WO2016073685A1 - Humanized anti-complement factor c1q antibodies and uses thereof - Google Patents

Humanized anti-complement factor c1q antibodies and uses thereof Download PDF

Info

Publication number
WO2016073685A1
WO2016073685A1 PCT/US2015/059185 US2015059185W WO2016073685A1 WO 2016073685 A1 WO2016073685 A1 WO 2016073685A1 US 2015059185 W US2015059185 W US 2015059185W WO 2016073685 A1 WO2016073685 A1 WO 2016073685A1
Authority
WO
WIPO (PCT)
Prior art keywords
antibody
amino acid
acid sequence
seq
clq
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2015/059185
Other languages
English (en)
French (fr)
Inventor
Arnon Rosenthal
Michael Leviten
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Annexon Inc
Original Assignee
Annexon Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to KR1020177015260A priority Critical patent/KR102626877B1/ko
Priority to EP23197405.6A priority patent/EP4295911A3/en
Priority to RS20250249A priority patent/RS66604B1/sr
Priority to AU2015343029A priority patent/AU2015343029B2/en
Priority to SM20250118T priority patent/SMT202500118T1/it
Priority to SI201532057T priority patent/SI3215527T1/sl
Priority to HRP20250246TT priority patent/HRP20250246T1/hr
Priority to BR112017009297-2A priority patent/BR112017009297B1/pt
Priority to CA2966894A priority patent/CA2966894C/en
Priority to LTEPPCT/US2015/059185T priority patent/LT3215527T/lt
Priority to HK18103938.9A priority patent/HK1244494B/xx
Priority to SG11201703667SA priority patent/SG11201703667SA/en
Priority to PL15857258.6T priority patent/PL3215527T3/pl
Priority to FIEP15857258.6T priority patent/FI3215527T3/fi
Priority to NZ732156A priority patent/NZ732156B2/en
Priority to CN201580072390.6A priority patent/CN107207587B/zh
Priority to JP2017543310A priority patent/JP6951246B2/ja
Priority to ES15857258T priority patent/ES3013108T3/es
Priority to EP15857258.6A priority patent/EP3215527B1/en
Application filed by Annexon Inc filed Critical Annexon Inc
Priority to DK15857258.6T priority patent/DK3215527T3/da
Publication of WO2016073685A1 publication Critical patent/WO2016073685A1/en
Priority to IL252026A priority patent/IL252026B/en
Anticipated expiration legal-status Critical
Priority to JP2021155093A priority patent/JP7275223B2/ja
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K49/00Preparations for testing in vivo
    • A61K49/0002General or multifunctional contrast agents, e.g. chelated agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/04Drugs for disorders of the alimentary tract or the digestive system for ulcers, gastritis or reflux esophagitis, e.g. antacids, inhibitors of acid secretion, mucosal protectants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P11/00Drugs for disorders of the respiratory system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P11/00Drugs for disorders of the respiratory system
    • A61P11/06Antiasthmatics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P13/00Drugs for disorders of the urinary system
    • A61P13/12Drugs for disorders of the urinary system of the kidneys
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00Drugs for dermatological disorders
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00Drugs for skeletal disorders
    • A61P19/02Drugs for skeletal disorders for joint disorders, e.g. arthritis, arthrosis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P21/00Drugs for disorders of the muscular or neuromuscular system
    • A61P21/02Muscle relaxants, e.g. for tetanus or cramps
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P21/00Drugs for disorders of the muscular or neuromuscular system
    • A61P21/04Drugs for disorders of the muscular or neuromuscular system for myasthenia gravis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/14Drugs for disorders of the nervous system for treating abnormal movements, e.g. chorea, dyskinesia
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/14Drugs for disorders of the nervous system for treating abnormal movements, e.g. chorea, dyskinesia
    • A61P25/16Anti-Parkinson drugs
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/28Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P27/00Drugs for disorders of the senses
    • A61P27/02Ophthalmic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P27/00Drugs for disorders of the senses
    • A61P27/02Ophthalmic agents
    • A61P27/04Artificial tears; Irrigation solutions
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P27/00Drugs for disorders of the senses
    • A61P27/02Ophthalmic agents
    • A61P27/06Antiglaucoma agents or miotics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P29/00Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/04Anorexiants; Antiobesity agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/08Drugs for disorders of the metabolism for glucose homeostasis
    • A61P3/10Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • A61P37/06Immunosuppressants, e.g. drugs for graft rejection
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P7/00Drugs for disorders of the blood or the extracellular fluid
    • A61P7/06Antianaemics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • A61P9/10Drugs for disorders of the cardiovascular system for treating ischaemic or atherosclerotic diseases, e.g. antianginal drugs, coronary vasodilators, drugs for myocardial infarction, retinopathy, cerebrovascula insufficiency, renal arteriosclerosis
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/564Immunoassay; Biospecific binding assay; Materials therefor for pre-existing immune complex or autoimmune disease, i.e. systemic lupus erythematosus, rheumatoid arthritis, multiple sclerosis, rheumatoid factors or complement components C1-C9
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/68Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
    • G01N33/6893Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids related to diseases not provided for elsewhere
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/68Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
    • G01N33/6893Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids related to diseases not provided for elsewhere
    • G01N33/6896Neurological disorders, e.g. Alzheimer's disease
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/31Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/34Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52Constant or Fc region; Isotype
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/55Fab or Fab'
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/94Stability, e.g. half-life, pH, temperature or enzyme-resistance
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2333/00Assays involving biological materials from specific organisms or of a specific nature
    • G01N2333/435Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
    • G01N2333/46Assays involving biological materials from specific organisms or of a specific nature from animals; from humans from vertebrates
    • G01N2333/47Assays involving proteins of known structure or function as defined in the subgroups
    • G01N2333/4701Details
    • G01N2333/4716Complement proteins, e.g. anaphylatoxin, C3a, C5a

Definitions

  • the present disclosure relates to anti-Clq antibodies and methods of using the same.
  • Eculizumab Only the C5 neutralizing antibody Eculizumab, an inhibitor of the terminal complement activation pathway, has obtained regulatory approval to date; Eculizumab is marketed for the treatment of paroxysmal nocturnal hemoglobinuria (PNH; Hillmen et al., N Engl J Med. 2006, 355(12):1233-43).
  • humanized anti-Clq antibodies Provided herein are humanized anti-Clq antibodies and methods of using humanized anti-Clq antibodies.
  • the present disclosure provides a humanized antibody that specifically binds to a Clq protein, wherein the antibody comprises a heavy chain variable region and a human heavy chain constant region, wherein the heavy chain variable region comprises an Fab region and the heavy chain constant region comprises an Fc region, wherein the Fab region specifically binds to the Clq protein, and wherein the Fc region is incapable of binding the Clq protein.
  • the Fc region is incapable of inducing complement activity. In some embodiments that may be combined with any of the preceding embodiments, the Fc region is incapable of inducing antibody-dependent cellular cytotoxicity (ADCC).
  • the human heavy chain constant region is a human IgG4 heavy chain constant region. In some embodiments that may be combined with any of the preceding embodiments, the human IgG4 heavy chain constant region comprises the amino acid sequence of SEQ ID NO: 37, or an amino acid sequence with at least about 90% homology to the amino acid sequence of SEQ ID NO: 37.
  • the human IgG4 heavy chain constant region comprises an Fc region, and wherein the Fc region comprises one or more modifications.
  • the Fc region comprises one or more amino acid substitutions.
  • the Fc region comprises an amino acid substitution at position 248 according to Kabat numbering convention.
  • the Fc region comprises a leucine to glutamate amino acid substitution at position 248 according to Kabat numbering convention.
  • the amino acid substitution at position 248 according to Kabat numbering convention inhibits the Fc region from interacting with an Fc receptor.
  • the Fc region comprises an amino acid substitution at position 241 according to Kabat numbering convention.
  • the Fc region comprises a serine to proline amino acid substitution at position 241 according to Kabat numbering convention.
  • the amino acid substitution at position 241 according to Kabat numbering convention prevents arm switching in the antibody.
  • the antibody comprises, the Fc region comprises the amino acid sequence of SEQ ID NO: 37, or an amino acid sequence with at least about 70%, at least about 75%, at least about 80% at least about 85% at least about 90%, or at least about 90% homology to the amino acid sequence of SEQ ID NO: 37.
