WO2016133372A2 - 지속형 인슐린 또는 이의 아날로그 결합체 - Google Patents

지속형 인슐린 또는 이의 아날로그 결합체 Download PDF

Info

Publication number
WO2016133372A2
WO2016133372A2 PCT/KR2016/001628 KR2016001628W WO2016133372A2 WO 2016133372 A2 WO2016133372 A2 WO 2016133372A2 KR 2016001628 W KR2016001628 W KR 2016001628W WO 2016133372 A2 WO2016133372 A2 WO 2016133372A2
Authority
WO
WIPO (PCT)
Prior art keywords
insulin
amino acid
chain
conjugate
amino acids
Prior art date
Application number
PCT/KR2016/001628
Other languages
English (en)
French (fr)
Other versions
WO2016133372A3 (ko
Inventor
허용호
이종수
박성희
김대진
정성엽
권세창
Original Assignee
한미약품 주식회사
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by 한미약품 주식회사 filed Critical 한미약품 주식회사
Priority to JP2017543742A priority Critical patent/JP2018508504A/ja
Priority to US15/551,489 priority patent/US10894089B2/en
Priority to CN201680022070.4A priority patent/CN107810202A/zh
Priority to EP16752702.7A priority patent/EP3260139A4/en
Publication of WO2016133372A2 publication Critical patent/WO2016133372A2/ko
Publication of WO2016133372A3 publication Critical patent/WO2016133372A3/ko

Links

Classifications

    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
    • A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
    • A61K47/6811—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a protein or peptide, e.g. transferrin or bleomycin
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/22—Hormones
    • A61K38/28—Insulins
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/56—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule
    • A61K47/59—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule obtained otherwise than by reactions only involving carbon-to-carbon unsaturated bonds, e.g. polyureas or polyurethanes
    • A61K47/60—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule obtained otherwise than by reactions only involving carbon-to-carbon unsaturated bonds, e.g. polyureas or polyurethanes the organic macromolecular compound being a polyoxyalkylene oligomer, polymer or dendrimer, e.g. PEG, PPG, PEO or polyglycerol
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00—Drugs for disorders of the metabolism
    • A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
    • A61P3/10—Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/575—Hormones
    • C07K14/62—Insulins
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09—Recombinant DNA-technology
    • C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/67—General methods for enhancing the expression
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52—Constant or Fc region; Isotype
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52—Constant or Fc region; Isotype
    • C07K2317/522—CH1 domain
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52—Constant or Fc region; Isotype
    • C07K2317/524—CH2 domain
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52—Constant or Fc region; Isotype
    • C07K2317/526—CH3 domain
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52—Constant or Fc region; Isotype
    • C07K2317/528—CH4 domain
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52—Constant or Fc region; Isotype
    • C07K2317/53—Hinge
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C07K2319/30—Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2840/00—Vectors comprising a special translation-regulating system
    • C12N2840/20—Vectors comprising a special translation-regulating system translation of more than one cistron
    • C12N2840/203—Vectors comprising a special translation-regulating system translation of more than one cistron having an IRES

