major mechanism of mAb-mediated antiviral clearance.
  • ADCC antibody - dependent cellular cytotoxicity
  • 3114 Following incubation with H3-expressing 293T target cells, 3114 induced a significant luciferase response in Jurkat reporter cells in a dose-dependent manner and at a comparable level to other anti-stem bnAbs including FI6v3, CR9114, 39.29 and group 2 mAb CR8020 (Fig. 9). The specificity of this assay was demonstrated by the lack of response from anti-group 1 mAb, F10. 3114 also specifically induced the luciferase response against H5-expressed 293T cells but at a lower level than FI6v3, CR9114, 39.29 and F10. We observed low reactivity for CR8020 against H5-expressed 293T target cells (Fig. 9). These data support that 3114 also likely engages an Fc-dependent immune-mediated mechanism for in vivo protection.
  • EXAMPLE 10 3114 CROSS-COMPETES FOR BINDING TO H3 OR H5 WITH
  • 3114 also inhibited the binding of 39.29 and F10 to H5-VN04, but did not inhibit the binding of anti-head antibody, 2A (Figs. 10E-F). These results suggest that 3114 targets an epitope in the HA stem region that overlaps with or is very close to the known epitopes of other anti- stalk bnAbs.
  • HCDR3 plays a major role in forming a hydrophobic core with the fusion peptide and helix A 15 ' 17 ' 18 . Rather than making significant interactions with HA, HCDR1 and HCDR2 appear to stabilize the HCDR3 loop to facilitate binding.
  • hydrophilic light chain CDR residues also interact with HA and surround the hydrophobic core, however the orientation of the light chains are not conserved nor are the residues involved in binding. These observations suggest that the light chains mainly contribute to the binding by orienting the HCDR3 to an optimal position to interact with the epitope.
  • H5 complexes defined by distances ⁇ 5 A and ⁇ 7 A, respectively.
  • the color scheme indicates contributions to the binding energy: very favorable (red); favorable (orange); neutral (blue) and unfavorable (black).
  • EXAMPLE 12 STRUCTURE OF THE 3114 EPITOPE ON THE STALK OF H3 TRIMER
  • Fig. 13 is a schematic representation of the 3114 epitope on the stalk of H3.
  • the heavy chain of 3114 is shown in blue and the light chain is in magenta.
  • the stalk of H3 trimer is color as salmon, green and cyan. Residue numbering is thoroughly on the basis of the H3 or Ab sequence.
  • the HCDR3 and the hydrophobic residues on the fusion peptide and helix A of HA2 of H3 must make close contact to form a hydrophobic core at the interface; the HCDR2 and HCDR1 residues make similar interactions with HCDR3 as other complexes; the light chain CDRs make mainly hydrophilic interactions with H3.
  • the top 10 models from 1000 decoys 6 models fit these criteria and they are very similar to each other. Therefore, the one with the best score within the 6 was chosen for further analysis.
  • EXAMPLE 13 SEQUENCE ALIGNMENT AND STRUCTURE SUPERPOSITION OF H3/3I14 AND H5/3I14 MODELS.
  • Fig. 14A depicts a sequence alignment of the stem epitopes of H3, H5 and influenza B.
  • Fig. 14B depicts a structure superposition of H3/3I14 and H5/3I14 models at residue 38 and 39.
  • H3 is shown as Cyan and H5 is shown as yellow; 3114 from H3/3I14 model is shown as blue (Heavy chain) and yellow (Light chain) and 3114 from H5/3I14 model is shown as orange.
  • the H3 residues Leu38 and Lys39 are labeled.
  • the residues F100F from heavy chain and D93 from light chain interact with 38 and 39 respectively and are also labeled.
  • H5/3I14 and influenza B/3I14 complexes were modeled in the same way as the 3I14/H3 complex. Both the 3114 model and the H5 trimer or H3 trimer were superimposed to the H3/39.29 complex structure and the two structure files were merged into one 3I14/H5 complex or 3114/Influenza B complex as the initial model for docking. Interestingly, similar models as those chosen for the H3/3I14 complex model are among the best models for both the H5/3I14 and influenza B/3I14 complexes. Therefore, these similar models were chosen as the final model for further analysis.
  • this mutation does not appear to be able to affect the binding affinity.
  • K39 makes contacts with D94 from the light chain of 3114 in the H3/3I14 model while E39 is rotating away from D94 in the H5/3I14 model due to the electrical repulsion (Fig. 14B).
  • the K39E mutation is not favorable for H5 binding and perhaps this is the reason that 3114 has weaker binding to H5 weaker in comparison to H3.
  • the residues at position 38-39 of HA from different subtypes were examined in comparison with their ability to bind 3114. A strong correlation can be unveiled that HAs with L38 and K39 bind 3114 strongly and HAs with K38 and E39 have weaker binding.
  • EXAMPLE 14 3114 WT AND VLD94N MUTATIONS IGGI BINDING (KD VALUES) TO RECOMBINANT H5-VN04 (A) AND H3-PE09 (B).
  • VLD94N variant improves the binding and neutralization activity to H5
  • VLD94N variant against H5 pseudotyped or H3 infectious virus (Fig. 16C and 16D).
  • VLD94N variant neutralized H5-VN04 pseudovirus with 10-fold higher potency (IC 5 o: 8.65 ng ml "1 vs. 81.58 ng ml "1 ), (Fig. 16C). Meanwhile, the neutralization activity against H3-BR07 remained intact of VLD94N variant (IC5 0 : 336.6 ng ml "1 vs. 305.4 ng ml "1 ) (Fig. 16D).
  • Example 15 3114 WT and VLD94N mutant IgGl neutralize
  • Fig. 16 is a series of graphs that depict the neutralization of H5N1-VN04 and H3N2-BR07 infection virus.