  • the antibody comprises a heavy chain variable domain and a light chain variable domain, wherein the heavy chain variable domain comprises an amino acid sequence selected from SEQ ID NOs: 1-4, or an amino acid sequence with at least about 90%> homology to the amino acid sequence selected from SEQ ID NOs: 1-4.
  • the light chain variable domain comprises an amino acid sequence selected from SEQ ID NOs: 5-8, or an amino acid sequence with at least about 90% homology to the amino acid sequence selected from SEQ ID NOs: 5-8.
  • the present disclosure provides a humanized anti-Clq antibody, or an antigen-binding fragment thereof, the antibody comprising a heavy chain variable domain and a light chain variable domain, wherein the heavy chain variable domain comprises an amino acid sequence selected from SEQ ID NOs: 1-4, or an amino acid sequence with at least about 90% homology to the amino acid sequence selected from SEQ ID NOs: 1-4.
  • the present disclosure provides a humanized anti-Clq antibody, or an antigen-binding fragment thereof, the antibody comprising a heavy chain variable domain and a light chain variable domain, wherein the light chain variable domain comprises an amino acid sequence selected from SEQ ID NOs: 5-8, or an amino acid sequence with at least about 90%> homology to the amino acid sequence selected from SEQ ID NOs: 5-8.
  • the present disclosure provides a humanized anti-Clq antibody, or an antigen-binding fragment thereof, the antibody comprising: a) a heavy chain variable domain comprising an amino acid sequence selected from SEQ ID NOs: 1-4, or an amino acid sequence with at least about 90%> homology to the amino acid sequence selected from SEQ ID NOs: 1-4; and/or b) a light chain variable domain comprising an amino acid sequence selected from SEQ ID NOs: 5-8, or an amino acid sequence with at least about 90%) homology to the amino acid sequence selected from SEQ ID NOs: 5-8.
  • the present disclosure provides a humanized anti-Clq antibody, or an antigen-binding fragment thereof, the antibody comprising: a) a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 1, or an amino acid sequence with at least about 90%> homology to the amino acid sequence of SEQ ID NO: 1; and b) a light chain variable domain comprising an amino acid sequence selected from SEQ ID NOs: 5-8, or an amino acid sequence with at least about 90% homology to the amino acid sequence selected from SEQ ID NOs: 5-8.
  • the present disclosure provides a humanized anti-Clq antibody, or an antigen-binding fragment thereof, the antibody comprising: a) a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 2, or an amino acid sequence with at least about 90% homology to the amino acid sequence of SEQ ID NO: 2; and b) a light chain variable domain comprising an amino acid sequence selected from SEQ ID NOs: 5-8, or an amino acid sequence with at least about 90%> homology to the amino acid sequence selected from SEQ ID NOs: 5-8.
  • the present disclosure provides a humanized anti-Clq antibody, or an antigen-binding fragment thereof, the antibody comprising: a) a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 3, or an amino acid sequence with at least about 90% homology to the amino acid sequence of SEQ ID NO: 3; and b) a light chain variable domain comprising an amino acid sequence selected from SEQ ID NOs: 5-8, or an amino acid sequence with at least about 90% homology to the amino acid sequence selected from SEQ ID NOs: 5-8.
  • the present disclosure provides a humanized anti-Clq antibody, or an antigen-binding fragment thereof, the antibody comprising: a) a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 4, or an amino acid sequence with at least about 90% homology to the amino acid sequence of SEQ ID NO: 4; and b) a light chain variable domain comprising an amino acid sequence selected from SEQ ID NOs: 5-8, or an amino acid sequence with at least about 90%> homology to the amino acid sequence selected from SEQ ID NOs: 5-8.
  • the present disclosure provides a humanized anti-Clq antibody, or an antigen-binding fragment thereof, the antibody comprising: a) a heavy chain variable domain comprising an amino acid sequence selected from SEQ ID NOs: 1-4, or an amino acid sequence with at least about 90%> homology to the amino acid sequence selected from SEQ ID NOs: 1-4; and b) a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 5, or an amino acid sequence with at least about 90%> homology to the amino acid sequence of SEQ ID NO: 5.
  • the present disclosure provides a humanized anti-Clq antibody, or an antigen-binding fragment thereof, the antibody comprising: a) a heavy chain variable domain comprising an amino acid sequence selected from SEQ ID NOs: 1-4, or an amino acid sequence with at least about 90%> homology to the amino acid sequence selected from SEQ ID NOs: 1-4; and b) a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 6, or an amino acid sequence with at least about 90%> homology to the amino acid sequence of SEQ ID NO: 6.
  • the present disclosure provides a humanized anti-Clq antibody, or an antigen-binding fragment thereof, the antibody comprising: a) a heavy chain variable domain comprising an amino acid sequence selected from SEQ ID NOs: 1-4, or an amino acid sequence with at least about 90%> homology to the amino acid sequence selected from SEQ ID NOs: 1-4; and b) a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 7, or an amino acid sequence with at least about 90%> homology to the amino acid sequence of SEQ ID NO: 7.
  • the present disclosure provides a humanized anti-Clq antibody, or an antigen-binding fragment thereof, the antibody comprising: a) a heavy chain variable domain comprising an amino acid sequence selected from SEQ ID NOs: 1-4, or an amino acid sequence with at least about 90%> homology to the amino acid sequence selected from SEQ ID NOs: 1-4; and b) a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 8, or an amino acid sequence with at least about 90% homology to the amino acid sequence of SEQ ID NO: 8.
  • the present disclosure provides a humanized anti-Clq antibody, or an antigen-binding fragment thereof, the antibody comprising: a) a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 1, or an amino acid sequence with at least about 90% homology to the amino acid sequence of SEQ ID NO: 1; and b) a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 5, or an amino acid sequence with at least about 90% homology to the amino acid sequence of SEQ ID NO: 5.
  • the present disclosure provides a humanized anti-Clq antibody, or an antigen-binding fragment thereof, the antibody comprising: a) a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 1, or an amino acid sequence with at least about 90%> homology to the amino acid sequence of SEQ ID NO: 1; and b) a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 6, or an amino acid sequence with at least about 90% homology to the amino acid sequence of SEQ ID NO: 6.
  • the present disclosure provides a humanized anti-Clq antibody, or an antigen-binding fragment thereof, the antibody comprising: a) a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 1, or an amino acid sequence with at least about 90%> homology to the amino acid sequence of SEQ ID NO: 1; and b) a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 7, or an amino acid sequence with at least about 90% homology to the amino acid sequence of SEQ ID NO: 7.
  • the present disclosure provides a humanized anti-Clq antibody, or an antigen-binding fragment thereof, the antibody comprising: a) a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 1, or an amino acid sequence with at least about 90%> homology to the amino acid sequence of SEQ ID NO: 1; and b) a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 8, or an amino acid sequence with at least about 90% homology to the amino acid sequence of SEQ ID NO: 8.
  • the present disclosure provides a humanized anti-Clq antibody, or an antigen-binding fragment thereof, the antibody comprising: a) a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 2, or an amino acid sequence with at least about 90% homology to the amino acid sequence of SEQ ID NO: 2; and b) a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 5, or an amino acid sequence with at least about 90% homology to the amino acid sequence of SEQ ID NO: 5.
  • the present disclosure provides a humanized anti-Clq antibody, or an antigen-binding fragment thereof, the antibody comprising: a) a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 2, or an amino acid sequence with at least about 90% homology to the amino acid sequence of SEQ ID NO: 2; and b) a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 6, or an amino acid sequence with at least about 90% homology to the amino acid sequence of SEQ ID NO: 6.
  • the present disclosure provides a humanized anti-Clq antibody, or an antigen-binding fragment thereof, the antibody comprising: a) a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 2, or an amino acid sequence with at least about 90%> homology to the amino acid sequence of SEQ ID NO: 2; and b) a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 7, or an amino acid sequence with at least about 90% homology to the amino acid sequence of SEQ ID NO: 7.
  • the present disclosure provides a humanized anti-Clq antibody, or an antigen-binding fragment thereof, the antibody comprising: a) a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 2, or an amino acid sequence with at least about 90%> homology to the amino acid sequence of SEQ ID NO: 2; and b) a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 8, or an amino acid sequence with at least about 90% homology to the amino acid sequence of SEQ ID NO: 8.
  • the present disclosure provides a humanized anti-Clq antibody, or an antigen-binding fragment thereof, the antibody comprising: a) a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 3, or an amino acid sequence with at least about 90%> homology to the amino acid sequence of SEQ ID NO: 3; and b) a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 5, or an amino acid sequence with at least about 90% homology to the amino acid sequence of SEQ ID NO: 5.