Definitions

  • the present invention relates to insulin and / or analogue conjugates thereof and their use in which the biocompatible materials, which can increase insulin and / or their analogues and their in vivo half-life, are covalently linked to each other, thereby improving their sustainability and stability in vivo.
  • the present invention relates to breakthrough insulins and / or analogue conjugates thereof and methods for preparing the same, which are endowed with in vivo properties to improve side effects and ease of administration of insulin therapy.
  • the present invention also provides a conjugate linked by biocompatible material mutual covalent bonds that can increase insulin and / or insulin analogues and half-life in vivo.
  • Insulin is a blood glucose control hormone secreted by the human pancreas. It transfers excess glucose in the blood to cells to supply cells with energy and maintain blood sugar at normal levels.
  • insulin does not show its normal function, which means that glucose in the blood cannot be used as an energy source and high blood glucose levels result in high blood glucose. It is associated with many complications. Therefore, insulin therapy is essential for diabetic patients with abnormal insulin production (Type I) or insulin resistance (Type II), and can control blood glucose to normal levels due to insulin administration.
  • Insulin preparations for such treatment have been developed, as well as natural insulin, insulin analogues that improve the action time by modifying human insulin.
  • the first human insulin analogue by genetic recombination technology is Eli lilly's insulin Lispro, changing the order of the second lysine residue and the third proline residue at the B-chain carboxyl terminus to form insulin dimers and hexamers. It is an insulin analogue that increases the amount of monomeric insulin that has good blood sugar-lowering activity when injected by injection. Novo Nordisk's insulin aspart replaces the B-chain proline residue with an aspartic acid residue to increase the repulsion of the charge, preventing the formation of insulin hexamers for super fast-acting activity. It is an analog made to represent. Insulin Glulisine from Sanofi Aventis Co. replaces B-chain 3 asparagine residues with Lysine residues and B-chain 29 Lysine residues with glutamic acid residues. It is an analog made to show the hypoglycemic effect.
  • This method of suction type is simple and the patient is able to administer without pain, so it is definitely preferred to the conventional injection, but it is lower in the delivery efficiency of the drug than the injection, and the drug requires the activity of the body. It is still difficult to maintain.
  • there is a difficulty in preparing a composition suitable for inhalation administration such as contamination, stability and durability by microorganisms and pathogens.
  • delivery of inhaled products to the lungs requires further study of lung absorption mechanisms due to side effects that can cause edema, cell damage, and inflammation in tissues, and the ability to predict absorption mechanisms, absorption rates and ranges is currently at an early stage. have.
  • insulin glargine (lantus) from sanofi-aventis and insulin detemir (levemir) from Novo Nordisk.
  • Sanofi-Aventis's insulin glargine is the first long-acting insulin that replaces the 21st asparagine of the A chain with glycine and adds two arginine residues to the B chain, making it soluble at acidic pH and low at in vivo pH. It exhibits soluble properties and is prepared for slow absorption by inducing precipitation of insulin upon subcutaneous administration.
  • the duration of insulin glargine is about 20-22 hours, which is longer than fast-acting (5-8 hours) and super fast-enzyme (3-5 hours) insulins, and does not have low peaks in insulin concentrations.
  • Have. Novo Nordisk's Insulin Determir is the most recently developed long-acting insulin preparation that removes the thirty th threonine residue in B chain and acylates the lysine residue in B chain 29 to bind albumin during human administration. It was designed so that it could be endowed with the properties of a sustained type (Allison J. et al, DM . 148-162, 2010).
  • the duration was developed in a dosage form once or twice a day, 18-22 hours slightly shorter than insulin glargine.
  • the present inventors have made intensive efforts to develop a long-acting insulin preparation for improving the convenience of administration by improving blood persistence, and thus, the insulin A chain and the A chain in the immunoglobulin constant region that can increase the half-life of insulin and its analogues.
  • a new type of insulin, or an analogue conjugate thereof was formed by combining the A-chain conjugate and the B-chain conjugate to which the B chain was linked, respectively.
  • Such a conjugate is expected to be able to increase the yield and to significantly increase the half-life because the C-peptide is not removed during purification.
  • One object of the present invention is to provide insulin and / or analogue conjugates wherein the analog and half-life of insulin, which are capable of prolonging the half-life and hypoglycemic effects of insulin, are bound by peptide bonds. It is.
  • Another object of the present invention is to provide insulin or an analogue conjugate thereof, wherein a biocompatible material capable of extending insulin and / or its analogue and its half-life is bound by peptide bonds.
  • X is the insulin A chain or the A chain of the insulin analogue
  • L is a linker
  • a is 0 or a natural number, provided that when L is 2 or more, each L is independent of each other,
  • Y is insulin B chain or B chain of insulin analogue
  • F1 and F2 contain an immunoglobulin constant region and have an FcRn binding site.
  • Another object of the present invention is to provide a polynucleotide encoding the insulin and / or its analog conjugate, a vector comprising the polynucleotide, and a transformant comprising the vector.
  • Another object of the present invention is insulin or insulin, in which the double bond formation of the A-chain and B-chain conjugates is enhanced by the variation of the biocompatible substance bound to the A and B chains of insulin and / or its analog, respectively. It is to provide an analog combination.
  • Still another object of the present invention is to provide a composition for preventing or treating diabetes, including the insulin and / or an analogue conjugate thereof.
  • Another object of the present invention is to provide a method of treating diabetes, comprising administering the insulin and / or its analog conjugate to a subject in need thereof.
  • Another object of the present invention is to provide a method for preparing insulin and / or insulin analogue conjugates, in which the A-chain and B-chain conjugates of insulin and / or their analogs are each encoded and then double-bonded.
  • Insulin and / or its analogue conjugates of the present invention maintain a stable hypoglycemic effect in vivo and have a significant increase in blood half-life, thereby improving the convenience and side effects of insulin administration.
  • One aspect for practicing the present invention is insulin and // wherein a biocompatible material capable of extending insulin and / or its analog and half-life, which maintains the body's half-life prolongation and hypoglycemic effect, is bound by peptide bonds. Or analogue combinations thereof, or methods for making the same.
  • the insulin and / or analogue conjugate thereof is a sustained conjugate having Formula 1 below.
  • X is wild-type insulin A chain or an analog thereof
  • L is a linker
  • a is 0 or a natural number, provided that when L is 2 or more, each L is independent of each other,
  • Y is wild type insulin B chain or analog thereof
  • F1 and F2 contain an immunoglobulin constant region and have an FcRn binding site.
  • the biocompatible material is characterized in that the immunoglobulin Fc region.
  • the insulin or analogue conjugate thereof is characterized by insulin or an analogue conjugate, wherein each chain of the insulin analogue is linked to each fragment of an immunoglobulin Fc region.
  • each chain of insulin or its analog with each fragment of the immunoglobulin Fc region can be linked at the gene level and by a polymeric polymer such as polyethylene glycol (PEG).
  • PEG polyethylene glycol
  • an insulin or an analogue conjugate thereof or a method for preparing the same, wherein the insulin or an analog thereof and a biocompatible material capable of extending its half-life are bound by peptide bonds.
  • the present invention provides a polynucleotide encoding the insulin and / or an analog conjugate thereof, a vector comprising the polynucleotide, and a transformant comprising the vector.
  • the insulin and / or its analog conjugates are insulin and / or insulin analogue conjugates formed by binding A-chain and B-chain conjugates, respectively, and then A-chain and B-chain conjugates bonded to each other. It features.
  • the immunoglobulin Fc region which is a biocompatible substance that forms the insulin and / or its analogue conjugate, is characterized by a biocompatible substance in which double bonds are enhanced by mutation.
  • the present invention provides a composition for preventing or treating diabetes, including the insulin and / or analogue conjugate thereof.
  • the composition comprises (i) improving the hypoglycemic effect compared to insulin; (ii) increased blood persistence compared to insulin: (iii) maintaining activity in vivo; And (iv) a reduced side effect of hypoglycemic effects as compared to insulin.
  • the present invention provides insulin and / or analogue conjugates thereof in one embodiment.
  • the insulin conjugate or insulin analogue conjugate is a single chain linker in which the insulin or insulin analogue moiety is linked by peptide bonds to an immunoglobulin Fc fragment moiety via an amino acid or non-amino acid linker. to be.
  • the insulin and / or analogue conjugate is one in which two or more of these linker chains form multimers such as dimers and trimers through chemical associations.
  • the associative association is a concept that includes all covalent bonds, ionic bonds, chemical bonds such as salt bridges, and intermolecular forces such as van der Waals forces and hydrophobic interactions, but is not limited thereto.
  • the chemical association is a disulfide bond formed between other linker Fc fragment sites belonging to the same binder as the Fc fragment site in the linker present in one conjugate.
  • More specific forms of the insulin and / or analogue conjugates of the present invention are conjugated to the aforementioned dimer of the two insulin or insulin analogue conjugates.
  • the insulin or insulin analog sites of each insulin or insulin analogue constituting the dimer may be the same or the same, for example, a pair of insulin and / or analog sites present in the dimeric form of the conjugate They may all be homodimers with wild type B chains, or heterodimers where one insulin and / or analog site is analog of insulin A chain and the other insulin and / or analog site is natural B chain.
  • Such disulfide bonds may be the same or different disulfide bonds present between the completed native insulin A and B chains.
  • an insulin analogue may be used as a method for solving the persistent and hypoglycemic problems of insulin preparations.
  • the "insulin analogue" of the present invention is an insulin variant of a human having a blood glucose lowering property similar to that of insulin, and refers to a peptide having at least one wild-type or natural-type insulin and one or more A-chain, B-chain, and C peptide amino acid sequences.
  • the native insulin amino acid sequence is as follows.
  • the insulin variant of the present invention refers to a peptide having a glycemic control function in the body as a peptide having one or more different amino acid sequences from insulin.
  • the “insulin analogue” of the present invention may include a peptide comprising any one of A chain, B chain, and C peptide, wherein the amino acid sequence of each of the A chain, B chain, and C peptide is native to wild type sequence or wild type sequence. All sequences in which one or more amino acids, which are or are non-naturally added, substituted or deleted, are possible, but are not limited thereto.
  • the insulin analogue of the present invention is homologous to the A chain and B chain of the native insulin in at least 80% amino acid sequence, respectively, and some groups of amino acid residues are chemically substituted (eg, alpha-methylation, alpha-hydroxylation).
  • Peptides which may be in the form of deamination or modified N-methylation, include, but are not limited to, all peptides having the function of regulating blood glucose in the body.
  • Insulin analog of the present invention is a peptide having the same blood glucose control function as the above-described insulin, such peptides include insulin agonists, derivatives, fragments, variants, etc. This is not restrictive.
  • the insulin agonist of the present invention refers to a substance that binds to the in vivo receptor of insulin and exhibits the same biological activity as insulin, regardless of the structure of insulin.
  • the insulin fragment of the present invention refers to a form in which one or more amino acids are added to or deleted from insulin, and the added amino acid may be an amino acid (eg, a D-type amino acid) that does not exist in nature, and such insulin fragment may be Has a glycemic control function.
  • the added amino acid may be an amino acid (eg, a D-type amino acid) that does not exist in nature, and such insulin fragment may be Has a glycemic control function.
  • the preparation methods used in the insulin agonists, derivatives, fragments and variants of the present invention may be used independently and may be combined.
  • peptides having a glycemic control function in a body having one or more amino acid sequences different from each other and deaminated to amino acid residues at the amino terminal are included.
  • the present invention in one embodiment, is to provide a sustained insulin and / or analogue combination thereof, characterized in that the biocompatible material capable of extending the half-life to insulin and / or analogs thereof.
  • insulin and / or analogues thereof to polyethylene glycol, fatty acids, cholesterol, albumin and fragments thereof, albumin binding agents, polymers of repeating units of specific amino acid sequences, antibodies, antibody fragments, FcRn binding materials, in vivo Provided is a sustained insulin conjugate in which a biocompatible material selected from the group consisting of connective tissues or derivatives thereof, nucleotides, fibronectin, transferrin, saccharides, and polymer polymers is bound to the insulin analogue.
  • biocompatible substance refers to a substance that can increase the duration of activity by increasing the in vivo half-life of insulin and / or its analog when covalently bound to insulin and / or its analog to form a conjugate.
  • biocompatible materials such as polyethylene glycol, fatty acids, cholesterol, albumin and fragments thereof, albumin binding agents, Elastin, a water soluble precursor of elastin and a repeating unit of a portion of the elastin protein sequence, a polymer of a repeating unit of a specific amino acid sequence, an antibody, an antibody fragment, an FcRn binding agent, an in vivo connective tissue, a nucleotide, fibronectin, transferrin, a saccharide, High molecular polymers;
  • Insulin and / or its analogs of the present invention are characterized by lower activity than native insulin.
  • Low activity compared to native insulin can lower the risk of hypoglycemia, which is the biggest problem of conventional native insulin, and its sustained formulations maintain low activity and are advantageous for glycemic control for a long time without the risk of hypoglycemia.
  • the insulin conjugate and / or insulin analog conjugate used in the present invention is characterized in that the biocompatible substance or immunoglobulin Fc fragment is bound to the carboxyl terminus by a peptide bond.
  • the present inventors cloned the expression vector by fusion at the gene level of insulin and / or its analog, A-chain or B-chain, at the amino terminus of the immunoglobulin Fc region. Post insulin and / or analogue conjugates thereof.
  • immunoglobulin Fc regions are biodegradable polypeptides that are metabolized in vivo, they are safe for use as carriers of drugs.
  • the immunoglobulin Fc region is advantageous in terms of preparation, purification and yield of the conjugate because of its relatively low molecular weight compared to the whole immunoglobulin molecule, and also removes Fab portions showing high heterogeneity because the amino acid sequence varies from antibody to antibody, It is also expected that the homogeneity of the substance will be greatly increased and the likelihood of inducing blood antigens will be lowered.
  • Insulin and / or analogs thereof used in the present invention are linked to the immunoglobulin Fc region by peptide bonds and are produced as sustained insulin and / or analogue conjugates in the expression host.
  • the expression host may be a microorganism, such as E. coli, which can produce a protein by transforming with an external gene, and there are no limitations such as yeast, insect cells, and animal cells.
  • A-chain and B-chain conjugates of insulin and / or insulin analogues produced through the expression host are linked to the A and B chains by double-bonding the Fc regions with each other during the folding process. Is completed.
  • the double bond may be a disulfide bond.
  • the variation of the Fc region is tyrosine (Tyr), which is the ninth amino acid of the CH3 domain of IgG1, as threonine (Thr), serine (Ser) as the 24th amino acid, and histidine (His), and threonine (Thr, 54th amino acid).
  • Teyr tyrosine
  • Amino acid variations that can promote double bonds are included without limitation, and may be modified in various combinations. In the embodiment of the present invention as a representative example, but produced using IgG1 as the Fc region, IgG2, IgG3, IgG4 and the like are included without limitation.
  • the "immunoglobulin constant region” which may be a constituent of a moiety of insulin and / or an insulin analogue conjugate, includes an immunoglobulin Fc region and also a heavy and light chain variable region of an immunoglobulin.
  • immunoglobulin Fc region a heavy chain constant region 1 (CH1) and light chain constant region (CL1)
  • heavy chain constant region 2 CH2
  • heavy chain constant region 3 CH3
  • Immunoglobulin constant regions of the invention include 1) CH1 domain, CH2 domain, CH3 domain and CH4 domain, 2) CH1 domain and CH2 domain, 3) CH1 domain and CH3 domain, 4) CH2 domain and CH3 domain, 5) 1 Or a combination of two or more domains with an immunoglobulin hinge region (or a portion of the hinge region), 6) heavy chain constant region dimer of each domain and light chain constant region.
  • immunoglobulin Fc regions of the present invention include naturally occurring amino acid sequences as well as their sequence derivatives.
  • Amino acid sequence derivatives mean that one or more amino acid residues in a natural amino acid sequence have different sequences by deletion, insertion, non-conservative or conservative substitution, or a combination thereof.
  • IgG Fc amino acid residues 214 to 238, 297 to 299, 318 to 322 or 327 to 331 which are known to be important for binding can be used as suitable sites for modification.
  • various kinds of derivatives are possible, such as a site capable of forming disulfide bonds, a few amino acids at the N-terminus in the native Fc, or a methionine residue may be added at the N-terminus of the native Fc. Do.
  • complement binding sites such as C1q binding sites may be removed, or ADCC (antibody dependent cell mediated cytotoxicity) sites may be removed to eliminate effector function.
  • ADCC antibody dependent cell mediated cytotoxicity
  • Amino acid exchanges in proteins and peptides that do not alter the activity of the molecule as a whole are known in the art (H. Neurode, R. L. Hill, The Proteins, Academic Press, New York, 1979).
  • the most commonly occurring exchanges are amino acid residues Ala / Ser, Val / Ile, Asp / Glu, Thr / Ser, Ala / Gly, Ala / Thr, Ser / Asn, Ala / Val, Ser / Gly, Thy / Phe, Ala / Exchange between Pro, Lys / Arg, Asp / Asn, Leu / Ile, Leu / Val, Ala / Glu, Asp / Gly.
  • the immunoglobulin Fc region may be a human or animal origin, such as cattle, goats, pigs, mice, rabbits, hamsters, rats, guinea pigs, preferably human origin.
  • the immunoglobulin Fc region may be an Fc region derived from IgG, IgA, IgD, IgE, IgM or combinations thereof or hybrids thereof. For example, it may be derived from IgG or IgM, which is most abundant in human blood, and may be derived from IgG known to enhance half-life of ligand binding proteins.
  • the combination means that, when forming a dimer or multimer, the polypeptide encoding the single-chain immunoglobulin Fc region of the same origin forms a bond with the single-chain polypeptide of different origin. That is, it is possible to prepare dimers or multimers from two or more fragments selected from the group consisting of Fc fragments of IgG Fc, IgA Fc, IgM Fc, IgD Fc and IgE.
  • hybrid is a term used to mean that there is a sequence corresponding to two or more immunoglobulin Fc fragments of different origins within an immunoglobulin Fc region of a single chain.
  • various types of hybrids are possible. That is, hybridization of a domain consisting of 1 to 4 domains from the group consisting of CH1, CH2, CH3 and CH4 of IgG Fc, IgM Fc, IgA Fc, IgE Fc and IgD Fc is possible, and may include a hinge.
  • IgG can also be divided into subclasses of IgG1, IgG2, IgG3 and IgG4 and combinations or hybridization thereof are also possible in the present invention.
  • IgG may be an IgG2 and IgG4 subclass, and in a specific example, may be, but is not limited to, an Fc region of IgG4 having little effector function such as Complementdependent cytotoxicity (CDC).
  • CDC Complementdependent cytotoxicity
  • the immunoglobulin Fc region which is a moiety of the insulin and / or analogue conjugate of the present invention, may be an Fc region derived from human IgG1, but an Fc region that may be used as a moiety of the conjugate is Included without limitation.
  • Human-derived Fc regions are preferred over non-human-derived Fc regions that can cause undesirable immune responses, such as acting as antigens in human living organisms to produce new antibodies against them.
  • This insulin or analogue conjugate of the present invention not only maintains the in vivo activity of existing insulins such as energy metabolism and sugar metabolism, but also significantly increases the blood half-life of the insulin analogue and the sustained effect of the peptide in vivo. Therefore, it may be useful for the treatment of diabetes (Diabetes).
  • the present invention provides a conjugate having the following Chemical Formula 1.
  • X is A chain of insulin or A chain of insulin analogue
  • L is a linker
  • a is 0 or a natural number, provided that when L is 2 or more, each L is independent of each other,
  • Y is B chain of insulin or B chain of insulin analogue
  • F1 and F2 comprise an immunoglobulin constant region and are characterized by having an FcRn binding site.
  • the chemical bond (:) of the above-mentioned conjugate is F-chain and F2, that is, Fc region is double-bonded to each other in the folding process after expression of [X-La-F1] and [Y-La-F2].
  • the chain conjugate may be in the form of a hetero dimer.
  • the chemical bond may be a disulfide bond, but is not limited thereto.
  • the F1 and F2 may be an immunoglobulin region substituted with a non-natural amino acid, and F2 and F1 may be amino acids substituted with different combinations, but are not limited thereto.
  • the B chain of the insulin analogue is amino acid 1, 2, 3, 5, 8, 10, 12, 16, 23, B.
  • One or more amino acids selected from the group consisting of amino acids, amino acids 24, 25 amino acids, 26 amino acids, 27 amino acids, 28 amino acids, 29 amino acids, and 30 amino acids may be substituted or deleted with other amino acids.
  • amino acids 1, 2, 3, 5, 8, 10, 12, 16, 23, 24, 25 amino acids 1, 2, 3, 5, 8, 10, 12, 16, 23, 24, 25
  • One or more amino acids selected from the group consisting of amino acid 26, amino acid 27, amino acid 28, amino acid 29, and amino acid 30 may be substituted with other amino acids.
  • the A chain of the insulin analogue is amino acid 1, 2, 5, 8, 10, 12, 14, 16, 17
  • One or more amino acids selected from the group consisting of amino acid number 18, amino acid number 18, amino acid number 19 and amino acid number 21 may be substituted or deleted with another amino acid.
  • amino acids 1, 2, 5, 8, 10, 12, 14, 16, 17, 18, 19 And one or more amino acids selected from the group consisting of amino acids 21 may be substituted with other amino acids.
  • the insulin analogue is selected from the group consisting of amino acid No. 8, amino acid No. 23, amino acid No. 24, amino acid No. 25, amino acid No. 1, amino acid No. 2, amino acid No. 14 and 19 No. It is characterized in that one or more selected amino acids are substituted with other amino acids.
  • the substituted amino acid is selected from the group consisting of alanine, glutamic acid, asparagine, isoleucine, valine, glutamine, glycine, lysine, histidine, cysteine, phenylalanine, tryptophan, proline, serine, threonine and aspartic acid It features.
  • the substituted amino acid is one selected from the group consisting of amino acid No. 8, amino acid No. 23, amino acid No. 24, amino acid No. 25, amino acid No. 1, A No. 2 and No. 19 of the A chain.
  • the amino acid may be substituted with alanine, or amino acid 14 of the A chain may be substituted with glutamic acid or asparagine, but is not limited thereto.
  • L is selected from the group consisting of peptides, polyethylene glycols, fatty acids, saccharides, polymers, low molecular weight compounds, nucleotides, and combinations thereof.
  • X and F1, Y and F2 are characterized in that they are bonded to each other by L in a covalent chemical bond, a non-covalent chemical bond or a combination thereof.
  • the F is an IgG Fc region.
  • Another aspect of the invention is a polynucleotide encoding said insulin or analog thereof, an expression vector comprising said polynucleotide and a transformant comprising said expression vector.
  • the insulin and / or analog thereof is as described above.
  • the polynucleotide is deoxyribonucleotide (DNA) or ribonucleotide (RNA) present in single- or double-stranded form, and has a meaning including genomic DNA, cDNA, and RNA transcribed therefrom, and the basic nucleotide is Natural nucleotides, as well as analogs with modified sugar or base sites (Scheit, Nucleotide Analogs, John Wiley, New York, 1980; Uhlman and Peyman, Chemical Reviews, 90: 543-584, 1990). Polynucleotides of the invention can be isolated or prepared using standard molecular biology techniques.
  • Recombinant vectors according to the invention are typically constructed as vectors for cloning or vectors for expression and as vectors for use of prokaryotic or eukaryotic cells as host cells.
  • the term "vector” refers to a nucleic acid construct that is a recombinant vector capable of expressing a protein of interest in a suitable host cell, and that includes an essential regulatory element operably linked to express a nucleic acid insert.
  • the present invention can produce a recombinant vector comprising a nucleic acid encoding insulin or an analog thereof, by transforming or transfecting the recombinant vector into a host cell, the insulin of the present invention and / or its Analog can be obtained.
  • the nucleic acid encoding insulin and / or its analog is operably linked to a promoter.
  • operatively linked means a functional binding between a nucleic acid expression control sequence (eg, promoter, signal sequence, ribosomal binding site, transcription termination sequence, etc.) and another nucleic acid sequence. And, thereby, the regulatory sequence regulates transcription and / or translation of the other nucleic acid sequence.
  • promoter refers to a non-readed nucleic acid sequence upstream of a coding region, i.e., a polymerase, that contains a binding site for polymerase and has a transcription initiation activity to mRNA of a promoter subgene. It refers to the DNA region to initiate the transcription of the gene, and is located at the 5'-site of the mRNA transcription start site.
  • the vector of the present invention is a recombinant vector and the prokaryotic cell is a host
  • powerful promoters capable of promoting transcription e.g., tac promoter, lac promoter, lacUV5 promoter, lpp promoter, pL ⁇ promoter, pR ⁇ promoter, rac5 promoter, amp promoter, recA promoter, SP6 promoter, trp promoter and T7 promoter, etc.
  • ribosome binding sites for initiation of translation and transcription / detoxification sequences e.g., tac promoter, lac promoter, lacUV5 promoter, lpp promoter, pL ⁇ promoter, pR ⁇ promoter, rac5 promoter, amp promoter, recA promoter, SP6 promoter, trp promoter and T7 promoter, etc.
  • vectors that can be used in the present invention are plasmids often used in the art (eg, pSC101, pGV1106, pACYC177, ColE1, pKT230, pME290, pBR322, pUC8 / 9, pUC6, pBD9, pHC79, pIJ61, pLAFR1, pHV14).
  • plasmids often used in the art (eg, pSC101, pGV1106, pACYC177, ColE1, pKT230, pME290, pBR322, pUC8 / 9, pUC6, pBD9, pHC79, pIJ61, pLAFR1, pHV14).
  • pGEX series, pET series, pPICZ ⁇ series, pUC19, etc. phage (e.g. ⁇ gt4 ⁇ ⁇ B, ⁇ -Charon, ⁇ z1 and M13, etc.) or viruses (e.g. SV
  • a promoter derived from the mammalian cell genome eg metallothionine promoter
  • a promoter derived from a mammalian virus eg adenovirus
  • Late promoters vaccinia virus 7.5K promoters
  • SV40 promoters e.g., SV40 derived poly adenylation sequences
  • tk promoters e.g., SV40 derived poly adenylation sequences
  • the recombinant vectors of the present invention include antibiotic resistance genes commonly used in the art as selection markers, for example ampicillin, gentamicin, carbenicillin, chloramphenicol, streptomycin, kanamycin, geneticin, neomycin And resistance genes for tetracycline can be used.
  • antibiotic resistance genes commonly used in the art as selection markers, for example ampicillin, gentamicin, carbenicillin, chloramphenicol, streptomycin, kanamycin, geneticin, neomycin And resistance genes for tetracycline can be used.
  • the recombinant vector of the present invention may further comprise other sequences as necessary to facilitate purification of the protein of interest, ie insulin and / or its analog, which is to be recovered.
  • the additionally included sequence may be a tag purification tag sequence, such as glutathione S-transferase (Pharmacia, USA), maltose binding protein (NEB, USA), FLAG (IBI, USA) and 6 histidines. (hexahistidine) and the like, but the examples do not limit the type of sequence required for purification of the target protein.
  • Fusion proteins expressed by recombinant vectors comprising such tag sequences can be purified by affinity chromatography. For example, when glutathione-S-transferase is fused, glutathione, which is a substrate of this enzyme, can be used. When six histidine tags are used, a desired protein can be easily recovered by using a Ni-NTA column. .
  • a transformant transformed with the vector can be constructed.
  • transformation refers to introducing DNA into a host cell so that the DNA can be reproduced as a factor of a chromosome or by completion of chromosome integration. It means a phenomenon causing change.
  • transformation methods include CaCl 2 Precipitation method, CaCl 2 Hanahan method, the electroporation method, calcium phosphate precipitation method, plasma fusion method, agitation method using silicon carbide fibers, agrobacterial mediated transformation method which improved efficiency by using reducing material called dimethyl sulfoxide (DMSO) in precipitation method , PEG-based transformation, dextran sulfate, lipofectamine and dry / inhibitory mediated transformation.
  • DMSO dimethyl sulfoxide
  • the method for transforming a recombinant vector comprising a nucleic acid encoding insulin and / or an analog thereof according to the present invention is not limited to the above examples, and transformation or transfection methods commonly used in the art can be used without limitation. Can be.
  • the transformant of the present invention can be obtained by introducing into a host cell a recombinant vector comprising a nucleic acid encoding insulin, which is a nucleic acid of interest, and / or an analog thereof.
  • Suitable hosts for the present invention are not particularly limited as long as they allow expression of the nucleic acid of the present invention.
  • Specific examples of hosts that may be used in the present invention include bacteria of the genus Escherichia , such as E. coli ; Bacillus subtilis (Bacillus subtilis) and Bacillus (Bacillus), such as bacteria belonging to the genus; Bacteria of the genus Pseudomonas, such as Pseudomonas putida ; Pichia pastoris , Saccharomyces cerevisiae ), Schizosaccharomyces yeast such as pombe ); Insect cells such as Spodoptera luciferda (SF9); And animal cells such as CHO, COS, BSC, and the like, but are not limited thereto.
  • the present invention provides a pharmaceutical composition for treating diabetes comprising the insulin and / or the analog conjugate thereof.
  • the composition has any one of the following characteristics: (i) improving blood glucose enhancing effect over insulin; (ii) increased blood persistence compared to insulin: (iii) maintaining activity in vivo; And (iv) reduced side effects of hypoglycemia compared to insulin.
  • Immunoglobulin Fc regions were fused at the gene level to A and B chains of native insulin, respectively, and inserted into expression vectors, respectively.
  • the immunoglobulin Fc region that binds to the A chain is specifically an immunoglobulin Fc region in which serine (Ser), amino acid 24 of the CH3 region, is substituted with histidine (His), and phenylalanine (Phe), amino acid 75, is substituted with alanine (Ala).
  • the immunoglobulin Fc region that binds to the B chain is specifically composed of tyrosine (Tyr), amino acid 9 of the CH3 region, as threonine (Thr), and threonine (Thr, 54 amino acid) as phenylalanine (Phe). Synthesis using immunoglobulin regions.
  • an expression vector was constructed such that the two linker genes were inserted into the expression vector pET22b vector.
  • the polycistronic expression vector When the polycistronic expression vector is expressed in a host cell, one long mRNA is formed in one vector, and two ribosome binding sites form an A-chain-IgG1 Fc linker and a B-chain-IgG1 Fc linker of two proteins, insulin.
  • the sieves are each expressed.
  • the expressed conjugates are double-bonded to each other, so that the mutated portions of IgG1 CH3 bind to each other to prepare an insulin conjugate in which the A-chain-IgG1 Fc linker and the B-chain-IgG1 Fc linker form a heterodimer.
  • Such insulin conjugates after refolding during expression, do not require the removal of C peptides such as existing insulin conjugates, and thus may increase yield.
  • Such insulin and / or analogue conjugates of the present invention maintain a stable hypoglycemic effect in vivo and improve blood persistence by significantly increasing blood half-life, thereby reducing the convenience and side effects of the insulin preparation. It can be used as an active ingredient.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Diabetes (AREA)
  • Organic Chemistry (AREA)
  • Veterinary Medicine (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Genetics & Genomics (AREA)
  • Zoology (AREA)
  • Endocrinology (AREA)
  • Epidemiology (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Immunology (AREA)
  • Toxicology (AREA)
  • General Engineering & Computer Science (AREA)
  • Wood Science & Technology (AREA)
  • Biotechnology (AREA)
  • Biomedical Technology (AREA)
  • Obesity (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Hematology (AREA)
  • Emergency Medicine (AREA)
  • Physics & Mathematics (AREA)
  • Plant Pathology (AREA)
  • Microbiology (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)