  • Anti-group 1 mAb F10 (BLUE) was used as controls. These data represent average neutralization titer of 2-3 independent experiments.
  • Example 16 Engineered yeast display for isolation of 3114 variant with increased binding to H5.
  • yeast display libraries were created by randomizing residues of HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, LCDR3 and LCDR4. These yeast display libraries were used to generate a pool of single chain 3114 variants, which will be selected and cloned into the yeast display vector pCTCON2.
  • the isolated construct will attach a c-Myc tag at the C-terminus of the antibody to serve as a marker for presentation.
  • the antibody expression and surface display will be induced by growing the library in SGCAA medium at 20 degree for 24-48hrs.
  • the successful presentation of the 3114 variants will be detected by anti-c-Myc FITC labeling.
  • H5 HA will be labeled with a fluorescent label and added to the staining for 1 hr. The unbound reagent will be washed away and the labeled library will be sorted for H5 HA positive clones.
  • both 3114 WT-yeast and CDR-libraries were positive for C-myc and H5, as demonstrated by FACS analysis.
  • the double positive H5 and c-myc positive population was increased in the 3114 yeast CDR library from 0.039% to 0.090%, in comparison to the 3I14-WT-yeast library.
  • the positive clones will be grown and sorted again for three times to enrich the positive population. The positive clones will be verified by FACS analysis and identified by sequencing. Yeast display in combination with FACS sorting has been proven successful for antibody engineering and will be used to isolate 3114 variant clones that are capable of binding to influenza B HA. Once initial binders to influenza B HA are identified, the subsequent rounds of screening will be carried out with multi-color sorting, that is, H3, H5 and influenza B HA will be labeled with different fluorescent labels and triple positive 3114 variants will be sorted.
  • Example 17 Epitope Mapping and Binding Competition
  • 3114 Fab strongly inhibits the binding of other anti-stem Abs CR9114, FI6v3 and 39.29 to H3-BR07 but not with the head-directed, anti-H3 mAb E730 (unpublished antibody sequence) (Fig. 10). 3114 also competes with CR8020, which is directed against a more membrane- proximal epitopel4. 3114 partially inhibits the binding of 39.29 and F10 to H5-VN04 but does not inhibit the binding of the anti-H5 head antibody 2A12 (Fig. 2e,f). These results demonstrate that 3114 is overlapping with or very close to the known stem epitopes of other bnAbs. In addition, 3114 is a potent inhibitor of H3 and moderate inhibitor of H5. These results are consistent with the affinity measurements of 3114 binding to H3 and H5.
  • the extracellular domain of H3 (A/Brisbane/10/2007), residues 17 to 531, was expressed as fusion protein included a C-terminal peptide containing Avitag (amino acid sequence: GGGLNDIFEAQKIEWHE), thrombin cleavage site, trimerization T4 fibritin foldon domain and six histidine residues.
  • the fusion protein H3-ATTH was expressed in 293F cells and purified from the supematant by Ni-NTA affinity chromatography. Purified recombinant HA protein was cleaved by thrombin enzyme (Novagen, Darmstadt,
  • A/shearwater/West Australia/2576/79 (H15-WA79) and A/black-headed gull/Sweden/2/99 (H16-SE06) were cloned into pcDNA3.1 vector and transfected into 293T/17 cells to produce cell surface expressed HA.
  • H3-PE09 A/Perth/16/09
  • H3-UY07 A/Uruguay /716/07
  • H3-VIC11 A/Victoria/341/11 (H3- VIC11)
  • H5 A/Vietnam/1203/04 H5-VN04
  • H7 A/Netherlands/219/03 H7-NL219)
  • A/Canada/RV444/04 H7-CA444
  • A/Anhui/1/13 H7-AH13
  • H9 A/Hong Kong/1073/99 H9-HK99
  • H4-NL05 H4-NL05
  • H14 A/mallard/Astrakhan/263/82 H14-AS82
  • Wild type influenza viruses A/California/4/09 (H1N1-CA09), A/Puerto Rico/8/34 (H1N1-PR8), A/Perth/16/09 (H3N2-PE09), A/Aichi/2/68 (H3N2-A2/68), A/Hong kong/8/68 (H3N2-HK68), A/Sydney /5/97 (H3N2-SY97), A/Brisbane/10/07 (H3N2-BR07), A/Wisconsin/67/05 (HA, NA) x A/Puerto Rico/8/34 (H3N2), A/Aichi/2/68 (HA, NA) x A/Puerto Rico/8/34 (H3N2) and A/Nanchang/993/95 (H3N2-NC95) were obtained from the NIH BEIR Repository (NIH, Manassas, VA), and grown in Madin-Darby canine kidney (MDCK) cells by
  • A/Brisbane/lO/2007-ma (H3N2) used in animal challenge studies is a mouse-adapted virus derived from a PR8 reassortant virus x-171 46 .
  • the Env-Pseudotyped luciferase reporter viruses were produced in 293T/17 cells as previously described 12 . Briefly, the pcDNA3.1- H5-VN04, H5-HK97, H7-NL219 or H7-FPV plasmids were separately co-transfected into 293T/17 cells with the Nl-expressing plasmid pcDNA3.1-N1-VN04, HIV packaging vector pCMVR8.2 and reporter vector pHIV-Luc. Viral supernatants were harvested at 48h post- transfection. Viral titration was evaluated by measuring luciferase activity using the POLARstar Omega Microplate Reader (BMG LABTECH, Ortenberg, Germany).
  • Fresh PBMCs were isolated from the collected blood by use of the Ficoll- Paque gradient (GE HealthCare).
  • the CD 19 CD27 + B cells were stained with biotinylated H3-ATTH and allophycocyanin (APC)-labeled streptavidin.