  • the present disclosure provides a humanized anti-Clq antibody, or an antigen-binding fragment thereof, the antibody comprising: a) a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 3, or an amino acid sequence with at least about 90%> homology to the amino acid sequence of SEQ ID NO: 3; and b) a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 6, or an amino acid sequence with at least about 90% homology to the amino acid sequence of SEQ ID NO: 6.
  • the present disclosure provides a humanized anti-Clq antibody, or an antigen-binding fragment thereof, the antibody comprising: a) a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 3, or an amino acid sequence with at least about 90% homology to the amino acid sequence of SEQ ID NO: 3; and b) a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 7, or an amino acid sequence with at least about 90% homology to the amino acid sequence of SEQ ID NO: 7.
  • the present disclosure provides a humanized anti-Clq antibody, or an antigen-binding fragment thereof, the antibody comprising: a) a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 3, or an amino acid sequence with at least about 90%> homology to the amino acid sequence of SEQ ID NO: 3; and b) a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 8, or an amino acid sequence with at least about 90% homology to the amino acid sequence of SEQ ID NO: 8.
  • the present disclosure provides a humanized anti-Clq antibody, or an antigen-binding fragment thereof, the antibody comprising: a) a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 4, or an amino acid sequence with at least about 90%> homology to the amino acid sequence of SEQ ID NO: 4; and b) a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 5, or an amino acid sequence with at least about 90% homology to the amino acid sequence of SEQ ID NO: 5.
  • the present disclosure provides a humanized anti-Clq antibody, or an antigen-binding fragment thereof, the antibody comprising: a) a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 4, or an amino acid sequence with at least about 90%> homology to the amino acid sequence of SEQ ID NO: 4; and b) a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 6, or an amino acid sequence with at least about 90% homology to the amino acid sequence of SEQ ID NO: 6.
  • the present disclosure provides a humanized anti-Clq antibody, or an antigen-binding fragment thereof, the antibody comprising: a) a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 4, or an amino acid sequence with at least about 90%> homology to the amino acid sequence of SEQ ID NO: 4; and b) a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 7, or an amino acid sequence with at least about 90% homology to the amino acid sequence of SEQ ID NO: 7.
  • the present disclosure provides a humanized anti-Clq antibody, or an antigen-binding fragment thereof, the antibody comprising: a) a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 4, or an amino acid sequence with at least about 90% homology to the amino acid sequence of SEQ ID NO: 4; and b) a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 8, or an amino acid sequence with at least about 90% homology to the amino acid sequence of SEQ ID NO: 8.
  • the antibody binds specifically to both human Clq and mouse Clq. In some embodiments that may be combined with any of the preceding embodiments, the antibody binds specifically to rat Clq. In some embodiments that may be combined with any of the preceding embodiments, the antibody binds specifically to human Clq, mouse Clq, and rat Clq. In some embodiments that may be combined with any of the preceding embodiments, the antibody or antigen-binding fragment thereof binds essentially the same Clq epitope as the antibody Ml produced by the hybridoma cell line with ATCC Accession Number PTA- 120399 or anti-Clq binding fragments thereof.
  • the antibody or antigen-binding fragment thereof inhibits the binding of the monoclonal antibody Ml produced by a hybridoma cell line with ATCC Accession Number PTA-120399 to human Clq or to mouse Clq.
  • the antibody is of the IgG class.
  • the antibody has an IgGl, IgG2, IgG3, or IgG4 isotype. In some embodiments that may be combined with any of the preceding
  • the antibody has an IgG4 isotype. In some embodiments that may be combined with any of the preceding embodiments, the antibody comprises a human IgG4 constant region. In some embodiments that may be combined with any of the preceding embodiments, the human IgG4 heavy chain constant region comprises the amino acid sequence of SEQ ID NO: 37, or an amino acid sequence with at least about 90%> homology to the amino acid sequence of SEQ ID NO: 37. In some embodiments that may be combined with any of the preceding embodiments, the human IgG4 constant region comprises an Fc region. In some embodiments that may be combined with any of the preceding embodiments, the Fc region is incapable of binding the Clq protein.
  • the Fc region is incapable of inducing complement activity. In some embodiments that may be combined with any of the preceding embodiments, the Fc region is incapable of inducing antibody- dependent cellular cytotoxicity (ADCC). In some embodiments that may be combined with any of the preceding embodiments, the Fc region comprises one or more modifications. In some embodiments that may be combined with any of the preceding embodiments, the Fc region comprises one or more amino acid substitutions. In some embodiments that may be combined with any of the preceding embodiments, the Fc region comprises an amino acid substitution at position 248 according to Kabat numbering convention. In some
  • the Fc region comprises a leucine to glutamate amino acid substitution at position 248 according to Kabat numbering convention. In some embodiments that may be combined with any of the preceding embodiments, the amino acid substitution at position 248 according to Kabat numbering convention inhibits the Fc region from interacting with an Fc receptor. In some embodiments that may be combined with any of the preceding embodiments, the Fc region comprises an amino acid substitution at position 241 according to Kabat numbering convention. In some embodiments that may be combined with any of the preceding embodiments, the Fc region comprises a serine to proline amino acid substitution at position 241 according to Kabat numbering convention.
  • the amino acid substitution at position 241 according to Kabat numbering convention prevents arm switching in the antibody.
  • the antibody is a bispecific antibody. In some embodiments that may be combined with any of the preceding embodiments, the antibody has been engineered to increase brain penetration. In some embodiments that may be combined with any of the preceding embodiments, the antibody is a bispecific antibody recognizing a first antigen and a second antigen. In some embodiments that may be combined with any of the preceding embodiments, the first antigen is a Clq protein and the second antigen is an antigen facilitating transport across the blood-brain-barrier.
  • the second antigen is selected from transferrin receptor (TR), insulin receptor (HIR), insulin-like growth factor receptor (IGFR), low-density lipoprotein receptor related proteins 1 and 2 (LPR-1 and 2), diphtheria toxin receptor, CRM 197, a llama single domain antibody, TMEM 30(A), a protein transduction domain, TAT, Syn-B, penetratin, a poly-arginine peptide, an angiopep peptide, and ANG1005.
  • the antigen- binding fragment is a Fab, F(ab') 2 or Fab' fragment.
  • the antibody fragment has better brain penetration as compared to its corresponding full-length antibody. In some embodiments that may be combined with any of the preceding embodiments, the antibody fragment has a shorter half-life as compared to its corresponding full-length antibody. In some
  • the antibody has a dissociation constant (KD) for human Clq that ranges from less than about 10 pM to less than about 5 pM. In some embodiments that may be combined with any of the preceding embodiments, the antibody has dissociation constant (K D ) for mouse Clq that ranges from less than about 125 nM to less than about 5 pM. In some embodiments that may be combined with any of the preceding embodiments, the antibody specifically binds to and neutralizes a biological activity of Clq.
  • the biological activity is (1) Clq binding to an autoantibody, (2) C lq binding to Clr, (3) Clq binding to Cls, (4) Clq binding to phosphatidylserine, (5) C lq binding to pentraxin-3, (6) C lq binding to C-reactive protein (CRP), (7) Clq binding to globular Clq receptor (gClqR), (8) C lq binding to complement receptor 1 (CR1), (9) C lq binding to beta-amyloid, or (10) Clq binding to calreticulin.
  • the biological activity is (1) activation of the classical complement activation pathway, (2) activation of antibody and complement dependent cytotoxicity, (3) CH50 hemolysis, (4) synapse loss, (5) B-cell antibody production, (6) dendritic cell maturation, (7) T-cell proliferation, (8) cytokine production (9) microglia activation, (10) Arthus reaction, (1 1) phagocytosis of synapses or nerve endings, or (12) activation of complement receptor 3 (CR3/C3) expressing cells.
  • CH50 hemolysis comprises human, mouse, and/or rat CH50 hemolysis.
  • the antibody is capable of neutralizing from at least about 50%, to at least about 95% of CH50 hemolysis. In some embodiments that may be combined with any of the preceding embodiments, the antibody is capable of neutralizing at least 50% of CH50 hemolysis at a dose of less than 150 ng, less than 100 ng, less than 50 ng, or less than 20 ng. In some embodiments that may be combined with any of the preceding embodiments, the antibody binds C lq with a binding stoichiometry that ranges from 20: 1 to 1.0: 1 or less than 1.0: 1.