Abstract

본 발명은 인슐린 및/또는 이의 아날로그(insulin analog)와 면역글로불린 Fc 영역을 연결하여, 생체 내 지속성 및 안정성이 향상된 인슐린 및/또는 이의 아날로그 결합체 및 그 이용에 관한 것이다. 본 발명의 인슐린 및/또는 이의 아날로그 결합체는 생체 내에서 인슐린과 유사한 활성을 나타내고, 혈중 반감기가 현저히 증가된 인슐린 및/또는 이의 아날로그의 지속형 제형으로 인슐린 치료의 단점인 저 혈당을 유도하지 않는 획기적인 인슐린 및/또는 이의 아날로그 결합체를 제공한다.

Description

지속형 인슐린 또는 이의 아날로그 결합체
본 발명은 인슐린 및/또는 이의 아날로그와 생체내 반감기를 증가시킬 수 있는, 생체 적합성 물질이 상호 공유결합에 의해 연결되어 있어 생체 내 지속성 및 안정성이 향상된 인슐린 및/또는 이의 아날로그 결합체 및 그 이용에 관한 것이다. 더욱 구체적으로 본 발명은 생체 내에서 지속성 특성이 부여되어 인슐린 치료의 부작용 및 투여 편의성을 향상시킨 획기적인 인슐린 및/또는 이의 아날로그 결합체 및 이의 제조방법에 관한 것이다. 또한, 본 발명은 인슐린 및/또는 인슐린 아날로그와 생체 내 반감기를 증가시킬 수 있는, 생체 적합성 물질 상호 공유결합에 의해 연결된 결합체를 제공한다.
인슐린은 인체의 췌장에서 분비되는 혈당 조절 호르몬으로, 혈액 내의 잉여 포도당을 세포로 옮겨 세포에 에너지원을 공급하는 한편 혈당을 정상 수준으로 유지시켜 주는 역할을 한다. 그러나 당뇨 환자의 경우 이러한 인슐린이 부족하거나 인슐린 저항성 및 베타 세포의 기능소실로 인하여 인슐린이 정상적인 기능을 나타내지 않아 혈액 내의 포도당을 에너지원으로 이용하지 못하고 혈중 포도당 수준이 높은 고혈당 증세를 나타내어 결국 소변으로 당을 배출하게 되며 여러 합병증과 연계되어 있다. 따라서 인슐린 생성이 이상이 있거나(Type I), 인슐린 내성으로 인한(Type Ⅱ) 당뇨환자에게는 인슐린 치료가 필수적이며, 인슐린 투여로 인해 정상 수준으로 혈당을 조절할 수 있다.
이와 같은 치료를 위한 인슐린 제제로는 천연 인슐린뿐만 아니라, 사람 인슐린을 변형시켜 작용시간 등을 개선한 인슐린 아날로그 등이 개발되고 있다.
유전자 재조합 기술에 의한 최초의 사람 인슐린 아날로그는 일라이릴리사(Eli lilly)의 인슐린 리스프로(Lispro)로 B쇄 카복실말단 두 번째 라이신 잔기와 세 번째 프롤린 잔기의 순서를 바꾸어 인슐린 이량체 및 육량체의 형성을 막아 주사 투여 시 혈당 강하 활성이 좋은 단량체 인슐린의 양을 늘린 인슐린 아날로그이다. 노보노디스크사(Novo Nordisk)의 인슐린 아스파트(aspart)는 B쇄 28번 프롤린 잔기를 아스파틱산 잔기로 치환하여, 전하의 반발력(repulsion)을 증가시켜 인슐린 육량체의 형성을 막아 초속효성 활성을 나타내도록 만들어진 아날로그이다. 사노피 아벤티스사의 인슐린 글루이진(Glulisine)은 B쇄 3번 아스파라진(asparagine) 잔기를 라이신(Lysine) 잔기로 치환하고, B쇄 29번 라이신(Lysine) 잔기를 글루탐산(glutamic acid) 잔기로 치환하여 빠른 혈당 강하 효과를 나타내도록 만들어진 아날로그이다.
그러나, 인슐린의 경우 다른 단백질 및 펩타이드 호르몬과 마찬가지로 체내반감기가 극히 짧아 치료학적 효과를 지속적으로 나타내기 힘들며, 효과를 나타내기 위해서는 지속적으로 반복 투여를 해야 한다는 단점이 있다. 또한 대부분 주사제 형태로 환자에게 투여되나, 인슐린의 혈중 농도를 유지하기 위해서는 자주 주사하게 되는데, 이는 환자에게 엄청난 고통을 야기하게 된다. 따라서, 인슐린의 생체 내 반감기를 증가시켜 투여 횟수를 줄임으로써 치료학적 효과를 높이며 환자의 삶의 질을 높이기 위해 여러 단백질 제형화 연구와 화학적 결합체 등(지방산 결합체, 폴리에틸렌중합체 결합체)에 대한 연구가 진행되어 왔다.
이러한 인슐린 제제의 투여상의 문제점을 극복하기 위하여 다양한 시도 중 하나로 인슐린 약물의 생체막 투과도를 증가시켜 구강 또는 비강을 통한 흡입으로 인슐린 약물을 체내로 전달하는 시도가 있었다. 화이자사의 흡입형 당뇨병 인슐린 치료제 '엑수베라(Exubera)'는 주사투여의 불편함을 개선한 획기적인 흡입형 속효성 인슐린 제제로 주사형 인슐린제제와 유사한 혈당강하 효과를 나타내어 주목받았으나, 폐암 발병 위험 등의 안전성 문제 및 매출 부진으로 인하여 시장에서 철수 되었다. 또한 노보노디스크사, 릴리사등 여러 제약회사에서 흡입형 인슐린 개발에 착수하였다가 중단한 바 있다.
이러한 흡인형 투여 방법은 간단하고 환자 스스로도 고통 없이 투여할 수 있는 방법을 제공하여 기존의 주사 투여 보다는 확실하게 선호되고 있지만 주사제에 비해 약물의 체내 전달 효율이 낮으며 약물의 체내 활성을 요구되는 조건으로 유지하는데 아직까지는 어려움이 많다. 또한 미생물 및 병원균에 의한 오염, 안정성 및 내구성등 흡입형 투여에 알맞은 조성물을 준비하는데 어려움이 있다. 그리고 흡입형 제품을 폐로 전달하는 것은 부종, 세포손상 및 조직에 염증을 유발할 수 있는 부작용으로 인하여 폐 흡수 메카니즘에 대한 연구가 더 필요하며, 현재 흡수 메커니즘, 흡수율 및 범위를 예측하는 능력은 초기 단계에 있다.
그러나 아직도 많은 연구자 및 제약사들은 인슐린제제의 호흡기 전달을 가능한 것으로 보고 계속해서 개발 노력을 쏟고 있으며, 현재 엑수베라의 단점을 극복 한 맨카인드(mannkind)사의 흡입형 인슐린제제 아프레자(Afrezza)가 FDA 승인 대기 중에 있다.
이외에도 투여 편의성을 향상시키고 효과적인 치료에 충분한 수준의 생물학적 이용 가능성을 가진 투여 방법의 개발은 지난 수년간 진행되어 왔으며, 경구, 비강 및 경피 흡수 등의 투여 경로가 인슐린 제제가 현재 임상 시험 진행 중에 있다. (E.-S. Khafagy et al. , Advanced Drug Delivery Reviews ; 59, (2007) 1521-1546).
한편, 인슐린 제제 약물의 혈중 안정성을 증가시키고 혈중 약물 농도를 오랫동안 높게 지속시켜 약효 극대화 및 투여 편의성을 향상시키려는 노력이 계속되어 왔다. 이와 같은 인슐린 약물의 지속형 제제는 인슐린의 안정성을 높이는 동시에 약물 자체의 역가가 충분히 높게 유지되고, 환자에게 저혈당 반응을 유발하지 않아야 한다.
현재 시판중인 지속형 인슐린 제제로는 사노피-아베티스사(sanofi-aventis)의 인슐린 글라진(insulin glargine, lantus)과 노보노디스크사(Novo Nordisk)의 인슐린 디터미르(insulin detemir, levemir)가 있다. 사노피-아벤티스사의 인슐린 글라진은 최초의 지속형 인슐린으로 A쇄의 21번째 아스파라진을 글라이신으로 치환하고, B쇄에 2개의 아르지닌 잔기를 추가하여 산성 pH에서 가용성 성질을 가지며 생체내의 pH에서는 낮은 가용성 성질을 나타내어, 피하 투여시에 인슐린의 침전을 유도하여 천천히 흡수되도록 제조되었다. 인슐린 글라진의 지속 시간은 약 20~22시간으로 속효성(5~8시간) 및 초 속효소성(3~5시간) 인슐린 대비 작용시간이 길고, 인슐린 농도의 피크가 없어 저혈당이 발생하지 않는다는 장점을 가지고 있다. 노보노디스크사의 인슐린 디터미르는 가장 최근에 개발된 지속형 인슐린 제제로 B쇄의 30번째 트레오닌 잔기를 제거하고 B쇄의 29번 라이신 잔기에 아실화를 시켜, 인체 투여 시에 알부민과 결합할 수 있도록 제작하여 지속형의 특성을 부여하였다(Allison J. et al, DM. 148-162, 2010). 아울러, 지속 시간은 인슐린 글라진보다 약간 짧은 18~22시간으로 하루 1회 또는 2회 제형으로 개발되었다. 이들 지속성 인슐린들은 혈중 인슐린 농도의 피크가 없어 기저 인슐린으로 적합하다. 그러나 이러한 지속형 인슐린들은 충분히 반감기가 길지 않아 매일 1회 또는 2회 투여해야 하는 불편함이 여전히 존재하여 장기간 투여해야 하는 당뇨병 환자의 경우 투여 빈도를 획기적으로 낮추어 환자의 편의성을 증가시킬 수 있는 제제의 필요성이 매우 요구되고 있다.
본 발명자들은 혈중 지속성 향상으로 투여의 편의성을 증대시키기 위한, 지속형 인슐린 제제를 개발하고자 예의 노력한 결과, 인슐린 및 이의 아날로그에 반감기를 증가시킬 수 있는 면역글로불린 불변 영역에 인슐린 A쇄 (A chain)와 B쇄 (B chain)가 각각 연결된 A-쇄 결합체와 B-쇄 결합체가 결합되어 형성된, 새로운 형태의 결합체인 인슐린 또는 이의 아날로그 결합체를 제조하였다. 이와 같은 결합체는 정제시 C-펩타이드 (C-peptide)의 제거 과정이 필요 없어 수율을 높일 수 있으며, 반감기를 획기적으로 증가시킬 수 있을 것으로 기대되고 있다.
본 발명의 하나의 목적은 인슐린의 체내 반감기 연장 및 혈당 강하 효력을 유지하는, 인슐린의 아날로그 및 반감기를 연장시킬 수 있는 생체적합성 물질이 펩타이드 결합에 의해 결합된, 인슐린 및/또는 이의 아날로그 결합체를 제공하는 것이다.
본 발명의 또 하나의 목적은 인슐린 및/또는 이의 아날로그 및 이의 반감기를 연장시킬 수 있는 생체적합성 물질이 펩타이드 결합에 의해 결합된, 인슐린 또는 이의 아날로그 결합체를 제공하는 것이다.
본 발명의 또 하나의 목적은 인슐린 및/또는 이의 아날로그 결합체인 하기 화학식 1을 갖는 지속형 결합체를 제공하는 것이다.
[화학식 1]
X-La-F1:Y-La-F2
여기에서,
X는 인슐린 A쇄 또는 인슐린 아날로그의 A쇄이고,
L은 링커이며,
a는 0 또는 자연수이며, 단 a가 2이상일 때 각각의 L은 서로 독립적이고,
:는 화학결합이며,
Y는 인슐린 B쇄 또는 인슐린 아날로그의 B쇄이고,
F1과 F2는 면역글로불린 불변 영역을 포함하며 FcRn 결합부위를 가짐.
본 발명의 또 하나의 목적은 상기 인슐린 및/또는 이의 아날로그 결합체를 코딩하는 폴리뉴클레오티드, 상기 폴리뉴클레오티드를 포함하는 벡터, 및 상기 벡터를 포함하는 형질전환체를 제공하는 것이다.
본 발명의 또 하나의 목적은 인슐린 및/또는 이의 아날로그의 A쇄 결합체와 B쇄 결합체가 각각 코딩된 후 이중 결합된, 인슐린 및/또는 인슐린 아날로그 결합체를 제공하는 것이다.
본 발명의 또 하나의 목적은 인슐린 및/또는 이의 아날로그의 A쇄와 B쇄에 각각 결합되어 있는 생체 적합성 물질의 변이에 의해 A쇄 결합체와 B쇄 결합체의 이중 결합 형성이 증진된, 인슐린 또는 인슐린 아날로그 결합체를 제공하는 것이다.
본 발명의 또 하나의 목적은 상기 인슐린 및/또는 이의 아날로그 결합체를 포함하는, 당뇨병의 예방 또는 치료용 조성물을 제공하는 것이다.
본 발명의 또 하나의 목적은 상기 인슐린 및/또는 이의 아날로그 결합체를 이를 필요로 하는 개체에 투여하는 단계를 포함하는, 당뇨병의 치료 방법을 제공하는 것이다.
본 발명의 또 하나의 목적은 인슐린 및/또는 이의 아날로그의 A쇄 결합체와 B쇄 결합체가 각각 코딩된 후 이중 결합된, 인슐린 및/또는 인슐린 아날로그 결합체를 제조하는 방법을 제공하는 것이다.
본 발명의 또 하나의 목적은 인슐린 및/또는 이의 아날로그의 A쇄 결합체와 B쇄 결합체가 각각 코딩된 후 이중 결합된, 인슐린 및/또는 인슐린 아날로그 결합체를 제조하는 방법을 제공함에 있어, 재접힘 (refolding) 과정 후 C-펩타이드의 제거가 결여된 제조 방법을 제공하는 것이다.
본 발명의 인슐린 및/또는 이의 아날로그 결합체는 생체 내에서 안정적인 혈당 강하 효과를 유지하고, 혈중 반감기가 현저히 증가하여 인슐린의 투여 편의성 및 부작용을 개선하는 효과가 있다.
본 발명을 구현하기 위한 하나의 양태는 인슐린의 체내 반감기 연장 및 혈당 강하 효력을 유지하는, 인슐린 및/또는 이의 아날로그 및 반감기를 연장 시킬 수 있는 생체적합성 물질이 펩타이드 결합에 의해 결합된, 인슐린 및/또는 이의 아날로그 결합체, 또는 이의 제조 방법을 제공한다.
하나의 구체예로서, 상기 인슐린 및/또는 이의 아날로그 결합체는 하기 화학식 1을 갖는 지속형 결합체이다.
[화학식 1]
X-La-F1:Y-La-F2
여기에서,
X는 야생형 인슐린 A쇄 또는 그 아날로그이고,
L은 링커이며,
a는 0 또는 자연수이며, 단 a가 2이상일 때 각각의 L은 서로 독립적이고,
:는 화학결합이며,
Y는 야생형 인슐린 B쇄 또는 그 아날로그이고,
F1과 F2는 면역글로불린 불변 영역을 포함하며 FcRn 결합부위를 가짐.
하나의 구체예로서, 상기 생체적합성 물질은 면역글로불린 Fc 영역임을 특징으로 한다.
또 하나의 구체예로서, 상기 인슐린 또는 이의 아날로그 결합체는 상기 인슐린 아날로그의 각 쇄 (chain)가 면역글로불린 Fc 영역의 각 단편에 연결된, 인슐린 또는 이의 아날로그 결합체를 특징으로 한다.