  • Single H3-reactive memory B cells were sorted into 384-well plate. After 14 days of expansion, the supernatants were tested for reactivity to recombinant HI (H1-CA09), H3 (H3-BR07), and H7 (H7-CA444) HA proteins and were analyzed by the Meso Scale Discovery multiplex (MSD, Rockville, Maryland). Subsequently, the reactive supernatants were measured in vitro neutralizing activity against H3N2-BR07. All H3N2 neutralizing antibodies were rescued by single cell RT-PCR using primers as previously described 47 .
  • MDCK cells Prior to the experiment, MDCK cells (1.5 ⁇ 10 4 cells per well) were seeded to the 96-well tissue culture plates and washed twice with PBS, then incubated in DMEM media supplemented with 2 ⁇ g/mL trypsin and 0.5% BSA. 100 TCID 50 (median tissue culture infectious doses) of virus were mixed in equal volume with two-fold serial dilutions of Ab or antibody containing supernatant in 96-well plates, and incubated for lh at 37°C. After the incubation, the Ab-virus mixture was transferred to confluent MDCK monolayers in duplicate, followed by incubation at 37°C for 21h. Cells were washed with PBS, fixed in 80% acetone, and viral antigen detected by indirect ELISA with a mAb against influenza A Virus Nucleoprotein (NP) (clone A3, BEI).
  • NP Virus Nucleoprotein
  • LD 50 median lethal dose
  • mice were weighed on the day of virus challenge and then monitored for clinical signs and body weight recorded daily for 14 days or 18 days. Body weight loss of >25% relative to initial weight, or a score of 4 on clinical signs (unresponsiveness or severe neurological symptoms such as hind limb paralysis, ataxia) index were used as survival endpoints. Animal studies were conducted per approved Institutional Animal Care and Use Committee protocols.
  • H3-ATTH H3-histidine
  • the ADCC Reporter Bioassay uses engineered Jurkat cells stably expressing the FcDRIIIa receptor, V158 (high affinity) variant, and an NFAT response element driving expression of firefly luciferase as effector cells (Promega).
  • Antibody biological activity in ADCC is quantified through the luciferase produced as a result of NFAT pathway activation; luciferase activity in the effector cell is quantified with luminescence readout.
  • 1 x l0 4 /well H3- or H5- expressed 293T cells were attached to the flat bottom 96-well plates prior to assay, and the medium was then replaced with Low IgG Serum assay buffer (RPMI 1640 with 0.5% low IgG FBS).
  • scFvFc antibodies were added to each well at 1, 0.2 and 0.04 ⁇ g ml "1 final concentration.
  • Jurkat effector cells were added for 6.0xl0 4 /well to assay plates in Low IgG Serum assay buffer and incubated for 6 hours.
  • the supernatants were recovered by centrifugation at 300*g and measured using Bio-Glo Luciferase Assay kits (Promega, Madison, WI) at 490 nm by the POLARstar Omega Microplate Reader (BMG LABTECH, Ortenberg, Germany).
  • ADCC assay was performed on HAs-expressed 293T cells with fresh PBMCs from healthy human donors.
  • the ADCC activity was determined by a lactose dehydrogenase (LDH) release assay (Pierce Biotechnology, Rockford, IL ).
  • LDH lactose dehydrogenase
  • Fresh PBMCs as effector cells were isolated from the collected blood by use of the Ficoll-Paque gradient (GE HealthCare).
  • 2x 10 4 /well H3- or H5- expressed 293T cells were attached to the solid round bottom 96-well plates prior to assay, and the medium was then replaced with Low IgG Serum assay buffer (RPMI 1640 with 0.5% low IgG FBS).
  • Low IgG Serum assay buffer RPMI 1640 with 0.5% low IgG FBS.
  • the scFvFc antibodies were added to each well at 10, 5, 2.5 and 1.25 ⁇ g ml "1 final concentration.
  • PBMCs were added for 1.2 xl0 5 /well to assay plates in Low IgG Serum assay buffer and incubated for 6 hours.
  • the supernatants were recovered by centrifugation at 300*g and measured using LDH Cytotoxicity Assay Kit (Pierce Biotechnology, Rockford, IL) at 490 nm and 680 nm by the Benchmark Plus Reader (Bio-Rad, Hercules, CA).
  • the LDH activity was determined by subtracting the 680 nm absorbance value (background) from the 490 nm absorbance reading.
  • Data represent a representative experiment from three independent experiments, and all tests were performed in triplicate. Data represent a representative experiment from three independent experiments, and all tests were performed in triplicate.
  • the full-length influenza A HA sequences were downloaded from the Influenza Virus Resource at the National Center for Biotechnology Information (NCBI) database.
  • the Phylogenetic (PHYML) trees are based on their amino acid sequence comparison using Geneious software.
  • the new bnAb, 3114 was analyzed for germline gene usage, somatic mutations, N-nucleotides insertion and cognate variable heavy (VH) and light (VL) chain gene pairs using IMGT database (http://imgt.cines.fr).
  • VH variable heavy
  • VL light chain gene pairs
  • Antibody variants in which single or multiple germline mutations were reverted to the germline were produced by synthesis (Genewiz, South Plainfield, NJ) and confirmed by sequencing.
  • the VH and VK sequences of F10, FI6v3, CR9114, CR8020 and 39.29 were obtained through the Protein Data Bank (PDB accession code) and the corresponding genes were synthetized and expressed by transient trans
  • BioLuminate The model was superimposed to H3/FI6 complex structure before docking with RosettaDock. Only high resolution docking is performed with side chain and loop rearrangement allowed. 1000 decoys were generated for each docking and clustered based on RMSD values. The final model was selected based on the cluster size and the criteria described in the result session.