  • the present disclosure provides an isolated polynucleotide comprising a nucleic acid sequence encoding a humanized anti-C lq antibody of any of the preceding embodiments.
  • the present disclosure provides an isolated host cell comprising a nucleic acid sequence of any of the preceding embodiments.
  • the present disclosure provides a pharmaceutical composition comprising a humanized anti-Clq antibody of any of the preceding embodiments and a pharmaceutically acceptable carrier.
  • the present disclosure provides a method of treating or preventing a disease associated with complement activation in an individual in need of such treatment, the method comprising the step of administering a therapeutically effective dose of a humanized anti-Clq antibody of any of the preceding embodiments.
  • the present disclosure provides a humanized anti-Clq antibody of any of the preceding embodiments for use in treating or preventing a disease associated with complement activation in an individual in need of such treatment.
  • the present disclosure provides use of a humanized anti-Clq antibody of any of the preceding embodiments in the manufacture of a medicament for treating or preventing a disease associated with complement activation in an individual in need of such treatment.
  • the disease associated with complement activation is a neurodegenerative disorder.
  • the neurodegenerative disorder is associated with the loss of synapses or nerve connections.
  • the neurodegenerative disorder is associated with synapse loss that is dependent on the complement receptor 3(CR3)/C3 or complement receptor CR1.
  • the neurodegenerative disorder is associated with pathological activity-dependent synaptic pruning.
  • the neurodegenerative disorder is associated with synapse phagocytosis by microglia.
  • the neurodegenerative disorder is selected from Alzheimer's disease, amyotrophic lateral sclerosis, multiple sclerosis, glaucoma, myotonic dystrophy, Guillain- Barre ' syndrome (GBS), Myastenia Gravis, Bullous Pemphigoid, spinal muscular atrophy, Down syndrome, Parkinson's disease, and Huntington's disease.
  • the disease associated with complement activation is an inflammatory disease, an autoimmune disease, or metabolic disorder.
  • the inflammatory disease, autoimmune disease, or metabolic disorder is selected from diabetes, obesity, rheumatoid arthritis (RA), acute respiratory distress syndrome (ARDS), remote tissue injury after ischemia and reperfusion, complement activation during cardiopulmonary bypass surgery, dermatomyositis, pemphigus, lupus nephritis and resultant glomerulonephritis and vasculitis, cardiopulmonary bypass, cardioplegia-induced coronary endothelial dysfunction, type II membranoproliferative glomerulonephritis, IgA nephropathy, acute renal failure, cryoglobulemia, antiphospholipid syndrome, Chronic open-angle glaucoma, acute closed angle glaucoma, macular degenerative diseases, age-related macular degeneration (AMD), (AMD-wet), Geographic atrophy choroidal neovascularization (CNV), uveitis, diabetic retinopathy,
  • RA rheumatoid arthritis
  • Hashimoto's thyroiditis Addison's disease, Coeliac disease, Crohn's disease, pernicious anaemia, Pemphigus vulgaris, vitiligo, autoimmune hemolytic anemias, paraneoplastic syndromes, a vasculitis disease, hypocomplementemic urticarial vasculitis (HUV), polymyalgia rheumatica, temporal arteritis, and Wegener's granulomatosis.
  • the present disclosure provides a kit comprising a humanized anti-Clq antibody of any of the preceding embodiments, and a package insert comprising instructions for using the antibody to treat or prevent a disease associated with complement activation in an individual in need of such treatment.
  • the disease associated with complement activation is a neurodegenerative disorder.
  • the neurodegenerative disorder is associated with loss of synapses or loss nerve connections.
  • the neurodegenerative disorder is associated with synapse loss that is dependent on the complement receptor 3(CR3)/C3 or complement receptor CR1.
  • the neurodegenerative disorder is associated with pathological activity-dependent synaptic pruning.
  • the disease associated with complement activation is a neurodegenerative disorder.
  • the neurodegenerative disorder is associated with loss of synapses or loss nerve connections.
  • the neurodegenerative disorder is associated with synapse loss that is dependent on the complement receptor 3(CR3)/C3 or complement receptor CR1.
  • the neurodegenerative disorder is associated with pathological activity-dependent synaptic pruning.
  • neurodegenerative disorder is associated with synapse phagocytosis by microglia.
  • the neurodegenerative disorder is selected from Alzheimer's disease, amyotrophic lateral sclerosis, multiple sclerosis, glaucoma, myotonic dystrophy, Down syndrome, Parkinson's disease, and Huntington's disease.
  • the disease associated with complement activation is an inflammatory disease, autoimmune disease, or metabolic disorder.
  • the inflammatory disease, autoimmune disease, or metabolic disorder is selected from diabetes, obesity, rheumatoid arthritis (RA), acute respiratory distress syndrome (ARDS), remote tissue injury after ischemia and reperfusion, complement activation during cardiopulmonary bypass surgery, dermatomyositis, pemphigus, lupus nephritis and resultant glomerulonephritis and vasculitis, cardiopulmonary bypass, cardioplegia-induced coronary endothelial dysfunction, type II membranoproliferative glomerulonephritis, IgA nephropathy, acute renal failure, cryoglobulemia, antiphospholipid syndrome, Chronic open-angle glaucoma, acute closed angle glaucoma, macular degenerative diseases, age-related macular degeneration (AMD), Geographic atrophy, choroidal neovascularization (CNV), uveitis, diabetic retinopathy, ischemia-related retinopathy, endophthalmitis, intraocular
  • the disease associated with complement activation is an autoimmune disease selected from myasthenia gravis, Diabetes mellitus type 1, Hashimoto's thyroiditis, Addison's disease, Coeliac disease, Crohn's disease, pernicious anaemia, Pemphigus vulgaris, vitiligo, autoimmune hemolytic anemias, paraneoplastic syndromes, a vasculitis disease, hypocomplementemic urticarial vasculitis (HUV), polymyalgia rheumatica, temporal arteritis, and Wegener's granulomatosis.
  • the present disclosure provides a kit comprising a humanized anti-Clq antibody of any of the preceding embodiments.
  • the kit is for diagnostic or therapeutic uses as disclosed herein.
  • the present disclosure provides a method of detecting synapses in an individual, by a) administering a humanized anti-Clq antibody of any of the preceding embodiments to the individual, and b) detecting antibody bound to synapses, thereby detecting synapses in the individual.
  • the present disclosure provides a humanized anti-Clq antibody of any of the preceding embodiments for use in detecting synapses in an individual.
  • the present disclosure provides use of a humanized anti-Clq antibody of any of the preceding embodiments in the manufacture of a medicament for detecting synapses in an individual.
  • the antibody bound to synapses is detected using imaging techniques selected from positron emission tomography (PET), X- ray computed tomography, single-photon emission computed tomography (SPECT), computed tomography (CT), and computed axial tomography (CAT).
  • PET positron emission tomography
  • SPECT single-photon emission computed tomography
  • CT computed tomography
  • CAT computed axial tomography
  • the detection of antibody bound to synapses provides a quantitative measure of the number of synapses in the individual.
  • the individual has a neurodegenerative disease or autoimmune disease.
  • the number of synapses in the individual is measured repeatedly over a period of time and a loss of synapses in the individual is detected over time.
  • the loss of synapses over time is a measure for the efficacy of a treatment for the neurodegenerative disease or autoimmune disease.
  • the present disclosure provides a method of detecting synapses in a biological sample, by a) contacting the biological sample with a humanized anti-Clq antibody of any of the preceding embodiments, and b) detecting antibody bound to synapses, thereby detecting synapses in the individual.
  • the method further comprises a step before step a) of obtaining the biological sample from an individual.
  • the biological sample comprises a biopsy specimen, a tissue, or a cell.
  • the antibody is detected by immunofluorescence microscopy, immunocytochemistry, immunohistochemistry, ELISA, FACS analysis, immunoprecipitation, or micro-positron emission tomography.
  • FIG. 1 depicts plasmid maps for light chain and heavy chain expression vectors.
  • FIG. 1A depicts a plasmid map for light chain expression vector pANTVk.
  • FIG. IB depicts a plasmid map for and heavy chain expression vector pANTVhG4 (S241P L248E).
  • Both VH and VK vectors contain genomic DNA fragments incorporating introns and polyA sequences. Expression of both chains is driven by a CMV promoter and selection (on the heavy chain vector) is via a DHFR mini gene.