인슐린 또는 이의 아날로그의 각 쇄와 면역글로불린 Fc 영역의 각 단편과의 연결은 유전자 수준에서 연결할 수 있으며 PEG(Polyethylene glycol)와 같은 고분자 중합체에 의할 수 있다.
본 발명의 또 하나의 양태로서, 인슐린 또는 이의 아날로그 및 이의 반감기를 연장시킬 수 있는 생체적합성 물질이 펩타이드 결합에 의해 결합된, 인슐린 또는 이의 아날로그 결합체, 또는 이의 제조 방법을 제공한다.
본 발명은 또 하나의 양태로서, 상기 인슐린 및/또는 이의 아날로그 결합체를 코딩하는 폴리뉴클레오티드, 상기 폴리뉴클레오티드를 포함하는 벡터, 및 상기 벡터를 포함하는 형질전환체를 제공한다.
본 발명은 또 하나의 양태로서, 상기 인슐린 및/또는 이의 아날로그 결합체는 A쇄 결합체와 B쇄 결합체가 각각 코딩된 후 A쇄 결합체와 B쇄 결합체가 서로 결합되어 형성된 인슐린 및/또는 인슐린 아날로그 결합체를 특징으로 한다.
본 발명은 또 하나의 양태로서, 상기 인슐린 및/또는 이의 아날로그 결합체를 형성하는 생체 적합성 물질인 면역글로불린 Fc 영역은 변이에 의해 이중결합이 증진된 생체적합성 물질을 특징으로 한다.
본 발명은 또 하나의 양태로서, 상기 인슐린 및/또는 이의 아날로그 결합체를 포함하는, 당뇨병의 예방 또는 치료용 조성물을 제공한다.
또 하나의 구체예로서, 상기 조성물은 (i) 인슐린에 비해 혈당 강하 효과 개선; (ii) 인슐린에 비해 혈중 지속성 증가: (iii) 생체 내 활성 유지; 및 (iv) 인슐린에 비해 부작용인 저혈당 효과 감소 중 어느 하나 이상을 갖는 것을 특징으로 한다.
이하, 본 발명을 상세히 설명한다.
본 발명은 하나의 구체예로 인슐린 및/또는 이의 아날로그 결합체를 제공한다.
본 발명의 한 실시 형태에서 인슐린 결합체 또는 인슐린 아날로그 결합체는 인슐린 또는 인슐린 아날로그 부위(moiety)가 아미노산 또는 비아미노산 링커를 통하여 면역글로불린 Fc 절편 부위(moiety)에 펩타이드 결합으로 연결된, 단일한 사슬의 연결체이다. 본 발명의 다른 한 실시 형태에서 인슐린 및/또는 아날로그 결합체는 이러한 연결체 사슬 둘 이상이 화학적인 회합(chemical association)을 통하여 이량체(dimer), 삼량체(trimer) 등의 다량체를 형성한 것일 수 있다. 여기서 화합적인 회합이란 공유결합, 이온결합, 염다리 등의 화학결합 및 반데르바알스 힘, 소수성 상호작용 등 분자간 힘을 모두 망라하는 개념이나, 이에 제한되지 않는다. 이 다량체 실시 형태의 한 구체예에서 상기 화학적인 회합은 하나의 결합체 내에 존재하는 연결체 내 Fc 절편 부위와 같은 결합체에 속한 다른 연결체 Fc 절편 부위 사이에 형성되는 이황화결합이다. 본 발명의 인슐린 및/또는 이의 아날로그 결합체의 더욱 구체적인 형태는 전술한 인슐린 또는 인슐린 아날로그 연결체 두 개가 회합한 이량체가 결합체를 이룬다. 이 때 상기 이량체를 이루는 각 인슐린 또는 인슐린 아날로그 연결체의 인슐린 또는 인슐린 아날로그 부위끼리는 서로 동일하거나 같을 수 있는데, 예를 들어 상기 이량체 형태의 결합체 내에 존재하는 한 쌍의 인슐린 및/또는 아날로그 부위들이 모두 야생형 B쇄로 동일한 호모이량체일 수도 있고, 한 인슐린 및/또는 아날로그 부위가 인슐린 A쇄의 아날로그이고, 나머지 인슐린 및/또는 아날로그 부위가 천연형 B쇄인 헤테로이량체일 수도 있다. 전술한 특정 헤테로이량체의 실시 형태에서는 인슐린 A쇄 (또는 그 아날로그) 부위와 그와 짝을 이루는 인슐린 B쇄(또는 그 아날로그) 사이에는 직접적인 연결이 없거나, 이황화결합으로 연결될 수 있다. 이러한 이황화결합은 완성된 천연형 인슐린 A쇄와 B쇄 사이에 존재하는 것과 동일하거나 다른 이황화결합일 수 있다.
본 발명의 다른 실시 형태에서는 인슐린 제제의 지속형 및 저혈당 문제를 해결하기 위한 방법으로 인슐린 아날로그를 사용할 수 있다.
본 발명의 "인슐린 아날로그"는 인슐린과 유사한 생체 내 혈당 강하 특성을 보유한 사람의 인슐린 변이체로서, 야생형 또는 천연형 인슐린과 A쇄, B쇄, 그리고 C 펩타이드 아미노산 서열이 하나 이상 다른 펩타이드를 의미한다.
천연형 인슐린 아미노산 서열은 하기와 같다.
A 쇄:
Gly-Ile-Val-Glu-Gln-Cys-Cys-Thr-Ser-Ile-Cys-Ser-Leu-Tyr-Gln-Leu-Glu-Asn-Tyr-Cys-Asn(서열번호 1)
B 쇄:
Phe-Val-Asn-Gln-His-Leu-Cys-Gly-Ser-His-Leu-Val-Glu-Ala-Leu-Tyr-Leu-Val-Cys-Gly-Glu-Arg-Gly-Phe-Phe-Tyr-Thr-Pro-Lys-Thr(서열번호 2)
본 발명의 인슐린 변이체는, 인슐린과 아미노산 서열이 하나 이상 다른 펩타이드로서, 체내에서 혈당조절 기능을 보유한 펩타이드를 의미한다.
본 발명의 “인슐린 아날로그"는 A쇄, B쇄 그리고 C 펩타이드 중 어느 하나를 포함하는 펩타이드를 포함할 수 있으며, A쇄, B쇄, C 펩타이드 각각의 아미노산 서열은 야생형 서열 또는 야생형 서열에 천연형이거나 비천연형인 하나 이상의 아미노산이 추가, 치환 또는 삭제된 서열이 모두 가능하나 이에 제한되지 않는다.
본 발명의 인슐린 아날로그는 천연형 인슐린의 A쇄, B쇄와 각각 최소한 80%이상 아미노산 서열에서 상동성을 보이며, 아미노산 한 잔기의 일부 그룹이 화학적으로 치환(예; alpha-methylation, alpha-hydroxylation), 제거(예;deamination) 또는 수식(예; N-methylation)된 형태일 수 있고, 체내에서 혈당을 조절하는 기능을 보유한 펩타이드를 모두 포함하나, 이에 제한되지 않는다.
본 발명의 인슐린 아날로그는 상기 기술한 인슐린과 동일한 생체내의 혈당 조절기능을 보유한 펩타이드로서, 이러한 펩타이드는 인슐린 아고니스트(agonist), 유도체(derivatives), 단편(fragments), 변이체(variants) 등을 포함하나, 이에 제한되지 않는다.
본 발명의 인슐린 아고니스트는 인슐린의 구조와 상관없이 인슐린의 생체 내 수용체에 결합하여 인슐린과 동일한 생물학적 활성을 나타내는 물질을 의미한다.
본 발명의 인슐린 단편은 인슐린에 하나 또는 그 이상 아미노산이 추가 또는 삭제된 형태를 의미하며 추가된 아미노산은 천연에 존재하지 않는 아미노산 (예; D형 아미노산) 도 가능할 수 있고, 이러한 인슐린 단편은 체내에서 혈당조절 기능을 보유한다.
본 발명의 인슐린 아고니스트, 유도체, 단편 및 변이체에서 각각 사용된 제조방법은 독립적으로 사용될 수 있고 조합도 가능하다. 예를 들어 아미노산 서열이 하나 이상 다르고 아미노 말단의 아미노산 잔기에 탈아미노화(deamination) 된 체내에서 혈당조절 기능을 보유한 펩타이드도 포함된다.
본 발명은 하나의 구체예로서, 인슐린 및/또는 이의 아날로그에 반감기를 연장시킬 수 있는 생체적합성 물질을 결합시킨 것을 특징으로 하는, 지속형 인슐린 및/또는 이의 아날로그 결합체를 제공하는 것이다.
또 하나의 구체예로서, 인슐린 및/또는 이의 아날로그에 폴리에틸렌글리콜, 지방산, 콜레스테롤, 알부민 및 이의 단편, 알부민 결합물질, 특정 아미노산 서열의 반복단위의 중합체, 항체, 항체 단편, FcRn 결합물질, 생체 내 결합조직 혹은 그 유도체, 뉴클레오타이드, 파이브로넥틴, 트랜스페린(Transferrin), 당류(saccharide) 및 고분자 중합체로 이루어진 군에서 선택된 생체적합성 물질을 인슐린 아날로그에 결합한 지속형 인슐린 결합체를 제공한다.
본 발명에서 용어, "생체적합성 물질"이란 인슐린 및/또는 이의 아날로그에 공유 결합되어 결합체를 형성했을 때, 인슐린 및/또는 이의 아날로그의 생체 내 반감기를 증가하여 활성 지속시간을 늘려줄 수 있는 물질이다. 그 예로, 반감기 증대 및 생체이용율 및 지속적인 활성유지가 최우선 목적이므로 인슐린 또는 이의 아날로그와 결합될 수 있는 것은 다양한 생체적합성 물질, 예를 들어 폴리에틸렌 글리콜, 지방산, 콜레스테롤, 알부민 및 이의 단편, 알부민 결합물질, 엘라스틴, 엘라스틴의 수용성 전구체 및 엘라스틴 단백질 서열 일부의 반복단위의 중합체, 특정 아미노산 서열의 반복단위의 중합체, 항체, 항체단편, FcRn 결합물질, 생체내 결합조직, 뉴클레오타이드, 파이브로넥틴, 트랜스페린, 당류, 고분자 중합체 등을 제한 없이 포함한다. 또한 인슐린 및/또는 이의 아날로그와 생체 내 반감기를 연장할 수 있는 생체적합성 물질의 연결은 유전자 재조합 방법일 수 있다. 상기 FcRn 결합물질은 면역글로불린 Fc 영역일 수 있다.
본 발명의 인슐린 및/또는 이의 아날로그는 천연형 인슐린 대비 낮은 활성을 갖음을 특징으로 한다. 천연형 인슐린에 비해 낮은 활성은 기존 천연형 인슐린의 가장 큰 문제점인 저혈당 위험을 낮출 수 있으며, 이의 지속형 제형은 낮은 활성을 지속적으로 유지하여 저혈당 위험 없이 긴 시간 동안 혈당 조절에 유리하다.
그 예로, 본 발명에서 사용된 인슐린 결합체 및/또는 인슐린 아날로그 결합체는, 카복실 말단에 상기 생체 적합성 물질 또는 면역글로불린 Fc 단편이 펩타이드 결합으로 결합된 것을 특징으로 한다.
구체적인 일 실시예로서, 본 발명자는 면역글로불린 Fc 영역의 아미노 말단에 인슐린 및/또는 이의 아날로그의, A쇄 (A-chain) 또는 B쇄 (B-chain)을 유전자 수준에서 융합하여 발현벡터에 클로닝 후 인슐린 및/또는 이의 아날로그 결합체를 생산할 수 있다.
면역글로불린 Fc 영역은 생체 내에서 대사되는 생분해성의 폴리펩타이드이기 때문에, 약물의 캐리어로 사용하기에 안전하다. 또한, 면역글로불린 Fc 영역은 면역글로불린 전체 분자에 비해 상대적으로 분자량이 적기 때문에 결합체의 제조, 정제 및 수율 면에서 유리할 뿐만 아니라, 아미노산 서열이 항체마다 다르기 때문에 높은 비균질성을 나타내는 Fab 부분이 제거되기 때문에, 물질의 동질성이 크게 증가되고 혈중 항원성의 유발 가능성도 낮아지게 되는 효과도 기대할 수 있다.
본 발명에서 사용되는 인슐린 및/또는 이의 아날로그는 면역글로불린 Fc 영역과 펩타이드 결합으로 연결되어 발현 숙주에서 지속형 인슐린 및/또는 이의 아날로그 결합체로 생산된다. 발현 숙주는 외부 유전자로 형질전환시켜 단백질을 생산할 수 있는 대장균과 같은 미생물일 수 있으며, 효모, 곤충세포, 동물세포등 제한이 없다.
발현 숙주를 통해 생산되는 인슐린 및/또는 인슐린 아날로그의 A쇄 결합체와 B쇄 결합체는 발현 후 접힘 과정에서 Fc 영역이 서로 이중 결합됨으로서 A쇄와 B쇄가 연결되어, 인슐린 및/또는 이의 아날로그 결합체가 완성된다.
이는 A쇄 결합체와 B쇄 결합체의 호모이량체가 아닌 헤테로이량체화를 촉진함으로써 인슐린 및/또는 이의 아날로그 결합체를 생산할 수 있다.
상기 이중 결합은 이황화 결합(disulfide bond)일 수 있다.
본 발명에서 Fc 영역의 변이는 IgG1의 CH3 도메인의 9번째 아미노산인 티로신(Tyr)을 트레오닌(Thr)으로, 24번째 아미노산인 세린(Ser)을 히스티딘(His)으로, 54번째 아미노산인 트레오닌(Thr)을 페닐알라닌(Phe)으로, 75번째 아미노산인 페닐알라닌(Phe)을 알라닌(Ala)으로 치환하여 이중결합을 촉진하는 인슐린 및/또는 이의 아날로그 결합체를 생산할 수 있으나, 상기 예로 들은 아미노산으로의 치환 뿐 아니라, 이중결합을 촉진시킬수 있는 아미노산 변이는 제한 없이 포함되며, 여러 조합으로 변이가 가능하다. 본 발명의 실시예에서는 대표적인 예로 Fc 영역으로 IgG1을 이용하여 생산하였으나, IgG2, IgG3, IgG4등이 제한 없이 포함된다.
본 발명에서, "면역글로불린 불변영역"은, 인슐린 및/또는 인슐린 아날로그 결합체의 모이어티(moiety)를 이루는 일 구성일 수 있는 것으로, 면역글로불린 Fc 영역을 포함하며 또한 면역글로불린의 중쇄와 경쇄 가변영역, 중쇄 불변영역 1(CH1)과 경쇄 불변영역(CL1)을 제외한, 중쇄 불변영역 2 (CH2)및 중쇄 불변영역 3(CH3)부분을 의미하며, 중쇄 불변영역에 힌지(hinge) 부분을 포함하기도 한다.
본 발명의 면역글로불린 불변영역은 1) CH1 도메인, CH2 도메인, CH3 도메인 및 CH4 도메인, 2) CH1 도메인 및 CH2 도메인, 3) CH1 도메인 및 CH3 도메인, 4) CH2 도메인 및 CH3 도메인, 5) 1개 또는 2개의 이상의 도메인과 면역글로불린 힌지 영역(또는 힌지 영역의 일부)와의 조합, 6) 중쇄 불변영역 각 도메인과 경쇄 불변영역의 이량체일 수 있다.