Landscapes

  • Life Sciences & Earth Sciences (AREA)
  • Health & Medical Sciences (AREA)
  • Virology (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Molecular Biology (AREA)
  • Immunology (AREA)
  • Pulmonology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Genetics & Genomics (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Communicable Diseases (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Oncology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Epidemiology (AREA)
  • Microbiology (AREA)
  • Mycology (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicinal Preparation (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
PCT/US2016/026800 2015-04-08 2016-04-08 Humanized influenza monoclonal antibodies and methods of use thereof Ceased WO2016164835A1 (en)

Priority Applications (11)

Application Number Priority Date Filing Date Title
KR1020177032200A KR102668588B1 (ko) 2015-04-08 2016-04-08 인간화된 인플루엔자 모노클로날 항체 및 그의 사용 방법
CA2981969A CA2981969C (en) 2015-04-08 2016-04-08 Humanized influenza monoclonal antibodies and methods of use thereof
JP2017553107A JP6960856B2 (ja) 2015-04-08 2016-04-08 ヒト化インフルエンザモノクローナル抗体およびその使用方法
AU2016246065A AU2016246065B2 (en) 2015-04-08 2016-04-08 Humanized influenza monoclonal antibodies and methods of use thereof
EP16716806.1A EP3280730B1 (en) 2015-04-08 2016-04-08 Humanized influenza monoclonal antibodies and methods of use thereof
US15/564,897 US11135282B2 (en) 2015-04-08 2016-04-08 Humanized influenza monoclonal antibodies and methods of use thereof
CN201680033270.XA CN107750253B (zh) 2015-04-08 2016-04-08 人源化流感单克隆抗体及其使用方法
IL254951A IL254951B (en) 2015-04-08 2017-10-09 Humanized influenza monoclonal antibodies and methods of use thereof
US17/405,748 US12076390B2 (en) 2015-04-08 2021-08-18 Humanized influenza monoclonal antibodies and methods of use thereof
AU2021225240A AU2021225240A1 (en) 2015-04-08 2021-09-03 Humanized influenza monoclonal antibodies and methods of use thereof
IL286208A IL286208A (en) 2015-04-08 2021-09-09 Humanized influenza monoclonal antibodies and methods of use thereof

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201562144729P 2015-04-08 2015-04-08
US62/144,729 2015-04-08

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US15/564,897 A-371-Of-International US11135282B2 (en) 2015-04-08 2016-04-08 Humanized influenza monoclonal antibodies and methods of use thereof
US17/405,748 Division US12076390B2 (en) 2015-04-08 2021-08-18 Humanized influenza monoclonal antibodies and methods of use thereof

Publications (1)

Publication Number Publication Date
WO2016164835A1 true WO2016164835A1 (en) 2016-10-13

Family

ID=55754481

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2016/026800 Ceased WO2016164835A1 (en) 2015-04-08 2016-04-08 Humanized influenza monoclonal antibodies and methods of use thereof

Country Status (9)

Country Link
US (2) US11135282B2 (https=)
EP (1) EP3280730B1 (https=)
JP (3) JP6960856B2 (https=)
KR (1) KR102668588B1 (https=)
CN (1) CN107750253B (https=)
AU (2) AU2016246065B2 (https=)
CA (1) CA2981969C (https=)
IL (2) IL254951B (https=)
WO (1) WO2016164835A1 (https=)

Cited By (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2018071913A2 (en) 2016-10-14 2018-04-19 Dana-Farber Cancer Institute, Inc. Modular tetrameric bispecific antibody platform
WO2019147867A1 (en) * 2018-01-26 2019-08-01 Regeneron Pharmaceuticals, Inc. Human antibodies to influenza hemagglutinin
WO2023081471A1 (en) 2021-11-05 2023-05-11 Dana-Farber Cancer Institute, Inc. Human broadly crossreactive influenza monoclonal antibodies and methods of use thereof
US11879896B2 (en) 2018-08-13 2024-01-23 Regeneron Pharmaceuticals, Inc. Therapeutic protein selection in simulated in vivo conditions
US12258378B2 (en) 2018-03-14 2025-03-25 Dana-Farber Cancer Institute, Inc. Engineered cells, T cell immune modulating antibodies and methods for using the same

Families Citing this family (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US9969794B2 (en) 2012-05-10 2018-05-15 Visterra, Inc. HA binding agents
EP4043489A1 (en) * 2014-03-19 2022-08-17 Dana-Farber Cancer Institute, Inc. Immunogenetic restriction on elicitation of antibodies
AU2017222564A1 (en) 2016-02-24 2018-09-06 Visterra, Inc. Formulations of antibody molecules to influenza virus
CN109448781B (zh) * 2018-11-06 2021-09-14 云南大学 一种流感病毒抗原变化的预测方法
CN111423507B (zh) * 2019-01-10 2022-04-15 中国科学院分子细胞科学卓越创新中心 广谱性中和流感病毒的全人抗体
US11230593B2 (en) 2019-03-25 2022-01-25 Visterra, Inc. Compositions and methods for treating and preventing influenza
WO2021119467A1 (en) * 2019-12-11 2021-06-17 Visterra, Inc. Compositions and methods for treating and preventing influenza
CN114366809B (zh) * 2022-01-12 2024-07-23 广州瑞贝斯药业有限公司 一种铝纳米晶递送系统及其结合疫苗抗原分子自组装颗粒佐剂疫苗