  • FIG. 2A depicts an alignment of amino acid sequence of the heavy chain variable region (VH) of the Ml antibody and the amino acid sequences of the humanized VH variants VH1-VH2.
  • FIG. 2B depicts an alignment of amino acid sequence of the heavy chain variable region (VH) of the Ml antibody and the amino acid sequences of the humanized VH variants VH3-VH4.
  • FIG. 2C depicts an alignment of amino acid sequence of the kappa light chain variable region (VK) of the Ml antibody and the amino acid sequences of the humanized VK variants VK1-VK2.
  • FIG. 2D depicts an alignment of amino acid sequence of the kappa light chain variable region (VK) of the Ml antibody and the amino acid sequences of the humanized VK variants VK3-VK4.
  • FIG. 3 depicts a Coomassie Blue-stained SDS-PAGE gel of protein A-purified antibodies. 2 ⁇ g of each sample was loaded on a NuPage 4-12% Bis-Tris gel and run at 200V for 35min. Size marker is pre-stained protein standard Fermentas PageRuler Plus.
  • FIG. 4 depicts competition ELISA assays for human Clq.
  • a dilution series of purified humanized anti-Clq antibodies were competed against a fixed concentration of biotinylated monoclonal antibody Ml for binding to human Clq. Bound biotinylated Ml antibody was detected using streptavidin-peroxidase conjugate and TMB substrate.
  • FIG. 4A depicts the results with the humanized antibodies VHI/VKI , VH1/VK2, and VH1/VK3.
  • FIG. 4B depicts the results with the humanized antibodies VHWK4, VH2/VK1, VH2/VK2, VH2/VK3, and VH2/VK4.
  • FIG. 4C depicts the results with the humanized
  • FIG. 4D depicts the results with the humanized antibodies VH4/VK1, VH4/VK2, VH4/VK3, and VH4/VK4.
  • FIG. 5 depicts competition ELISA assays for mouse Clq.
  • a dilution series of purified humanized anti-Clq antibodies were competed against a fixed concentration of the chimeric Ml antibody for binding to mouse Clq.
  • Bound biotinylated chimeric Ml was detected using streptavidin-peroxidase conjugate and TMB substrate.
  • FIG. 6 depicts a Coomassie Blue-stained SDS-PAGE gel of gel filtration- purified antibodies. 1 ⁇ g of each sample was loaded on a NuPage 4-12% Bis-Tris gel and run at 200V for 35min. Size marker (M) is pre-stained protein standard Fermentas
  • Lane 1 depicts Fab VH3/VK3 reduced; lane 2 depicts Fab VH3/VK3 non- reduced; lane 3 depicts IgG V VH3/VK3 reduced; and lane 4 depicts IgG VH3/VK3 non- reduced.
  • FIG. 7 illustrates the Clq-neutralizing activities of anti-Clq antibodies in human, and rat CH50 hemolytic assays in a dose-response format.
  • FIG. 7A illustrates results from a human CH50 hemolytic assay.
  • FIG. 7B illustrates results from a rat CH50 hemolytic assay.
  • ANN-005" corresponds to the monoclonal antibody Ml
  • 3E2 corresponds to a chimeric Ml antibody
  • 2B12 corresponds to antibody VHI/VKI
  • 5H7 corresponds to antibody VH3/VK3
  • 3F1 corresponds to antibody VH3/VK4
  • “1D3” corresponds to antibody VH4/VK3.
  • FIG. 8 depicts the time course of serum 5H7 levels in monkeys for single IV dose at 15 and 100 mg/Kg.
  • FIG. 9 illustrates the time course of serum Clq levels in monkeys for single IV dose at 15 and 100 mg/Kg.
  • FIG 9A depicts the time course of serum Clq levels in monkeys using the JL1-M1 assay.
  • FIG. 9B depicts the time course of serum Clq levels in monkeys using the JL1-JL1 assay.
  • FIG 10 shows sustained reduction of serum hemolysis in monkeys for single IV dose at 15 and 100 mg/Kg.
  • the term "preventing” includes providing prophylaxis with respect to occurrence or recurrence of a particular disease, disorder, or condition in an individual.
  • An individual may be predisposed to, susceptible to a particular disease, disorder, or condition, or at risk of developing such a disease, disorder, or condition, but has not yet been diagnosed with the disease, disorder, or condition.
  • an individual "at risk" of developing a particular disease, disorder, or condition may or may not have detectable disease or symptoms of disease, and may or may not have displayed detectable disease or symptoms of disease prior to the treatment methods described herein.
  • At risk denotes that an individual has one or more risk factors, which are measurable parameters that correlate with development of a particular disease, disorder, or condition, as known in the art. An individual having one or more of these risk factors has a higher probability of developing a particular disease, disorder, or condition than an individual without one or more of these risk factors.
  • treatment refers to clinical intervention designed to alter the natural course of the individual being treated during the course of clinical pathology. Desirable effects of treatment include decreasing the rate of progression, ameliorating or palliating the pathological state, and remission or improved prognosis of a particular disease, disorder, or condition.
  • An individual is successfully "treated", for example, if one or more symptoms associated with a particular disease, disorder, or condition are mitigated or eliminated.
  • an "effective amount” refers to at least an amount effective, at dosages and for periods of time necessary, to achieve the desired therapeutic or prophylactic result.
  • An effective amount can be provided in one or more administrations.
  • a “therapeutically effective amount” is at least the minimum concentration required to effect a measurable improvement of a particular disease, disorder, or condition.
  • a therapeutically effective amount herein may vary according to factors such as the disease state, age, sex, and weight of the patient, and the ability of the anti-Clq antibody to elicit a desired response in the individual.
  • a therapeutically effective amount is also one in which any toxic or detrimental effects of the anti-Clq antibody are outweighed by the
  • Chronic administration refers to administration of the medicament(s) in a continuous as opposed to acute mode, so as to maintain the initial therapeutic effect (activity) for an extended period of time.
  • Intermittent administration refers to treatment that is not consecutively done without interruption, but rather is cyclic in nature.
  • administration "in conjunction" with another compound or composition includes simultaneous administration and/or administration at different times.
  • Administration in conjunction also encompasses administration as a co-formulation or administration as separate compositions, including at different dosing frequencies or intervals, and using the same route of administration or different routes of administration.
  • An individual for purposes of treatment, prevention, or reduction of risk refers to any animal classified as a mammal, including humans, domestic and farm animals, and zoo, sport, or pet animals, such as dogs, horses, rabbits, cattle, pigs, hamsters, gerbils, mice, ferrets, rats, cats, and the like. In some embodiments, the individual is human.
  • autoantibody ' means any antibody that recognizes a host antigen.
  • immunoglobulin (Ig) is used interchangeably with “antibody” herein.
  • antibody herein is used in the broadest sense and specifically covers monoclonal antibodies, polyclonal antibodies, multispecific antibodies ⁇ e.g. bispecific antibodies) formed from at least two intact antibodies, and antibody fragments so long as they exhibit the desired biological activity.
  • the basic 4-chain antibody unit is a heterotetrameric glycoprotein composed of two identical light (L) chains and two identical heavy (H) chains. The pairing of a V H and V L together forms a single antigen-binding site.
  • L light
  • H heavy
  • immunoglobulins can be assigned to different classes or isotypes. There are five classes of immunoglobulins: IgA, IgD, IgE, IgG, and IgM, having heavy chains designated alpha ("a"), delta (" ⁇ "), epsilon (“ ⁇ "), gamma (“ ⁇ ”) and mu (“ ⁇ ”), respectively.
  • the ⁇ and a classes are further divided into subclasses (isotypes) on the basis of relatively minor differences in the CH sequence and function, e.g., humans express the following subclasses: IgGl, IgG2, IgG3, IgG4, IgAl, and IgA2.
  • subclasses immunoglobulins
  • the subunit structures and three dimensional configurations of different classes of immunoglobulins are well known and described generally in, for example, Abbas et al. , Cellular and Molecular Immunology, 4 th ed. (W.B. Saunders Co., 2000).
  • “Native antibodies” are usually heterotetrameric glycoproteins of about 150,000 daltons, composed of two identical light (L) chains and two identical heavy (H) chains. Each light chain is linked to a heavy chain by one covalent disulfide bond, while the number of disulfide linkages varies among the heavy chains of different immunoglobulin isotypes. Each heavy and light chain also has regularly spaced intrachain disulfide bridges. Each heavy chain has at one end a variable domain (V H ) followed by a number of constant domains.