또한, 본 발명의 면역글로불린 Fc 영역은 천연형 아미노산 서열뿐만 아니라 이의 서열유도체(mutant)를 포함한다. 아미노산 서열 유도체란 천연 아미노산 서열중의 하나 이상의 아미노산 잔기가 결실, 삽입, 비보전적 또는 보전적 치환 또는 이들의 조합에 의하여 상이한 서열을 가지는 것을 의미한다. 예를 들면, IgG Fc의 경우 결합에 중요하다고 알려진 214 내지 238, 297 내지 299, 318 내지 322 또는 327 내지 331번 아미노산 잔기들이 변형을 위해 적당한 부위로서 이용될 수 있다. 또한, 이황화 결합을 형성할 수 있는 부위가 제거되거나, 천연형 Fc에서 N-말단의 몇몇 아미노산이 제거되거나 또는 천연형 Fc의 N-말단에 메티오닌 잔기가 부가될 수도 있는 등 다양한 종류의 유도체가 가능하다. 또한, 이펙터 기능을 없애기 위해 보체결합부위, 예로 C1q 결합부위가 제거될 수도 있고, ADCC(antibody dependent cell mediated cytotoxicity) 부위가 제거될 수도 있다. 이러한 면역글로불린 Fc 영역의 서열 유도체를 제조하는 기술은 국제특허공개 제WO97/34631호, 국제특허공개 제WO96/32478호 등에 개시되어 있다.
분자의 활성을 전체적으로 변경시키지 않는 단백질 및 펩타이드에서의 아미노산 교환은 당해 분야에 공지되어 있다(H.Neurath, R.L.Hill, The Proteins, Academic Press, New York, 1979). 가장 통상적으로 일어나는 교환은 아미노산 잔기 Ala/Ser, Val/Ile, Asp/Glu, Thr/Ser, Ala/Gly, Ala/Thr, Ser/Asn, Ala/Val, Ser/Gly, Thy/Phe, Ala/Pro, Lys/Arg, Asp/Asn, Leu/Ile, Leu/Val, Ala/Glu, Asp/Gly 간의 교환이다.
한편, 면역글로불린 Fc 영역은 인간 또는 소, 염소, 돼지, 마우스, 래빗, 햄스터, 랫트, 기니아 픽 등의 동물기원일 수 있으며, 바람직하게는 인간기원이다. 또한, 면역글로불린 Fc 영역은 IgG, IgA, IgD, IgE, IgM 유래 또는 이들의 조합 (combination) 또는 이들의 혼성(hybrid)에 의한 Fc 영역일 수 있다. 그 예로 인간 혈액에 가장 풍부한 IgG 또는 IgM 유래일 수 있으며, 리간드 결합 단백질의 반감기를 향상시키는 것으로 공지된 IgG 유래일 수 있다.
한편, 본 발명에서 조합(combination)이란 이량체 또는 다량체를 형성할 때, 동일 기원 단쇄 면역글로불린 Fc 영역을 암호화하는 폴리펩타이드가 상이한 기원의 단쇄 폴리펩타이드와 결합을 형성하는 것을 의미한다. 즉, IgG Fc, IgA Fc, IgM Fc, IgD Fc 및 IgE의 Fc 단편으로 이루어진 그룹으로부터 선택된 2개 이상의 단편으로부터 이량체 또는 다량체의 제조가 가능하다.
본 발명에서 "하이브리드(hybrid)"란 단쇄의 면역글로불린 Fc 영역 내에 2개 이상의 상이한 기원의 면역글로불린 Fc 단편에 해당하는 서열이 존재함을 의미하는 용어이다. 본 발명의 경우 여러 형태의 하이브리드가 가능하다. 즉, IgG Fc, IgM Fc, IgA Fc, IgE Fc 및 IgD Fc의 CH1, CH2, CH3 및 CH4로 이루어진 그룹으로부터 1개 내지 4개 도메인으로 이루어진 도메인의 하이브리드가 가능하며, 힌지를 포함할 수 있다.
한편, IgG 역시 IgG1, IgG2, IgG3 및 IgG4의 서브클래스로 나눌 수 있고 본 발명에서는 이들의 조합 또는 이들의 혼성화도 가능하다. 그 예로, IgG2 및 IgG4 서브클래스이며, 구체적인 예로, 보체 의존적 독성(CDC, Complementdependent cytotoxicity)과 같은 이펙터 기능(effector function)이 거의 없는 IgG4의 Fc 영역일 수 있으나, 이에 제한되지 않는다.
구체적으로, 본 발명의 인슐린 및/또는 이의 아날로그 결합체의 한 모이어티 (moiety)인 면역글로불린 Fc 영역은, 인간 IgG1 유래의 Fc 영역일 수 있으나, 결합체의 한 모이어티로 이용될 수 있는 Fc 영역은 제한 없이 포함된다. 인간 유래의 Fc 영역은 인간 생체에서 항원으로 작용하여 이에 대한 새로운 항체를 생성하는 등의 바람직하지 않은 면역반응을 일으킬 수 있는 비-인간 유래의 Fc 영역에 비하여 바람직하다.
이러한 본 발명의 인슐린 또는 이의 아날로그 결합체는 에너지 대사 및 당 대사와 같은 기존의 인슐린의 생체 내 활성이 유지될 뿐만 아니라 인슐린 아날로그의 혈중 반감기 및 이로 인한 상기 펩타이드의 생체 내 효력 지속효과가 획기적으로 증가하게 하므로, 당뇨(Diabetes)의 치료에 유용할 수 있다.
본 발명은 하나의 구체예로서 하기 화학식 1을 갖는 결합체를 제공한다.
[화학식 1]
X-La-F1:Y-La-F2
여기에서
X는 인슐린의 A쇄 또는 인슐린 아날로그의 A쇄이고,
L은 링커이며,
a는 0 또는 자연수이며, 단 a가 2이상일 때 각각의 L은 서로 독립적이고,
:는 화학결합이며,
Y는 인슐린의 B쇄 또는 인슐린 아날로그의 B쇄이고,
F1과 F2는 면역글로불린 불변 영역을 포함하며 FcRn 결합부위를 갖는 것을 특징으로 한다.
상기 결합체의 화학결합 (:)은 구체적으로는 [X-La-F1] 및 [Y-La-F2]가 발현 후 접힘 과정에서 F1 및 F2, 즉 Fc 영역이 서로 이중결합되어 A쇄 결합체와 B쇄 결합체가 헤테로 다이머 형태를 이루는 것일 수 있다. 이에 상기 화학결합은 이황화 결합일 수 있으나, 이에 제한되지 않는다.
상기 F1과 F2는 천연형이 아닌 아미노산으로 치환된 면역글로불린 영역일 수 있으며, F2와 F1는 서로 다른 조합으로 치환된 아미노산이 될 수 있으나, 이에 제한되지 않는다.
다른 구체예로서, 상기 인슐린 아날로그의 B쇄는 인슐린 B쇄의 1번 아미노산, 2번 아미노산, 3번 아미노산, 5번 아미노산, 8번 아미노산, 10번 아미노산, 12번 아미노산, 16번 아미노산, 23번 아미노산, 24번 아미노산, 25번 아미노산, 26번 아미노산, 27번 아미노산, 28번 아미노산, 29번 아미노산, 및 30번 아미노산으로 이루어진 군에서 선택된 하나 또는 그 이상의 아미노산이 다른 아미노산으로 치환되거나 결실된 것일 수 있다. 그 예로, 인슐린 B쇄의 1번 아미노산, 2번 아미노산, 3번 아미노산, 5번 아미노산, 8번 아미노산, 10번 아미노산, 12번 아미노산, 16번 아미노산, 23번 아미노산, 24번 아미노산, 25번 아미노산, 26번 아미노산, 27번 아미노산, 28번 아미노산, 29번 아미노산, 및 30번 아미노산으로 이루어진 군에서 선택된 하나 또는 그 이상의 아미노산이 다른 아미노산으로 치환된 것일 수 있다.
또 다른 구체예로서, 상기 인슐린 아날로그의 A쇄는 인슐린 A쇄의 1번 아미노산, 2번 아미노산, 5번 아미노산, 8번 아미노산, 10번 아미노산, 12번 아미노산, 14번 아미노산, 16번 아미노산, 17번 아미노산, 18번 아미노산, 19번 아미노산 및 21번 아미노산으로 이루어진 군에서 선택된 하나 또는 그 이상의 아미노산이 다른 아미노산으로 치환되거나 결실된 것일 수 있다. 그 예로, 인슐린 A쇄의 1번 아미노산, 2번 아미노산, 5번 아미노산, 8번 아미노산, 10번 아미노산, 12번 아미노산, 14번 아미노산, 16번 아미노산, 17번 아미노산, 18번 아미노산, 19번 아미노산 및 21번 아미노산으로 이루어진 군에서 선택된 하나 또는 그 이상의 아미노산이 다른 아미노산으로 치환된 것일 수 있다.
다른 구체예로서, 상기 인슐린 아날로그는 B쇄의 8번 아미노산, 23번 아미노산, 24번 아미노산, 25번 아미노산, A쇄의 1번 아미노산, 2번 아미노산, 14번 아미노산 및 19번 아미노산으로 이루어진 군에서 선택된 하나 또는 그 이상의 아미노산이 다른 아미노산으로 치환된 것을 특징으로 한다.
다른 구체예로서, 상기 치환된 아미노산은 알라닌, 글루탐산, 아스파라긴, 이소루신, 발린, 글루타민,글라이신, 라이신, 히스티딘, 시스테인, 페닐알라닌, 트립토판, 프로린, 세린, 트레오닌 및 아스파틱산으로 이루어진 군에서 선택되는 것을 특징으로 한다.
다른 구체예로서, 상기 치환된 아미노산은 B 쇄의 8번 아미노산, 23번 아미노산, 24번 아미노산, 25번 아미노산, A 쇄의 1번 아미노산, 2번 아미노산 및 19번 아미노산으로 이루어진 군에서 선택된 하나의 아미노산이 알라닌으로 치환되거나, A 쇄의 14번 아미노산이 글루탐산 또는 아스파라긴으로 치환된 것일 수 있으나, 이에 제한되지 않는다.
다른 구체예로서, 상기 L은 펩타이드, 폴리에틸렌 글리콜, 지방산, 사카라이드(saccharide), 고분자 중합체, 저분자 화합물, 뉴클레오타이드 및 이들의 조합으로 이루어진 군으로부터 선택되는 것을 특징으로 한다.
다른 구체예로서, 상기 X와 F1, Y와 F2는 공유 화학 결합, 비공유 화학 결합 또는 이들의 조합으로 L에 의해 서로 결합되는 것을 특징으로 한다.
다른 구체예로서, 상기 F는 IgG Fc 영역인 것을 특징으로 한다.
본 발명의 또 하나의 양태는 상기 인슐린 또는 이의 아날로그를 코딩하는 폴리뉴클레오티드, 상기 폴리뉴클레오티드를 포함하는 발현 벡터 및 상기 발현 벡터를 포함하는 형질전환체이다.
상기 인슐린 및/또는 이의 아날로그에 대해서는 앞서 설명한 바와 같다.
상기 폴리뉴클레오티드는, 단일가닥 또는 이중가닥 형태로 존재하는 디옥시리보뉴클레오티드(DNA) 또는 리보뉴클레오티드(RNA)로, 게놈 DNA, cDNA 및 이로부터 전사되는 RNA를 포함하는 의미를 가지며, 기본 구성단위인 뉴클레오티드는 자연의 뉴클레오티드뿐만 아니라, 당 또는 염기 부위가 변형된 유사체(analogue)도 포함한다(Scheit, Nucleotide Analogs, John Wiley, New York, 1980; Uhlman 및 Peyman, Chemical Reviews, 90: 543-584, 1990). 본 발명의 폴리뉴클레오티드는 표준 분자생물학 기술을 이용하여 분리 또는 제조할 수 있다.
본 발명에 따른 재조합 벡터는 전형적으로 클로닝을 위한 벡터 또는 발현을 위한 벡터로서 구축될 수 있고, 원핵세포 또는 진핵세포를 숙주세포로 사용하기 위한 벡터로서 구축될 수 있다.
본 발명에서 용어, "벡터"란 적당한 숙주세포에서 목적 단백질을 발현할 수 있는 재조합 벡터로서, 핵산 삽입물이 발현되도록 작동 가능하게 연결된 필수적인 조절요소를 포함하는 핵산 구조물(construct)을 의미한다. 본 발명은 인슐린 또는 이의 아날로그를 코딩하는 핵산을 포함하는 재조합 벡터를 제조할 수 있는데, 상기 재조합 벡터를 숙주세포에 형질전환(transformation) 또는 형질감염(transfection) 시킴으로써, 본 발명의 인슐린 및/또는 이의 아날로그를 수득할 수 있다.
본 발명에서 인슐린 및/또는 이의 아날로그를 코딩하는 핵산은 프로모터에 작동 가능하게 연결된다. 본 발명에서 용어, "작동 가능하게 연결된(operatively linked)"은 핵산 발현 조절서열(예: 프로모터, 시그널 서열, 라이보좀 결합부위, 전사 종결서열 등)과 다른 핵산 서열사이의 기능적인 결합을 의미하며, 이에 의해 상기 조절서열은 상기 다른 핵산 서열의 전사 및/또는 해독을 조절하게 된다.
본 발명에서 용어, "프로모터"는 폴리머라제에 대한 결합 부위를 포함하고 프로모터 하위 유전자의 mRNA로의 전사 개시 활성을 가지는, 코딩 영역의 상위(upstream)의 비해독된 핵산 서열, 즉, 폴리머라제가 결합하여 유전자의 전사를 개시하도록 하는 DNA 영역을 말하며, mRNA 전사 개시부위의 5'-부위에 위치한다.
예를 들어, 본 발명의 벡터가 재조합 벡터이고 원핵세포를 숙주로 하는 경우에, 전사를 진행시킬 수 있는 강력한 프로모터(예: tac 프로모터, lac 프로모터, lacUV5 프로모터, lpp 프로모터, pLλ 프로모터, pRλ 프로모터, rac5 프로모터, amp 프로모터, recA 프로모터, SP6 프로모터, trp 프로모터 및 T7 프로모터 등), 해독의 개시를 위한 라이보좀 결합부위 및 전사/해독 종결서열을 포함하는 것이 일반적이다.
또한, 본 발명에 이용될 수 있는 벡터는 당업계에서 종종 사용되는 플라스미드(예: pSC101, pGV1106, pACYC177, ColE1, pKT230, pME290, pBR322, pUC8/9, pUC6, pBD9, pHC79, pIJ61, pLAFR1, pHV14, pGEX 시리즈, pET 시리즈, pPICZα 시리즈, pUC19 등), 파지(예: λgt4·λB, λ-Charon, λΔz1 및 M13 등) 또는 바이러스(예: SV40 등)를 조작하여 제작될 수 있으나, 이에 제한되지 않는다.
한편, 본 발명의 벡터가 재조합 벡터이고 진핵세포를 숙주로 하는 경우에, 포유동물 세포의 게놈으로부터 유래된 프로모터(예: 메탈로티오닌 프로모터) 또는 포유동물 바이러스로부터 유래된 프로모터(예: 아데노바이러스 후기 프로모터, 우두바이러스 7.5K 프로모터, SV40 프로모터, 사이토메갈로바이러스 프로모터 및 HSV의 tk 프로모터)가 이용될 수 있으며, 전사 종결 서열로서 폴리아데닐화 서열(예: 소성장 호르몬 터미네이터 및 SV40 유래 폴리 아데닐화 서열)을 일반적으로 갖는다.