Citations (38)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US3773919A (en) 1969-10-23 1973-11-20 Du Pont Polylactide-drug mixtures
EP0003089A1 (fr) 1978-01-06 1979-07-25 Bernard David Séchoir pour feuilles imprimées par sérigraphie
US4485045A (en) 1981-07-06 1984-11-27 Research Corporation Synthetic phosphatidyl cholines useful in forming liposomes
US4522811A (en) 1982-07-08 1985-06-11 Syntex (U.S.A.) Inc. Serial injection of muramyldipeptides and liposomes enhances the anti-infective activity of muramyldipeptides
US4544545A (en) 1983-06-20 1985-10-01 Trustees University Of Massachusetts Liposomes containing modified cholesterol for organ targeting
US4676980A (en) 1985-09-23 1987-06-30 The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services Target specific cross-linked heteroantibodies
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
US4946778A (en) 1987-09-21 1990-08-07 Genex Corporation Single polypeptide chain binding molecules
WO1991000360A1 (en) 1989-06-29 1991-01-10 Medarex, Inc. Bispecific reagents for aids therapy
US5013556A (en) 1989-10-20 1991-05-07 Liposome Technology, Inc. Liposomes with enhanced circulation time
US5030719A (en) 1986-08-28 1991-07-09 Teijin Limited Cytotoxic antibody conjugates and a process for preparation thereof
WO1992000373A1 (en) 1990-06-29 1992-01-09 Biosource Genetics Corporation Melanin production by transformed microorganisms
US5091513A (en) 1987-05-21 1992-02-25 Creative Biomolecules, Inc. Biosynthetic antibody binding sites
US5132405A (en) 1987-05-21 1992-07-21 Creative Biomolecules, Inc. Biosynthetic antibody binding sites
US5223409A (en) 1988-09-02 1993-06-29 Protein Engineering Corp. Directed evolution of novel binding proteins
US5233409A (en) 1992-02-25 1993-08-03 Schwab Karl W Color analysis of organic constituents in sedimentary rocks for thermal maturity
WO1994002602A1 (en) 1992-07-24 1994-02-03 Cell Genesys, Inc. Generation of xenogeneic antibodies
WO1994011026A2 (en) 1992-11-13 1994-05-26 Idec Pharmaceuticals Corporation Therapeutic application of chimeric and radiolabeled antibodies to human b lymphocyte restricted differentiation antigen for treatment of b cell lymphoma
WO1995022618A1 (en) 1994-02-22 1995-08-24 Dana-Farber Cancer Institute Nucleic acid delivery system, method of synthesis and uses thereof
US5545806A (en) 1990-08-29 1996-08-13 Genpharm International, Inc. Ransgenic non-human animals for producing heterologous antibodies
US5545807A (en) 1988-10-12 1996-08-13 The Babraham Institute Production of antibodies from transgenic animals
US5569825A (en) 1990-08-29 1996-10-29 Genpharm International Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
WO1996034096A1 (en) 1995-04-28 1996-10-31 Abgenix, Inc. Human antibodies derived from immunized xenomice
WO1996033735A1 (en) 1995-04-27 1996-10-31 Abgenix, Inc. Human antibodies derived from immunized xenomice
US5625126A (en) 1990-08-29 1997-04-29 Genpharm International, Inc. Transgenic non-human animals for producing heterologous antibodies
US5633425A (en) 1990-08-29 1997-05-27 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
US5661016A (en) 1990-08-29 1997-08-26 Genpharm International Inc. Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
US5916771A (en) 1996-10-11 1999-06-29 Abgenix, Inc. Production of a multimeric protein by cell fusion method
US5939598A (en) 1990-01-12 1999-08-17 Abgenix, Inc. Method of making transgenic mice lacking endogenous heavy chains
WO1999053049A1 (en) 1998-04-15 1999-10-21 Abgenix, Inc. Epitope-driven human antibody production and gene expression profiling
WO2010130636A1 (en) * 2009-05-11 2010-11-18 Crucell Holland B.V. Human binding molecules capable of neutralizing influenza virus h3n2 and uses thereof
WO2011117848A1 (en) * 2010-03-26 2011-09-29 Pomona Ricerca S.R.L. Full-length immunoglobulins of the igg isotvpe capable of recognizing a heterosubtvpe neutralizing epitope on the hemagglutinin stem region and their use as anti-influenza medicament
US20120058124A1 (en) * 2010-09-03 2012-03-08 The Research Foundation For Microbial Diseases Of Osaka University Influenza virus-neutralizing antibody and screening method therefor
WO2013007770A1 (en) * 2011-07-14 2013-01-17 Crucell Holland B.V. Human binding molecules capable of neutralizing influenza a viruses of phylogenetic group 1 and phylogenetic group 2 and influenza b viruses
WO2013011347A1 (en) * 2011-07-18 2013-01-24 Institute For Research In Biomedicine Neutralizing anti-influenza a virus antibodies and uses thereof
US20130302349A1 (en) * 2012-05-10 2013-11-14 Visterra, Inc. Novel ha binding agents
WO2014078268A2 (en) * 2012-11-13 2014-05-22 Genentech, Inc. Anti-hemagglutinin antibodies and methods of use
US9502140B2 (en) 2013-03-22 2016-11-22 Kabushiki Kaisha Toshiba Semiconductor memory device

Family Cites Families (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1992020373A1 (en) 1991-05-14 1992-11-26 Repligen Corporation Heteroconjugate antibodies for treatment of hiv infection
JP5998222B2 (ja) * 2011-09-30 2016-09-28 セルトリオン・インコーポレイテッド ヒトb細胞で生産されたインフルエンザaウイルス中和活性を持つ結合分子