  • V H variable domain
  • Each light chain has a variable domain at one end (V L ) and a constant domain at its other end; the constant domain of the light chain is aligned with the first constant domain of the heavy chain, and the light chain variable domain is aligned with the variable domain of the heavy chain. Particular amino acid residues are believed to form an interface between the light chain and heavy chain variable domains.
  • an "isolated" antibody such as an anti-Clq antibody of the present disclosure, is one that has been identified, separated and/or recovered from a component of its production environment ⁇ e.g., naturally or recombinantly).
  • the isolated polypeptide is free of association with all other contaminant components from its production environment.
  • Contaminant components from its production environment such as those resulting from recombinant transfected cells, are materials that would typically interfere with research, diagnostic or therapeutic uses for the antibody, and may include enzymes, hormones, and other proteinaceous or non-proteinaceous solutes.
  • the polypeptide will be purified: (1) to greater than 95% by weight of antibody as determined by, for example, the Lowry method, and in some embodiments, to greater than 99% by weight; (2) to a degree sufficient to obtain at least 15 residues of N- terminal or internal amino acid sequence by use of a spinning cup sequenator, or (3) to homogeneity by SDS-PAGE under non-reducing or reducing conditions using Coomassie blue or silver stain.
  • Isolated antibody includes the antibody in situ within recombinant T- cells since at least one component of the antibody's natural environment will not be present. Ordinarily, however, an isolated polypeptide or antibody will be prepared by at least one purification step.
  • variable region refers to the amino-terminal domains of the heavy or light chain of the antibody.
  • the variable domains of the heavy chain and light chain may be referred to as "V H " and "V L ", respectively. These domains are generally the most variable parts of the antibody (relative to other antibodies of the same class) and contain the antigen binding sites.
  • variable refers to the fact that certain segments of the variable domains differ extensively in sequence among antibodies, such as anti-Clq antibodies of the present disclosure. The V domain mediates antigen binding and defines the specificity of a particular antibody for its particular antigen.
  • variable domains are not evenly distributed across the entire span of the variable domains. Instead, it is concentrated in three segments called hypervariable regions (HVRs) both in the light-chain and the heavy chain variable domains.
  • HVRs hypervariable regions
  • FR framework regions
  • the variable domains of native heavy and light chains each comprise four FR regions, largely adopting a beta-sheet configuration, connected by three HVRs, which form loops connecting, and in some cases forming part of, the beta-sheet structure.
  • the HVRs in each chain are held together in close proximity by the FR regions and, with the HVRs from the other chain, contribute to the formation of the antigen binding site of antibodies (see Kabat et al., Sequences of Immunological Interest, Fifth Edition, National Institute of Health, Bethesda, MD (1991)).
  • the constant domains are not involved directly in the binding of antibody to an antigen, but exhibit various effector functions, such as participation of the antibody in antibody-dependent-cellular toxicity.
  • the term "monoclonal antibody" as used herein refers to an antibody, such as an anti- Clq antibody of the present disclosure, obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical except for possible naturally occurring mutations and/or post-translation modifications (e.g., isomerizations, amidations) that may be present in minor amounts. Monoclonal antibodies are highly specific, being directed against a single antigenic site. In contrast to polyclonal antibody preparations which typically include different antibodies directed against different determinants (epitopes), each monoclonal antibody is directed against a single determinant on the antigen.
  • the monoclonal antibodies are advantageous in that they are synthesized by the hybridoma culture, uncontaminated by other immunoglobulins.
  • the modifier "monoclonal” indicates the character of the antibody as being obtained from a substantially homogeneous population of antibodies, and is not to be construed as requiring production of the antibody by any particular method.
  • the monoclonal antibodies to be used in accordance with the present disclosure may be made by a variety of techniques, including, for example, the hybridoma method (e.g., Kohler and Milstein., Nature, 256:495-97 (1975); Hongo et al, Hybridoma, 14 (3):253-260 (1995), Harlow et al, Antibodies: A Laboratory Manual, (Cold Spring Harbor Laboratory Press, 2d ed. 1988); Hammerling et al., in: Monoclonal
  • full-length antibody “intact antibody” or “whole antibody” are used interchangeably to refer to an antibody, such as and anti-Clq antibody of the present disclosure, in its substantially intact form, as opposed to an antibody fragment.
  • whole antibodies include those with heavy and light chains including an Fc region.
  • the constant domains may be native sequence constant domains (e.g., human native sequence constant domains) or amino acid sequence variants thereof.
  • the intact antibody may have one or more effector functions.
  • an "antibody fragment” comprises a portion of an intact antibody, the antigen binding and/or the variable region of the intact antibody.
  • antibody fragments include Fab, Fab', F(ab') 2 and Fv fragments; diabodies; linear antibodies (see U.S. Patent 5,641,870, Example 2; Zapata et al, Protein Eng. 8(10): 1057-1062 (1995)); single-chain antibody molecules and multispecific antibodies formed from antibody fragments.
  • Papain digestion of antibodies produces two identical antigen-binding fragments or regions, called “Fab” fragments or regions, and a residual "Fc" fragment or region, a designation reflecting the ability to crystallize readily.
  • the Fab fragment or region consists of an entire L chain along with the variable region domain of the H chain (V H ), and the first constant domain of one heavy chain (C H I).
  • V H variable region domain of the H chain
  • C H I first constant domain of one heavy chain
  • Each Fab fragment or region is monovalent with respect to antigen binding, i.e., it has a single antigen-binding site.
  • Fab' fragments or regions differ from Fab fragments by having a few additional residues at the carboxy terminus of the C H I domain including one or more cysteines from the antibody hinge region.
  • Fab'-SH is the designation herein for Fab' in which the cysteine residue(s) of the constant domains bear a free thiol group.
  • F(ab') 2 antibody fragments originally were produced as pairs of Fab' fragments which have hinge cysteines between them. Other chemical couplings of antibody fragments are also known.
  • the Fc fragment or region comprises the carboxy-terminal portions of both H chains held together by disulfides.
  • the effector functions of antibodies are determined by sequences in the Fc region, the region which is also recognized by Fc receptors (FcR) found on certain types of cells.
  • Fv is the minimum antibody fragment which contains a complete antigen- recognition and -binding site. This fragment consists of a dimer of one heavy- and one light-chain variable region domain in tight, non-covalent association. From the folding of these two domains emanate six hypervariable loops (3 loops each from the H and L chain) that contribute the amino acid residues for antigen binding and confer antigen binding specificity to the antibody. However, even a single variable domain (or half of an Fv comprising only three HVRs specific for an antigen) has the ability to recognize and bind antigen, although at a lower affinity than the entire binding site.
  • Single-chain Fv also abbreviated as “sFv” or “scFv” are antibody fragments that comprise the VH and VL antibody domains connected into a single polypeptide chain.
  • the sFv polypeptide further comprises a polypeptide linker between the V R and V L domains which enables the sFv to form the desired structure for antigen binding.
  • Fully immunological fragments of antibodies such as anti-Clq antibodies of the present disclosure, comprise a portion of an intact antibody, generally including the antigen binding or variable region of the intact antibody or the F region of an antibody which retains or has modified FcR binding capability.
  • antibody fragments include linear antibody, single-chain antibody molecules and multispecific antibodies formed from antibody fragments.
  • diabodies refers to small antibody fragments prepared by
  • sFv fragments (see preceding paragraph) with short linkers (about 5-10) residues) between the V H and V L domains such that inter-chain but not intra-chain pairing of the V domains is achieved, thereby resulting in a bivalent fragment, i.e., a fragment having two antigen-binding sites.
  • Bispecific diabodies are heterodimers of two "crossover" sFv fragments in which the V H and V L domains of the two antibodies are present on different polypeptide chains.
  • Diabodies are described in greater detail in, for example, EP 404,097; WO 93/11161; Hollinger et al., Proc. Nat ⁇ Acad. Sci. USA 90:6444-48 (1993).
  • a "chimeric antibody” refers to an antibody (immunoglobulin), such as an anti-Clq antibody of the present disclosure, in which a portion of the heavy and/or light chain is identical with or homologous to corresponding sequences in antibodies derived from a particular species or belonging to a particular antibody class or subclass, while the remainder of the chain(s) is(are) identical with or homologous to corresponding sequences in antibodies derived from another species or belonging to another antibody class or subclass, as well as fragments of such antibodies, so long as they exhibit the desired biological activity (U.S. Patent No. 4,816,567; Morrison et al, Proc. Nat'lAcad. Sci.