또한, 본 발명의 재조합 벡터는 선택 마커로서 당업계에서 통상적으로 이용되는 항생제 내성 유전자를 포함하며, 예를 들어 암피실린, 겐타마이신, 카베니실린, 클로람페니콜, 스트렙토마이신, 카나마이신, 게네티신, 네오마이신 및 테트라사이클린에 대한 내성 유전자가 사용될 수 있다.
본 발명의 재조합 벡터는 회수되는 목적 단백질, 즉 인슐린 및/또는 이의 아날로그의 정제를 용이하게 하기 위하여 필요에 따라 다른 서열을 추가로 포함할 수 있다. 상기 추가로 포함될 수 있는 서열은 단백질 정제용 태그 서열일 수 있으며, 예컨대, 글루타티온 S-트랜스퍼라제(Pharmacia, USA), 말토스 결합 단백질(NEB, USA), FLAG(IBI, USA) 및 6개 히스티딘(hexahistidine) 등이 있으나, 상기 예들에 의하여 목적 단백질의 정제를 위하여 필요한 서열의 종류가 제한되는 것은 아니다.
상기와 같은 태그 서열을 포함하는 재조합 벡터에 의해 발현된 융합 단백질은 친화성 크로마토그래피에 의해 정제될 수 있다. 예컨대, 글루타티온-S-트랜스퍼라제가 융합된 경우에는 이 효소의 기질인 글루타티온을 이용할 수 있고, 6개 히스티딘 태그가 이용된 경우에는 Ni-NTA 칼럼을 이용하여 원하는 목적 단백질을 용이하게 회수할 수 있다.
상기 인슐린 및/또는 이의 아날로그를 코딩하는 폴리뉴클레오티드를 포함하는 재조합 벡터를 이용하여, 상기 벡터가 형질전환된 형질전환체가 구축될 수 있다.
본 발명에서 용어, "형질전환(transformation)"이란 DNA를 숙주세포 내로 도입하여 DNA가 염색체의 인자로서 또는 염색체 통합 완성에 의해 복제 가능하게 되는 것으로, 외부의 DNA를 세포 내로 도입하여 인위적으로 유전적인 변화를 일으키는 현상을 의미한다.
본 발명의 형질전환 방법은 임의의 형질전환 방법이 사용될 수 있으며, 당업계의 통상적인 방법에 따라 용이하게 수행할 수 있다. 일반적으로 형질전환 방법에는 CaCl2 침전법, CaCl2 침전법에 DMSO(dimethyl sulfoxide)라는 환원물질을 사용함으로써 효율을 높인 Hanahan 방법, 전기천공법(electroporation), 인산칼슘 침전법, 원형질 융합법, 실리콘 카바이드 섬유를 이용한 교반법, 아그로박테리아 매개 형질전환법, PEG를 이용한 형질전환법, 덱스트란 설페이트, 리포펙타민 및 건조/억제 매개된 형질전환법 등이 있다.
본 발명에 따른 인슐린 및/또는 이의 아날로그를 코딩하는 핵산을 포함하는 재조합 벡터를 형질전환시키기 위한 방법은 상기 예들에 국한되지 않으며, 당업계에서 통상적으로 사용되는 형질전환 또는 형질감염 방법이 제한 없이 사용될 수 있다.
목적 핵산인 인슐린 및/또는 이의 아날로그를 코딩하는 핵산을 포함하는 재조합 벡터를 숙주세포 내로 도입함으로써 본 발명의 형질전환체(transformant)를 획득할 수 있다.
본 발명에 적합한 숙주는 본 발명의 핵산을 발현하도록 하는 한 특별히 제한되지 않는다. 본 발명에 사용될 수 있는 숙주의 특정한 예로는 대장균(E. coli)과 같은 에스케리키아(Escherichia) 속 세균; 바실러스 서브틸리스(Bacillus subtilis)와 같은 바실러스(Bacillus) 속 세균; 슈도모나스 푸티다(Pseudomonas putida)와 같은 슈도모나스(Pseudomonas) 속 세균; 피키아 파스토리스(Pichia pastoris), 사카로마이세스 세레비지애(Saccharomyces cerevisiae), 스키조사카로마이세스 폼베(Schizosaccharomyces pombe)와 같은 효모; 스포도프테라 프루기페르다(SF9)와 같은 곤충세포; 및 CHO, COS, BSC 등과 같은 동물세포가 있으나, 이에 제한되지 않는다.
본 발명은 또 하나의 구체예로서, 본 발명의 상기 인슐린 및/또는 이의 아날로그 결합체를 포함하는 당뇨병 치료용 약학적 조성물을 제공한다.
상기 조성물은 하기의 특징 중 어느 하나의 특징을 갖는다: (i) 인슐린에 비해 혈당 강화 효과 개선; (ii) 인슐린에 비해 혈중 지속성 증가: (iii) 생체 내 활성 유지; 및 (iv) 인슐린에 비해 부작용인 저혈당 효과 감소.
이하, 실시예를 통하여 본 발명을 더욱 상세하게 설명하기로 한다. 이들 실시예는 단지 본 발명을 예시하기 위한 것으로, 본 발명의 범위가 이들 실시예에 의해 제한되는 것으로 해석되지는 않는다.
실시예 1: 천연형 인슐린의 A쇄 및 B쇄 연결체 유전자 합성
천연형 인슐린의 A쇄 및 B쇄 각각에 면역글로불린 Fc 영역을 유전자 수준에서 융합하여 발현 벡터에 각각 삽입하였다.
구체적으로, 하기와 같은 천연형 인슐린의 A쇄와 B쇄가 각각 포함된 연결체들을 합성하였다 (표 1). A쇄에 결합하는 면역글로불린 Fc 영역은 구체적으로 CH3 영역의 24번 아미노산인 세린(Ser)을 히스티딘(His)으로, 75번 아미노산인 페닐알라닌(Phe)을 알라닌(Ala)으로 치환된 면역글로불린 Fc 영역을 사용하였으며, B쇄에 결합하는 면역글로불린 Fc 영역은 구체적으로 CH3 영역의 9번 아미노산인 티로신(Tyr)을 트레오닌(Thr)으로, 54번 아미노산인 트레오닌(Thr)을 페닐알라닌(Phe)으로 치횐된 면역글로불린 영역을 사용하여 합성하였다.
서열 서열번호
A쇄-IgG1 Fc(S171H/F212A) DNA(서열번호 3) A쇄 atgggcattgtggaacagtgctgtaccagcatttgtagtctatatcaacttgaaaattattgtaat 8
IgG1힌지 gagcccaaatcatgcgataaaacccacacctgtcccccatgcccg 9
IgG1CH2 gctccggaactcttaggtggccctagcgtatttctgttcccgccgaagccgaaggatacgctgatgatctcacggaccccagaagttacttgcgtggtggtggacgtatcacatgaagatcccgaggtcaaatttaattggtacgttgatggggttgaagtacataatgcaaaaacaaagccgcgtgaggagcagtataattcaacttatcgtgtggtcagcgtgctgacagttctgcaccaggattggctcaacgggaaagaatataagtgtaaagtttccaacaaagccctgccagctcctatagagaaaactatctcgaaagccaaa 10
IgG1CH3 ggacagccacgtgaacctcaggtttacacgctgccaccgtcccgcgatgaattaacaaaaaatcaggtgcatttgacgtgtctggttaagggtttctatccgagcgacattgcggtagaatgggaatctaatggacaacctgagaataactacaaaactacaccgccggttttagatagcgatggttcctttgcgctttatagcaaactgacggtggacaaaagtcgttggcagcaaggcaacgtctttagttgcagcgtcatgcatgaagcacttcacaaccattacacccagaaatctctgagcctgtcgcctggtaagtag 11
단백질(서열번호 4) A쇄 MGIVEQCCTSICSLYQLENYCN 12
IgG1힌지 EPKSCDKTHTCPPCP 13
IgG1CH2 APELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAK 14
IgG1CH3 GQPREPQVYTLPPSRDELTKNQVHLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFALYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK 15
B쇄-IgG1 Fc(Y165T/T209F) DNA(서열번호 5) B쇄 atgtttgtaaatcaacatctgtgtgggagtcaccttgtggaagcattatatttagtctgcggtgaacgtggattcttctacactcctaaaact 16
IgG1힌지 gaaccgaagtcatgcgataagacccatacgtgtccgccctgtccc 17
IgG1CH2 gccccggaactgcttggcggccctagtgtttttctgtttcctccgaaaccaaaagatacgttgatgattagcagaacgccggaagttacctgtgtagtcgttgacgtatcccacgaagatccggaggtgaaattcaattggtatgttgatggtgtggaggtgcataatgccaaaacgaaacctcgtgaagagcagtataactctacctaccgcgtcgtaagcgtgctgacagttctccatcaggactggctgaatggtaaagagtataaatgcaaagttagtaacaaggctctgcctgctcccatagaaaaaaccatctctaaagcgaag 18
IgG1CH3 ggtcagccgcgggagccacaagttacaaccctgccaccgtctcgcgacgaattaaccaagaatcaggtgtccctgacatgcctagtcaagggcttttatcccagtgatattgcggtggaatgggaatcgaatggacaaccagaaaacaactacaaaactttcccgccagtcctggactcagatggcagcttttttctgtattctaaactcacagtggataaatcgcgttggcagcaggggaacgtgtttagctgtagcgtgatgcatgaggcactgcacaatcattatactcagaaatccctttcattaagccctggaaaatag 19
단백질(서열번호 6) B 쇄 MFVNQHLCGSHLVEALYLVCGERGFFYTPKT 20
IgG1힌지 EPKSCDKTHTCPPCP 21
IgG1CH2 APELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAK 22
IgG1CH3 GQPREPQVTTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTFPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK 23
실시예 2: 폴리시스트로닉 발현되는 천연형 인슐린 연결체의 제조
상기 실시예 1 에서 합성 후 발현벡터에 각각 삽입된 A 쇄-IgG1 Fc 연결체와 B쇄-IgG1 Fc 연결체를 하나의 벡터에서 발현시키기 위해서 제한효소를 이용하여 A쇄-IgG1 Fc 연결체가 있는 벡터에 B-쇄 -IgG1 Fc 연결체 DNA 단편을 삽입하였다. 폴리시스트로닉 발현 시스템을 구축하기 위하여, 발현벡터인 pET22b 벡터에 상기 두 개의 연결체 유전자가 삽입되도록 발현 벡터를 구축하였다. A 쇄-IgG1 Fc가 삽입된 벡터에 A쇄-IgG1 Fc 연결합체를 자르지 않고 다중 클론 자리(Multi cloning site)에 존재하는 SalI과 XhoI 제한효소 절단 부위를 자른 뒤, B 쇄-IgG1 Fc 연결체 DNA 단편을 삽입하였다. 이때 폴리시스트로닉 발현을 위해 B 쇄-IgG1 Fc 앞에 리보솜 결합부위를 함께 삽입하여 하나의 프로모터에서 두개의 리보솜 결합부위가 포함된 전령 RNA가 형성되고 두 개의 리보솜 결합부위를 통하여 A쇄-IgG1 Fc 연결체와 B-쇄-IgG Fc 연결체가 각각 발현되도록 하였다.
서열 서열번호
리보솜 결합부위 포함한 서열 aataattttgtttaactttaagaaggagaTatacaA 7
상기 폴리시스트로닉 발현 벡터를 숙주세포에서 발현시키면 하나의 벡터에서 하나의 긴 mRNA가 형성되고 두개의 리보솜결합부위를 통하여 두개의 단백질인 인슐린의 A쇄-IgG1 Fc 연결체 및 B쇄-IgG1 Fc 연결체가 각각 발현되게 된다. 이때 발현되는 연결체들은 서로 이중결합을 하게 되는데 IgG1 CH3에 변이된 부분끼리 서로 결합하게끔 하여 A-쇄-IgG1 Fc 연결체와 B-쇄-IgG1 Fc 연결체가 헤테로이량체를 형성하는 인슐린 결합체를 제조할 수 있다. 이와 같은 인슐린 결합체는 발현 시 재접힘 과정 후, 기존 인슐린 결합체 등의 C 펩타이드의 제거 단계가 필요 없어서, 수율을 높일 수 있을 것이다.
이와 같은 본 발명의 인슐린 및/또는 이의 아날로그 결합체는 생체 내에서 안정적인 혈당 강하 효과를 유지하고, 혈중 반감기가 현저히 증가하는 혈중 지속성 향상으로, 인슐린 제제의 투여 편의성 및 부작용을 감소시킬 수 있는 인슐린 제제의 유효성분으로 사용될 수 있을 것이다.
이상의 설명으로부터, 본 발명이 속하는 기술분야의 당업자는 본 발명이 그 기술적 사상이나 필수적 특징을 변경하지 않고서 다른 구체적인 형태로 실시될 수 있다는 것을 이해할 수 있을 것이다. 이와 관련하여, 이상에서 기술한 실시 예들은 모든 면에서 예시적인 것이며 한정적인 것이 아닌 것으로서 이해해야만 한다. 본 발명의 범위는 상기 상세한 설명보다는 후술하는 특허 청구범위의 의미 및 범위 그리고 그 등가 개념으로부터 도출되는 모든 변경 또는 변형된 형태가 본 발명의 범위에 포함되는 것으로 해석되어야 한다.