Patent Citations (38)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US3773919A (en) 1969-10-23 1973-11-20 Du Pont Polylactide-drug mixtures
EP0003089A1 (fr) 1978-01-06 1979-07-25 Bernard David Séchoir pour feuilles imprimées par sérigraphie
US4485045A (en) 1981-07-06 1984-11-27 Research Corporation Synthetic phosphatidyl cholines useful in forming liposomes
US4522811A (en) 1982-07-08 1985-06-11 Syntex (U.S.A.) Inc. Serial injection of muramyldipeptides and liposomes enhances the anti-infective activity of muramyldipeptides
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
US4544545A (en) 1983-06-20 1985-10-01 Trustees University Of Massachusetts Liposomes containing modified cholesterol for organ targeting
US4676980A (en) 1985-09-23 1987-06-30 The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services Target specific cross-linked heteroantibodies
US5030719A (en) 1986-08-28 1991-07-09 Teijin Limited Cytotoxic antibody conjugates and a process for preparation thereof
US5091513A (en) 1987-05-21 1992-02-25 Creative Biomolecules, Inc. Biosynthetic antibody binding sites
US5132405A (en) 1987-05-21 1992-07-21 Creative Biomolecules, Inc. Biosynthetic antibody binding sites
US4946778A (en) 1987-09-21 1990-08-07 Genex Corporation Single polypeptide chain binding molecules
US5223409A (en) 1988-09-02 1993-06-29 Protein Engineering Corp. Directed evolution of novel binding proteins
US5545807A (en) 1988-10-12 1996-08-13 The Babraham Institute Production of antibodies from transgenic animals
WO1991000360A1 (en) 1989-06-29 1991-01-10 Medarex, Inc. Bispecific reagents for aids therapy
US5013556A (en) 1989-10-20 1991-05-07 Liposome Technology, Inc. Liposomes with enhanced circulation time
US5939598A (en) 1990-01-12 1999-08-17 Abgenix, Inc. Method of making transgenic mice lacking endogenous heavy chains
WO1992000373A1 (en) 1990-06-29 1992-01-09 Biosource Genetics Corporation Melanin production by transformed microorganisms
US5545806A (en) 1990-08-29 1996-08-13 Genpharm International, Inc. Ransgenic non-human animals for producing heterologous antibodies
US5633425A (en) 1990-08-29 1997-05-27 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
US5569825A (en) 1990-08-29 1996-10-29 Genpharm International Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
US5661016A (en) 1990-08-29 1997-08-26 Genpharm International Inc. Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
US5625126A (en) 1990-08-29 1997-04-29 Genpharm International, Inc. Transgenic non-human animals for producing heterologous antibodies
US5233409A (en) 1992-02-25 1993-08-03 Schwab Karl W Color analysis of organic constituents in sedimentary rocks for thermal maturity
WO1994002602A1 (en) 1992-07-24 1994-02-03 Cell Genesys, Inc. Generation of xenogeneic antibodies
WO1994011026A2 (en) 1992-11-13 1994-05-26 Idec Pharmaceuticals Corporation Therapeutic application of chimeric and radiolabeled antibodies to human b lymphocyte restricted differentiation antigen for treatment of b cell lymphoma
WO1995022618A1 (en) 1994-02-22 1995-08-24 Dana-Farber Cancer Institute Nucleic acid delivery system, method of synthesis and uses thereof
WO1996033735A1 (en) 1995-04-27 1996-10-31 Abgenix, Inc. Human antibodies derived from immunized xenomice
WO1996034096A1 (en) 1995-04-28 1996-10-31 Abgenix, Inc. Human antibodies derived from immunized xenomice
US5916771A (en) 1996-10-11 1999-06-29 Abgenix, Inc. Production of a multimeric protein by cell fusion method
WO1999053049A1 (en) 1998-04-15 1999-10-21 Abgenix, Inc. Epitope-driven human antibody production and gene expression profiling
WO2010130636A1 (en) * 2009-05-11 2010-11-18 Crucell Holland B.V. Human binding molecules capable of neutralizing influenza virus h3n2 and uses thereof
WO2011117848A1 (en) * 2010-03-26 2011-09-29 Pomona Ricerca S.R.L. Full-length immunoglobulins of the igg isotvpe capable of recognizing a heterosubtvpe neutralizing epitope on the hemagglutinin stem region and their use as anti-influenza medicament
US20120058124A1 (en) * 2010-09-03 2012-03-08 The Research Foundation For Microbial Diseases Of Osaka University Influenza virus-neutralizing antibody and screening method therefor
WO2013007770A1 (en) * 2011-07-14 2013-01-17 Crucell Holland B.V. Human binding molecules capable of neutralizing influenza a viruses of phylogenetic group 1 and phylogenetic group 2 and influenza b viruses
WO2013011347A1 (en) * 2011-07-18 2013-01-24 Institute For Research In Biomedicine Neutralizing anti-influenza a virus antibodies and uses thereof
US20130302349A1 (en) * 2012-05-10 2013-11-14 Visterra, Inc. Novel ha binding agents
WO2014078268A2 (en) * 2012-11-13 2014-05-22 Genentech, Inc. Anti-hemagglutinin antibodies and methods of use
US9502140B2 (en) 2013-03-22 2016-11-22 Kabushiki Kaisha Toshiba Semiconductor memory device

Non-Patent Citations (91)