  • Chimeric antibodies of interest herein include PRIMATIZED ® antibodies wherein the antigen-binding region of the antibody is derived from an antibody produced by, e.g. , immunizing macaque monkeys with an antigen of interest.
  • PRIMATIZED ® antibodies wherein the antigen-binding region of the antibody is derived from an antibody produced by, e.g. , immunizing macaque monkeys with an antigen of interest.
  • humanized antibody is used a subset of “chimeric antibodies.”
  • Humanized forms of non-human ⁇ e.g., murine) antibodies are chimeric antibodies that contain minimal sequence derived from non-human immunoglobulin.
  • a humanized antibody is a human immunoglobulin (recipient antibody) in which residues from an HVR of the recipient are replaced by residues from an HVR of a non-human species (donor antibody) such as mouse, rat, rabbit or non-human primate having the desired specificity, affinity, and/or capacity.
  • donor antibody such as mouse, rat, rabbit or non-human primate having the desired specificity, affinity, and/or capacity.
  • FR residues of the human immunoglobulin are replaced by corresponding non-human residues.
  • humanized antibodies may comprise residues that are not found in the recipient antibody or in the donor antibody.
  • a humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the hypervariable loops correspond to those of a non-human immunoglobulin sequence, and all or substantially all of the FR regions are those of a human immunoglobulin sequence, although the FR regions may include one or more individual FR residue substitutions that improve antibody performance, such as binding affinity, isomerization, immunogenicity, and the like.
  • the number of these amino acid substitutions in the FR is typically no more than 6 in the H chain, and in the L chain, no more than 3.
  • the humanized antibody optionally will also comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin.
  • Fc immunoglobulin constant region
  • a "human antibody” is one that possesses an amino-acid sequence
  • Human antibodies can be produced using various techniques known in the art, including phage-display libraries. Hoogenboom and Winter, J. Mol. Biol., 227:381 (1991); Marks et al., J. Mol. Biol., 222:581 (1991). Also available for the preparation of human monoclonal antibodies are methods described in Cole et al, Monoclonal Antibodies and Cancer Therapy, Alan R. Liss, p.
  • Human antibodies can be prepared by administering the antigen to a transgenic animal that has been modified to produce such antibodies in response to antigenic challenge, but whose endogenous loci have been disabled, e.g., immunized xenomice ⁇ see, e.g., U.S. Patent Nos. 6,075,181 and 6,150,584 regarding XENOMOUSETM technology). See also, for example, Li et al, Proc. Nat'lAcad. Sci. USA, 103:3557-3562 (2006) regarding human antibodies generated via a human B-cell hybridoma technology.
  • hypervariable region when used herein refers to the regions of an antibody- variable domain, such as that of an anti-Clq antibody of the present disclosure, that are hypervariable in sequence and/or form structurally defined loops.
  • antibodies comprise six HVRs; three in the VH (HI, H2, H3), and three in the VL (LI, L2, L3).
  • H3 and L3 display the most diversity of the six HVRs, and H3 in particular is believed to play a unique role in conferring fine specificity to antibodies. See, e.g., Xu et al, Immunity 13:37-45 (2000); Johnson and Wu in Methods in Molecular Biology 248: 1-25 (Lo, ed., Human Press, Totowa, NJ, 2003)).
  • camelid antibodies consisting of a heavy chain only are functional and stable in the absence of light chain. See, e.g., Hamers-Casterman et al., Nature 363:446-448 (1993) and Sheriff et al, Nature Struct. Biol. 3:733-736 (1996).
  • HVR delineations are in use and are encompassed herein.
  • the HVRs that are Kabat complementarity-determining regions (CDRs) are based on sequence variability and are the most commonly used (Kabat et al., supra). Chothia refers instead to the location of the structural loops (Chothia and Lesk J. Mol. Biol. 196:901-917 (1987)).
  • the AbM HVRs represent a compromise between the Kabat CDRs and Chothia structural loops, and are used by Oxford Molecular's AbM antibody-modeling software.
  • the "contact" HVRs are based on an analysis of the available complex crystal structures. The residues from each of these HVRs are noted below.
  • HVRs may comprise "extended HVRs" as follows: 24-36 or 24-34 (LI), 46-56 or 50-56 (L2), and 89-97 or 89-96 (L3) in the VL, and 26-35 (HI), 50-65 or 49-65 (H2), and 93-102, 94-102, or 95-102 (H3) in the VH.
  • the variable-domain residues are numbered according to Kabat et al., supra, for each of these extended-HVR definitions.
  • variable-domain residue-numbering as in Kabat or “amino-acid- position numbering as in Kabat,” and variations thereof, refers to the numbering system used for heavy-chain variable domains or light-chain variable domains of the compilation of antibodies in Kabat et al., supra. Using this numbering system, the actual linear amino acid sequence may contain fewer or additional amino acids corresponding to a shortening of, or insertion into, a FR or HVR of the variable domain.
  • a heavy-chain variable domain may include a single amino acid insert (residue 52a according to Kabat) after residue 52 of H2 and inserted residues ⁇ e.g., residues 82a, 82b, and 82c, etc. according to Kabat) after heavy-chain FR residue 82.
  • the Kabat numbering of residues may be determined for a given antibody by alignment at regions of homology of the sequence of the antibody with a "standard" Kabat numbered sequence.
  • the Kabat numbering system is generally used when referring to a residue in the variable domain (approximately residues 1-107 of the light chain and residues 1-113 of the heavy chain) ⁇ e.g., Kabat et al., Sequences of Immunological Interest. 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (1991)).
  • the "EU numbering system” or "EU index” is generally used when referring to a residue in an immunoglobulin heavy chain constant region ⁇ e.g., the EU index reported in Kabat et al., supra).
  • the "EU index as in Kabat” refers to the residue numbering of the human IgGl EU antibody.
  • references to residue numbers in the variable domain of antibodies means residue numbering by the Kabat numbering system. Unless stated otherwise herein, references to residue numbers in the constant domain of antibodies means residue numbering by the EU numbering system ⁇ e.g., see United States Patent Publication No. 2010-280227).
  • an "acceptor human framework” as used herein is a framework comprising the amino acid sequence of a VL or VH framework derived from a human immunoglobulin framework or a human consensus framework.
  • An acceptor human framework "derived from” a human immunoglobulin framework or a human consensus framework may comprise the same amino acid sequence thereof, or it may contain pre-existing amino acid sequence changes. In some embodiments, the number of pre-existing amino acid changes are 10 or less, 9 or less, 8 or less, 7 or less, 6 or less, 5 or less, 4 or less, 3 or less, or 2 or less.
  • those changes occur at only three, two, or one of positions 71H, 73H and 78H; for instance, the amino acid residues at those positions may by 71 A, 73T and/or 78A.
  • the VL acceptor human framework is identical in sequence to the VL human immunoglobulin framework sequence or human consensus framework sequence.
  • a "human consensus framework” is a framework that represents the most commonly occurring amino acid residues in a selection of human immunoglobulin VL or VH framework sequences.
  • the selection of human immunoglobulin VL or VH sequences is from a subgroup of variable domain sequences.
  • the subgroup of sequences is a subgroup as in Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD (1991).
  • the subgroup may be subgroup kappa I, kappa II, kappa III or kappa IV as in Kabat et al, supra. Additionally, for the VH, the subgroup may be subgroup I, subgroup II, or subgroup III as in Kabat et al., supra.
  • amino-acid modification at a specified position, e.g., of an anti-Clq antibody of the present disclosure, refers to the substitution or deletion of the specified residue, or the insertion of at least one amino acid residue adjacent the specified residue. Insertion "adjacent" to a specified residue means insertion within one to two residues thereof. The insertion may be N-terminal or C-terminal to the specified residue.
  • the amino acid modification herein is a substitution.
  • an "affinity-matured" antibody such as an anti- Clq antibody of the present disclosure, is one with one or more alterations in one or more HVRs thereof that result in an improvement in the affinity of the antibody for antigen, compared to a parent antibody that does not possess those alteration(s).
  • an affinity-matured antibody has nanomolar or even picomolar affinities for the target antigen.