Claims (11)

  1. 하기 화학식 1을 갖는 지속형 결합체:
    [화학식 1]
    X-La-F1:Y-La-F2
    여기에서,
    X는 야생형 인슐린 A쇄 또는 그 아날로그이고,
    L은 링커이며,
    a는 0 또는 자연수이며, 단 a가 2이상일 때 각각의 L은 서로 독립적이고,
    :는 화학결합이며,
    Y는 야생형 인슐린 B쇄 또는 그 아날로그이고,
    F1과 F2는 면역글로불린 불변 영역을 포함하며 FcRn 결합부위를 가짐.
  2. 제1항에 있어서, F1과 F2의 면역글로불린 불변 영역은 면역글로불린 CH1, CH2, CH3 및 CH4 도메인으로 이루어진 군으로부터 1개 내지 4개 선택되는 도메인으로 이루어진 결합체.
  3. 제2항에 있어서, 면역글로불린 불변 영역은 힌지 영역을 추가로 포함하는 결합체.
  4. 제2항에 있어서, 면역글로불린 불변영역은 IgG임을 특징으로 하는 결합체.
  5. 제1항에 있어서, F1은 IgG1의 힌지 영역, CH2 및 CH3 영역을 포함하고, CH3 영역의 24번 아미노산인 세린(Ser)을 히스티딘(His)으로, 75번 아미노산인 페닐알라닌(Phe)을 알라닌(Ala)으로 치환된 것을 특징으로 하고 있으며, F2는 IgG1의 힌지 영역, CH2 및 CH3 영역을 포함하고, CH3 영역의 9번 아미노산인 티로신(Tyr)을 트레오닌(Thr)으로, 54번 아미노산인 트레오닌(Thr)을 페닐알라닌(Phe)으로 치환된 것을 특징으로 하는 결합체.
  6. 제1항에 있어서, F1과 F2는 천연형이 아닌 아미노산으로 치환된 면역글로불린 영역이며, F2와 F1는 서로 다른 조합으로 치환된 아미노산이 될 수 있음을 특징으로 하는 결합체.
  7. 제1항에서 있어서, L인 링커는 펩타이드 또는 폴리에틸렌 글리콜(polyethylene glycol)을 포함하는 것을 특징으로 하는 결합체.
  8. 제1항에 있어서, F1과 F2의 화학결합은 이황화결합(disulfide bond)임을 특징으로 하는 결합체.
  9. 제1항에 있어서, 인슐린 아날로그의 B쇄는 인슐린 B쇄의 8번 아미노산, 10번 아미노산, 12번 아미노산, 16번 아미노산, 23번 아미노산, 24번 아미노산, 25번 아미노산, 26번 아미노산, 27번 아미노산, 28번 아미노산, 29번 아미노산, 30번 아미노산으로 이루어진 군에서 선택된 하나 또는 그 이상의 아미노산이 다른 아미노산으로 치환된 것을 특징으로 하는 결합체.
  10. 제1항에 있어서, 인슐린 아날로그의 A쇄는 인슐린 A쇄의 1번 아미노산, 2번 아미노산, 5번 아미노산, 14번 아미노산, 19번 아미노산 및 21번 아미노산으로 이루어진 군에서 선택된 하나 또는 그 이상의 아미노산이 다른 아미노산으로 치환된 것을 특징으로 하는 결합체.
  11. 제1항 내지 제10항 중 어느 한 항의 결합체를 포함하는, 당뇨병의 예방 또는 치료용 약학적 조성물.
PCT/KR2016/001628 2015-02-17 2016-02-17 지속형 인슐린 또는 이의 아날로그 결합체 WO2016133372A2 (ko)