* Cited by examiner, † Cited by third party
Title
"Advances In Parenteral Sciences", vol. 4, 1991, M. DEKKER, article "Peptide And Protein Drug Delivery"
"Contributions to Microbiology and Immunology", 1989, CARGER PRESS, NEW YORK, article "Conjugate Vaccines"
"Drug Absorption Enhancement: Concepts, Possibilities, Limitations, And Trends", 1994, HARWOOD ACADEMIC PUBLISHERS
"ELISA: Theory and Practice: Methods in Molecular Biology", vol. 42, 1995, HUMAN PRESS
"Immunoassay", 1996, ACADEMIC PRESS, INC.
"Remington: The Science And Practice Of Pharmacy", 1995, MACK PUB. CO.
BARBAS ET AL., PROC. NATL. ACAD. SCI. USA, vol. 89, 1992, pages 9339 - 43
BOBO ET AL., PROC. NATL. ACAD. SCI. USA, vol. 91, 1994, pages 2076 - 2080
BONA ET AL., IMMUNOL. TODAY, vol. 19, 1998, pages 126 - 33
BRODEUR ET AL.: "Monoclonal Antibody Production Techniques and Applications", 1987, MARCEL DEKKER, INC., pages: 51 - 63
BURTON, NATL. REV. IMMUNOL., vol. 2, 2002, pages 706 - 13
CARELL ET AL., ANGEW. CHEM. INT. ED. ENGL., vol. 33, 1994, pages 2061
CARON ET AL., J. EXP MED., vol. 176, 1992, pages 1191 - 1195
CARRELL ET AL., ANGEW. CHEM. INT. ED. ENGL., vol. 33, 1994, pages 2059
CASADEVALL, NAT. BIOTECHNOL., vol. 20, 2002, pages 114
CASARES ET AL., VIRAL IMMUNOL., vol. 10, 1997, pages 129 - 36
CASARES ET AL., VIRAL. IMMUNOL., vol. 10, 1997, pages 129 - 36
CHO ET AL., SCIENCE, vol. 261, 1993, pages 1303
COLE ET AL.: "MONOCLONAL ANTIBODIES AND CANCER THERAPY", 1985, ALAN R. LISS, INC., pages: 77 - 96
CORTI DAVIDE ET AL: "A Neutralizing Antibody Selected from Plasma Cells That Binds to Group 1 and Group 2 Influenza A Hemagglutinins", SCIENCE, AMERICAN ASSOCIATION FOR THE ADVANCEMENT OF SCIENCE, vol. 333, no. 6044, 12 August 2011 (2011-08-12), pages 850 - 856, XP002711146, ISSN: 0036-8075 *
COTE ET AL., PROC NATL ACAD SCI USA, vol. 80, 1983, pages 2026 - 2030
CULL ET AL., PROC. NATL. ACAD. SCI. USA, vol. 89, 1992, pages 1865 - 1869
CWIRLA ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 87, 1990, pages 6378 - 6382
D. WILKINSON: "The Scientist", vol. 14, 17 April 2000, THE SCIENTIST, INC., pages: 25 - 28
DAVIDSON ET AL., NAT. GENET, vol. 3, 1993, pages 219
DAVIES ET AL., ANNUAL REV BIOCHEM, vol. 59, 1990, pages 439 - 473
DEVLIN, SCIENCE, vol. 249, 1990, pages 404 - 406
DEWITT ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 90, 1993, pages 6909
EPSTEIN ET AL., PROC. NATL. ACAD. SCI. USA, vol. 82, 1985, pages 3688
ERB ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 91, 1994, pages 11422
FELICI, J. MOL. BIOL., vol. 222, 1991, pages 301 - 310
FISHWILD ET AL., NATURE BIOTECHNOLOGY, vol. 14, 1996, pages 845 - 51
FODOR, NATURE, vol. 364, 1993, pages 555 - 556
GALLOP ET AL., J. MED. CHERN, vol. 37, 1994, pages 1233
GARRITY ET AL., J. IMMUNOL., vol. 159, 1997, pages 279
GELLER, A. I. ET AL., J. NEUROCHEM, vol. 64, 1995, pages 487
GELLER, A. I. ET AL., PROC NATL. ACAD. SCI USA, vol. 87, 1990, pages 1149
GELLER, A. I. ET AL., PROC NATL. ACAD. SCI.: U.S.A., vol. 90, 1993, pages 7603
GERALD NAKAMURA ET AL: "An In Vivo Human-Plasmablast Enrichment Technique Allows Rapid Identification of Therapeutic Influenza A Antibodies", CELL HOST & MICROBE, vol. 14, no. 1, 1 July 2013 (2013-07-01), pages 93 - 103, XP055103733, ISSN: 1931-3128, DOI: 10.1016/j.chom.2013.06.004 *
GERLONI ET AL., DNA CELL BIOL., vol. 16, 1997, pages 611 - 25
GERLONI ET AL., NAT. BIOTECH., vol. 15, 1997, pages 876 - 81
GODING: "Monoclonal Antibodies: Principles and Practice", 1986, ACADEMIC PRESS, pages: 59 - 103
HARLOW E; LANE D: "Antibodies: A Laboratory Manual", 1988, COLD SPRING HARBOR LABORATORY PRESS
HASHEM A M ET AL: "Universal antibodies against the highly conserved influenza fusion peptide cross-neutralize several subtypes of influenza A virus", BIOCHEMICAL AND BIOPHYSICAL RESEARCH COMMUNICATIONS, ACADEMIC PRESS INC. ORLANDO, FL, US, vol. 403, no. 2, 10 December 2010 (2010-12-10), pages 247 - 251, XP027552632, ISSN: 0006-291X, [retrieved on 20101208], DOI: 10.1016/J.BBRC.2010.11.030 *
HOOGENBOOM; WINTER, J. MOL. BIOL., vol. 227, 1991, pages 381
HOUGHTEN, BIOTECHNIQUES, vol. 13, 1992, pages 412 - 421
HUSE ET AL., SCIENCE, vol. 246, 1989, pages 1275 - 1281
HUSTON ET AL., PROC NAT ACAD SCI USA, vol. 85, no. 16, 1988, pages 5879 - 5883
HWANG ET AL., PROC. NATL ACAD. SCI. USA, vol. 77, 1980, pages 4030
IGARASHI ET AL., NAT. MED., vol. 5, 1999, pages 211 - 16
JANSEN ET AL., IMMUNOLOGICAL REVIEWS, vol. 62, 1982, pages 185 - 216
KAPLITT, M. G. ET AL., NAT. GENET., vol. 8, 1994, pages 148
KELLER ET AL., CLIN. MICROBIOL. REV., vol. 13, 2000, pages 602 - 14
KILLEN; LINDSTROM, JOUR. IMMUN., vol. 133, 1984, pages 1335 - 2549
KOHLER; MILSTEIN, NATURE, vol. 256, 1975, pages 495
KOZBOR ET AL., IMMUNOL TODAY, vol. 4, 1983, pages 72
KOZBOR, J. IMMUNOL., vol. 133, 1984, pages 3001
LAM, ANTICANCER DRUG DESIGN, vol. 12, 1997, pages 145
LAM, NATURE, vol. 354, 1991, pages 82 - 84
LANZA ET AL., PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 11683 - 87
LEGAL LASALLE ET AL., SCIENCE, vol. 259, 1993, pages 988
LIM, F. ET AL.: "DNA Cloning: Mammalian Systems", 1995, OXFORD UNIV. PRESS
LONBERG ET AL., NATURE, vol. 368, 1994, pages 856 - 859
LONBERG; HUSZAR, INTERN. REV. IMMUNOL., vol. 13, 1995, pages 65 - 93
LUNDE ET AL., BIOCHEM. SOC. TRANS., vol. 30, 2002, pages 500 - 6
MARASCO ET AL., PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 7889 - 7893
MARKS ET AL., BIO/TECHNOLOGY, vol. 10, 1992, pages 779 - 783
MARKS ET AL., J. MOL. BIOL., vol. 222, 1991, pages 581
MARTIN ET AL., J. BIOL. CHEM., vol. 257, 1982, pages 286 - 288
MATTHEWS ET AL., J. IMMUNOL., vol. 169, 2002, pages 837
MORRISON ET AL., AM. J. PHYSIOL., vol. 266, 1994, pages 292 - 305
MORRISON, NATURE, vol. 368, 1994, pages 812 - 13
MUNSON; POLLARD, ANAL. BIOCHEM., vol. 107, 1980, pages 220
NATURE, vol. 361, 1993, pages 186 - 87
NEUBERGER, NATURE BIOTECHNOLOGY, vol. 14, 1996, pages 826
P. TIJSSEN: "Practice and Theory of Enzyme Immunoassays", 1985, ELSEVIER SCIENCE PUBLISHERS
PARREN ET AL., ADV. IMMUNOL., vol. 77, 2001, pages 195 - 262
RAMAKRISHNAN, S. ET AL., CANCER RES., vol. 44, 1984, pages 201 - 208
SCOTT; SMITH, SCIENCE, vol. 249, 1990, pages 386 - 390
SHIBATA ET AL., NAT. MED., vol. 5, 1999, pages 204 - 10
SHOPES, J. IMMUNOL., vol. 148, 1992, pages 2918 - 2922
STEVENSON ET AL., ANTI-CANCER DRUG DESIGN, vol. 3, 1989, pages 219 - 230
STEWARD ET AL., J. VIROL., vol. 69, 1995, pages 7668
VITETTA ET AL., SCIENCE, vol. 238, 1987, pages 1098
WEIBIN HU ET AL: "Fully human broadly neutralizing monoclonal antibodies against influenza A viruses generated from the memory B cells of a 2009 pandemic H1N1 influenza vaccine recipient", VIROLOGY, vol. 435, no. 2, 1 January 2013 (2013-01-01), pages 320 - 328, XP055100211, ISSN: 0042-6822, DOI: 10.1016/j.virol.2012.09.034 *
YANG ET AL., J. VIROL., vol. 69, 1995, pages 2004
YOU ET AL., CANCER RES., vol. 61, 2001, pages 3704 - 11
ZAGHOUANI ET AL., PROC. NATL. ACAD. SCI. USA, vol. 92, 1995, pages 631 - 35
ZANETTI, NATURE, vol. 355, 1992, pages 476 - 77
ZEBEDEE ET AL., PROC. NATL. ACAD. SCI. USA, vol. 89, 1992, pages 3175 - 79
ZUCKERMANN ET AL., J. MED. CHEM., vol. 37, 1994, pages 2678