Priority Applications (4)

Application Number Priority Date Filing Date Title
JP2017543742A JP2018508504A (ja) 2015-02-17 2016-02-17 持続型インスリンまたはインスリンアナログ結合体
US15/551,489 US10894089B2 (en) 2015-02-17 2016-02-17 Long-acting insulin or insulin analogue conjugate
CN201680022070.4A CN107810202A (zh) 2015-02-17 2016-02-17 长效胰岛素或胰岛素类似物复合物
EP16752702.7A EP3260139A4 (en) 2015-02-17 2016-02-17 Long-acting insulin or insulin analogue complex

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
KR10-2015-0024091 2015-02-17
KR20150024091 2015-02-17

Publications (2)

Publication Number Publication Date
WO2016133372A2 true WO2016133372A2 (ko) 2016-08-25
WO2016133372A3 WO2016133372A3 (ko) 2016-10-13

Family

ID=56692355

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2016/001628 WO2016133372A2 (ko) 2015-02-17 2016-02-17 지속형 인슐린 또는 이의 아날로그 결합체

Country Status (6)

Country Link
US (1) US10894089B2 (ko)
EP (1) EP3260139A4 (ko)
JP (1) JP2018508504A (ko)
KR (1) KR20160101702A (ko)
CN (1) CN107810202A (ko)
WO (1) WO2016133372A2 (ko)

Cited By (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US9855318B2 (en) 2015-05-07 2018-01-02 Eli Lilly And Company Fusion proteins
WO2018185131A3 (en) * 2017-04-05 2018-11-15 Novo Nordisk A/S Oligomer extended insulin-fc conjugates
US11208452B2 (en) 2015-06-02 2021-12-28 Novo Nordisk A/S Insulins with polar recombinant extensions
US11292825B2 (en) 2015-10-01 2022-04-05 Novo Nordisk A/S Protein conjugates

Families Citing this family (17)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
GB201607918D0 (en) 2016-05-06 2016-06-22 Arecor Ltd Novel formulations
AU2017371217B2 (en) 2016-12-09 2020-03-19 Akston Biosciences Corporation Insulin-Fc fusions and methods of use
KR20190036956A (ko) * 2017-09-28 2019-04-05 한미약품 주식회사 지속형 단쇄 인슐린 아날로그 및 이의 결합체
US20210046189A1 (en) * 2018-03-30 2021-02-18 HANMl PHARM. CO., LTD. Long-acting protein conjugates for brain targeting, a preparation method thereof, and a composition comprising the same
US11267862B2 (en) 2018-06-29 2022-03-08 Akston Biosciences Corporation Ultra-long acting insulin-Fc fusion proteins and methods of use
LT4186920T (lt) 2018-06-29 2024-04-25 Akston Biosciences Corporation Itin ilgai veikiantys insulino-fc sulieti baltymai ir naudojimo būdai
KR102646845B1 (ko) * 2018-08-08 2024-03-14 주식회사 대웅제약 클로스트리파인을 이용한 지속형 인슐린 아날로그 복합체의 활성형 제조방법
KR102666154B1 (ko) * 2018-08-08 2024-05-20 주식회사 대웅제약 지속형 인슐린 아날로그 및 그 복합체
CN112839681A (zh) * 2018-10-10 2021-05-25 诺和诺德股份有限公司 寡聚体延伸的胰岛素-Fc缀合物及其医学用途
IL294051A (en) 2019-12-19 2022-08-01 Akston Biosciences Corp Long-acting insulin-fc fusion proteins, and methods of use
US11186623B2 (en) 2019-12-24 2021-11-30 Akston Bioscience Corporation Ultra-long acting insulin-Fc fusion proteins and methods of use
US11192930B2 (en) 2020-04-10 2021-12-07 Askton Bioscences Corporation Ultra-long acting insulin-Fc fusion protein and methods of use
HRP20230990T1 (hr) 2020-04-10 2023-12-08 Akston Biosciences Corporation Antigen specifična imunoterapija za fuzijske proteine covid-19 i postupci uporabe
US11198719B2 (en) 2020-04-29 2021-12-14 Akston Biosciences Corporation Ultra-long acting insulin-Fc fusion protein and methods of use
KR20220073454A (ko) * 2020-11-26 2022-06-03 한미약품 주식회사 신규한 뇌 표적 지속형 단백질 결합체 및 이의 제조방법
WO2023004406A2 (en) 2021-07-23 2023-01-26 Akston Biosciences Corporation Insulin-fc fusion proteins and methods of use to treat cancer
CN115894720B (zh) * 2023-01-16 2024-07-09 中国科学院上海药物研究所 一种长效胰岛素-Fc融合蛋白

Family Cites Families (13)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6096871A (en) 1995-04-14 2000-08-01 Genentech, Inc. Polypeptides altered to contain an epitope from the Fc region of an IgG molecule for increased half-life
CA2249195A1 (en) 1996-03-18 1997-09-25 Board Of Regents, The University Of Texas System Immunoglobin-like domains with increased half lives
CN1330664C (zh) * 2001-03-07 2007-08-08 默克专利有限公司 用于含杂合同种型抗体部分的蛋白质的表达技术
JP2008504012A (ja) * 2004-01-28 2008-02-14 シントニックス・ファーマシューティカルズ・インコーポレーテッド 不妊治療のためのへテロ二量体卵胞刺激ホルモン−Ｆｃ（ＦＳＨ−Ｆｃ）融合タンパク質
WO2009015345A1 (en) 2007-07-25 2009-01-29 Amgen Inc. Pharmaceutical compositions comprising fc fusion proteins
US8569231B2 (en) 2009-03-20 2013-10-29 Smartcells, Inc. Soluble non-depot insulin conjugates and uses thereof
AR081066A1 (es) * 2010-04-02 2012-06-06 Hanmi Holdings Co Ltd Conjugado de insulina donde se usa un fragmento de inmunoglobulina
JP6392123B2 (ja) 2011-12-20 2018-09-19 インディアナ ユニバーシティー リサーチ アンド テクノロジー コーポレーションＩｎｄｉａｎａ Ｕｎｉｖｅｒｓｉｔｙ Ｒｅｓｅａｒｃｈ Ａｎｄ Ｔｅｃｈｎｏｌｏｇｙ Ｃｏｒｐｏｒａｔｉｏｎ 糖尿病治療のためのｃｔｐ系インスリンアナローグ
CN103509118B (zh) * 2012-06-15 2016-03-23 郭怀祖 胰岛素-Fc融合蛋白
AR091902A1 (es) * 2012-07-25 2015-03-11 Hanmi Pharm Ind Co Ltd Formulacion liquida de un conjugado de insulina de accion prolongada
PT2963055T (pt) * 2013-02-26 2019-07-25 Hanmi Pharm Ind Co Ltd Conugado de insulina específico ao local
PE20191481A1 (es) * 2013-02-26 2019-10-18 Hanmi Pharm Ind Co Ltd Analogo de insulina novedoso y su uso
AR096891A1 (es) 2013-07-12 2016-02-03 Hanmi Pharm Ind Co Ltd Conjugado de monómero polipéptido biológicamente activo y conjugado de fragmento fc de inmunoglobulina, que muestra aclaramiento mediado por receptor reducido, y el método para la preparación del mismo

Cited By (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US9855318B2 (en) 2015-05-07 2018-01-02 Eli Lilly And Company Fusion proteins
US10709766B2 (en) 2015-05-07 2020-07-14 Eli Lilly And Company Fusion proteins
US11253574B2 (en) 2015-05-07 2022-02-22 Eli Lilly And Company Fusion proteins and methods of use
US11208452B2 (en) 2015-06-02 2021-12-28 Novo Nordisk A/S Insulins with polar recombinant extensions
US11292825B2 (en) 2015-10-01 2022-04-05 Novo Nordisk A/S Protein conjugates
WO2018185131A3 (en) * 2017-04-05 2018-11-15 Novo Nordisk A/S Oligomer extended insulin-fc conjugates
CN110505885A (zh) * 2017-04-05 2019-11-26 诺和诺德股份有限公司 寡聚体延伸的胰岛素-Fc缀合物
JP2020513019A (ja) * 2017-04-05 2020-04-30 ノヴォ ノルディスク アー／エス オリゴマー伸長インスリン−Ｆｃコンジュゲート
US11471537B2 (en) 2017-04-05 2022-10-18 Novo Nordisk A/S Oligomer extended insulin-Fc conjugates

Also Published As

Publication number Publication date
EP3260139A2 (en) 2017-12-27
US20180161448A1 (en) 2018-06-14
CN107810202A (zh) 2018-03-16
WO2016133372A3 (ko) 2016-10-13
JP2018508504A (ja) 2018-03-29
US10894089B2 (en) 2021-01-19
EP3260139A4 (en) 2018-09-05
KR20160101702A (ko) 2016-08-25

Similar Documents

Publication Publication Date Title
WO2016133372A2 (ko) 지속형 인슐린 또는 이의 아날로그 결합체
AU2015268199B2 (en) Composition for treating diabetes mellitus comprising insulin and a GLP-1/glucagon dual agonist
TWI755579B (zh) 新穎胰島素類似物及其用途
TWI784914B (zh) 包含長效胰島素類似物接合物及長效促胰島素肽接合物之治療糖尿病組成物
KR102406654B1 (ko) 지속형 인슐린 및 그 용도
KR101324828B1 (ko) 면역글로불린 단편을 이용한 단쇄 인슐린 아날로그 약물 결합체
JP7475276B2 (ja) Ｆｇｆ２１バリアント、融合タンパク質及びそれらの適用
JP7174149B2 (ja) ＧＬＰ１－Ｆｃ融合タンパク質及びその複合体
SK284534B6 (sk) Polypeptidový analóg natívneho keratinocytového rastového faktora, spôsob jeho výroby a použitie, farmaceutický prostriedok a kit, nukleová kyselina, vektor a hostiteľská bunka
WO2014133327A1 (ko) 인슐린 위치 특이적 결합체
WO2016006963A1 (en) Insulin analogue
WO2015199511A1 (en) Novel long-acting insulin analogue and use thereof
US20080045450A1 (en) GLP-2 Derivatives

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 16752702

Country of ref document: EP

Kind code of ref document: A2

WWE Wipo information: entry into national phase

Ref document number: 15551489

Country of ref document: US

ENP Entry into the national phase

Ref document number: 2017543742

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

REEP Request for entry into the european phase

Ref document number: 2016752702

Country of ref document: EP

121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 16752702

Country of ref document: EP

Kind code of ref document: A2