Cited By (11)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2018071913A2 (en) 2016-10-14 2018-04-19 Dana-Farber Cancer Institute, Inc. Modular tetrameric bispecific antibody platform
WO2019147867A1 (en) * 2018-01-26 2019-08-01 Regeneron Pharmaceuticals, Inc. Human antibodies to influenza hemagglutinin
CN111670195A (zh) * 2018-01-26 2020-09-15 瑞泽恩制药公司 针对流感血凝素的人抗体
JP2021511043A (ja) * 2018-01-26 2021-05-06 リジェネロン・ファーマシューティカルズ・インコーポレイテッドRegeneron Pharmaceuticals, Inc. インフルエンザヘマグルチニンに対するヒト抗体
US11780907B2 (en) 2018-01-26 2023-10-10 Regeneron Pharmaceuticals, Inc. Human antibodies to influenza hemagglutinin
JP7372925B2 (ja) 2018-01-26 2023-11-01 リジェネロン・ファーマシューティカルズ・インコーポレイテッド インフルエンザヘマグルチニンに対するヒト抗体
IL275884B1 (en) * 2018-01-26 2024-07-01 Regeneron Pharma Human antibodies to influenza hemagglutinin
IL275884B2 (en) * 2018-01-26 2024-11-01 Regeneron Pharma Human antibodies to influenza hemagglutinin
US12258378B2 (en) 2018-03-14 2025-03-25 Dana-Farber Cancer Institute, Inc. Engineered cells, T cell immune modulating antibodies and methods for using the same
US11879896B2 (en) 2018-08-13 2024-01-23 Regeneron Pharmaceuticals, Inc. Therapeutic protein selection in simulated in vivo conditions
WO2023081471A1 (en) 2021-11-05 2023-05-11 Dana-Farber Cancer Institute, Inc. Human broadly crossreactive influenza monoclonal antibodies and methods of use thereof

Also Published As

Publication number Publication date
AU2021225240A1 (en) 2021-09-30
EP3280730A1 (en) 2018-02-14
KR20170133507A (ko) 2017-12-05
JP2021121204A (ja) 2021-08-26
CA2981969C (en) 2023-12-05
CN107750253A (zh) 2018-03-02
JP2018518940A (ja) 2018-07-19
US12076390B2 (en) 2024-09-03
US11135282B2 (en) 2021-10-05
US20220054624A1 (en) 2022-02-24
IL254951B (en) 2021-09-30
AU2016246065A1 (en) 2017-10-26
IL286208A (en) 2021-10-31
AU2016246065B2 (en) 2021-06-03
JP6960856B2 (ja) 2021-11-05
CN107750253B (zh) 2022-10-04
CA2981969A1 (en) 2016-10-13
JP2023130499A (ja) 2023-09-20
EP3280730C0 (en) 2024-01-03
EP3280730B1 (en) 2024-01-03
IL254951A0 (en) 2017-12-31
US20180099040A1 (en) 2018-04-12
KR102668588B1 (ko) 2024-05-22

Similar Documents

Publication Publication Date Title
US12076390B2 (en) Humanized influenza monoclonal antibodies and methods of use thereof
AU2008338691B2 (en) Antibodies against influenza virus and methods of use thereof
JP2024542158A (ja) ヒト広域交差反応性インフルエンザモノクローナル抗体及びその使用方法
AU2019204310B2 (en) Antibodies against influenza virus and methods of use thereof

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 16716806

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2981969

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 15564897

Country of ref document: US

WWE Wipo information: entry into national phase

Ref document number: 254951

Country of ref document: IL

ENP Entry into the national phase

Ref document number: 2017553107

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2016246065

Country of ref document: AU

Date of ref document: 20160408

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 20177032200

Country of ref document: KR

Kind code of ref document: A