  • Affinity-matured antibodies are produced by procedures known in the art. For example, Marks et al., Bio/Technology 10:779-783 (1992) describes affinity maturation by VH- and VL-domain shuffling.
  • Random mutagenesis of HVR and/or framework residues is described by, for example: Barbas et al. Proc Nat. Acad. Sci. USA 91 :3809-3813 (1994); Schier et al. Gene 169: 147- 155 (1995); Yelton et al. J. Immunol. 155: 1994-2004 (1995); Jackson et al, J. Immunol. 154(7):3310-9 (1995); and Hawkins et al, J. Mol. Biol. 226:889-896 (1992).
  • the term “specifically recognizes” or “specifically binds” refers to measurable and reproducible interactions such as attraction or binding between a target and an antibody, such as an anti-Clq antibody of the present disclosure, that is determinative of the presence of the target in the presence of a heterogeneous population of molecules including biological molecules.
  • an antibody, such as an anti-Clq antibody of the present disclosure, that specifically or preferentially binds to a target or an epitope is an antibody that binds this target or epitope with greater affinity, avidity, more readily, and/or with greater duration than it binds to other targets or other epitopes of the target.
  • an antibody (or a moiety) that specifically or preferentially binds to a first target may or may not specifically or preferentially bind to a second target.
  • “specific binding” or “preferential binding” does not necessarily require (although it can include) exclusive binding.
  • An antibody that specifically binds to a target may have an association constant of at least about 10 3 M 1 or 10 4 M 1 , sometimes about 10 5 M 1 or 10 6 M 1 , in other instances about 10 6 M 1 or 10 7 M ⁇ about 10 8 M 1 to 10 9 M _1 , or about 10 10 M 1 to 10 11 M 1 or higher.
  • a variety of immunoassay formats can be used to select antibodies specifically immunoreactive with a particular protein.
  • solid-phase ELISA immunoassays are routinely used to select monoclonal antibodies specifically immunoreactive with a protein. See, e.g., Harlow and Lane (1988) Antibodies, A Laboratory Manual, Cold Spring Harbor Publications, New York, for a description of immunoassay formats and conditions that can be used to determine specific immunoreactivity.
  • an "interaction" between a complement protein, such as complement factor Clq, and a second protein encompasses, without limitation, protein- protein interaction, a physical interaction, a chemical interaction, binding, covalent binding, and ionic binding.
  • an antibody “inhibits interaction” between two proteins when the antibody disrupts, reduces, or completely eliminates an interaction between the two proteins.
  • An antibody of the present disclosure, or fragment thereof, "inhibits interaction” between two proteins when the antibody or fragment thereof binds to one of the two proteins.
  • a “blocking" antibody, an "antagonist” antibody, an “inhibitory” antibody, or a “neutralizing” antibody is an antibody, such as an anti-Clq antibody of the present disclosure that inhibits or reduces one or more biological activities of the antigen it binds, such as interactions with one or more proteins.
  • blocking antibodies, antagonist antibodies, inhibitory antibodies, or “neutralizing” antibodies substantially or completely inhibit one or more biological activities or interactions of the antigen.
  • Antibody effector functions refer to those biological activities attributable to the Fc region (a native sequence Fc region or amino acid sequence variant Fc region) of an antibody, and vary with the antibody isotype.
  • Fc region herein is used to define a C-terminal region of an immunoglobulin heavy chain, including native-sequence Fc regions and variant Fc regions.
  • the boundaries of the Fc region of an immunoglobulin heavy chain might vary, the human IgG heavy-chain Fc region is usually defined to stretch from an amino acid residue at position Cys226, or from Pro230, to the carboxyl-terminus thereof.
  • the C- terminal lysine (residue 447 according to the EU numbering system) of the Fc region may be removed, for example, during production or purification of the antibody, or by recombinantly engineering the nucleic acid encoding a heavy chain of the antibody.
  • composition of intact antibodies may comprise antibody populations with all K447 residues removed, antibody populations with no K447 residues removed, and antibody populations having a mixture of antibodies with and without the K447 residue.
  • Suitable native-sequence Fc regions for use in the antibodies of the present disclosure include human IgGl, IgG2, IgG3 and IgG4.
  • a "native sequence Fc region” comprises an amino acid sequence identical to the amino acid sequence of an Fc region found in nature.
  • Native sequence human Fc regions include a native sequence human IgGl Fc region (non-A and A allotypes); native sequence human IgG2 Fc region; native sequence human IgG3 Fc region; and native sequence human IgG4 Fc region as well as naturally occurring variants thereof.
  • a "variant Fc region” comprises an amino acid sequence which differs from that of a native sequence Fc region by virtue of at least one amino acid modification. In some embodiments, the variant Fc region differs in one or more amino acid substitution(s). In some embodiments, the variant Fc region has at least one amino acid substitution compared to a native sequence Fc region or to the Fc region of a parent polypeptide, e.g. from about one to about ten amino acid substitutions, and, in some embodiments, from about one to about five amino acid substitutions in a native sequence Fc region or in the Fc region of the parent polypeptide.
  • the variant Fc region herein will, in some embodiments, possess at least about 80% homology with a native sequence Fc region and/or with an Fc region of a parent polypeptide, and, in some embodiments, at least about 90% homology therewith, and, in some embodiments, at least about 95% homology therewith.
  • Fc receptor or “FcR” describes a receptor that binds to the Fc region of an antibody.
  • the FcR is a native sequence human FcR.
  • a FcR is one which binds an IgG antibody (a gamma receptor) and includes receptors of the FcyRI, FcyRII, and FcyRIII subclasses, including allelic variants and alternatively spliced forms of these receptors, FcyRII receptors include FcyRIIA (an "activating receptor") and FcyRIIB (an “inhibiting receptor”), which have similar amino acid sequences that differ primarily in the cytoplasmic domains thereof.
  • Activating receptor FcyRIIA contains an immunoreceptor tyrosine-based activation motif ("IT AM”) in its cytoplasmic domain.
  • Inhibiting receptor FcyRIIB contains an immunoreceptor tyrosine- based inhibition motif ("ITIM”) in its cytoplasmic domain (see, e.g., M. Daeron, Annu. Rev. Immunol. 15:203-234 (1997)).
  • ITIM immunoreceptor tyrosine-based inhibition motif
  • FcRs can also increase the serum half-life of antibodies.
  • Binding to FcRn in vivo and serum half- life of human FcRn high-affinity binding polypeptides can be assayed, e.g., in transgenic mice or transfected human cell lines expressing human FcRn, or in primates to which the polypeptides having a variant Fc region are administered.
  • WO 2004/42072 (Presta) describes antibody variants with improved or diminished binding to FcRs. See also, e.g., Shields et al, J. Biol. Chem.
  • k off is intended to refer to the rate constant for dissociation of an antibody from the antibody/antigen complex.
  • K D is intended to refer to the equilibrium dissociation constant of an antibody-antigen interaction.
  • percent (%) amino acid sequence identity and “homology” with respect to a peptide, polypeptide or antibody sequence refers to the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in the specific peptide or polypeptide sequence, after aligning the sequences and
  • an "isolated" molecule or cell is a molecule or a cell that is identified and separated from at least one contaminant molecule or cell with which it is ordinarily associated in the environment in which it was produced.
  • the isolated molecule or cell is free of association with all components associated with the production environment.
  • the isolated molecule or cell is in a form other than in the form or setting in which it is found in nature. Isolated molecules therefore are distinguished from molecules existing naturally in cells; isolated cells are distinguished from cells existing naturally in tissues, organs, or individuals.
  • the isolated molecule is an anti-Clq antibody of the present disclosure.
  • the isolated cell is a host cell or hybridoma cell producing an anti-Clq antibody of the present disclosure.
  • An "isolated" nucleic acid molecule encoding an antibody is a nucleic acid molecule that is identified and separated from at least one contaminant nucleic acid molecule with which it is ordinarily associated in the environment in which it was produced. In some embodiments, the isolated nucleic acid is free of association with all components associated with the production environment.
  • the isolated nucleic acid molecules encoding the polypeptides and antibodies herein is in a form other than in the form or setting in which it is found in nature. Isolated nucleic acid molecules therefore are distinguished from nucleic acid encoding the polypeptides and antibodies herein existing naturally in cells.
  • vector is intended to refer to a nucleic acid molecule capable of transporting another nucleic acid to which it has been linked.
  • plasmid refers to a circular double stranded DNA into which additional DNA segments may be ligated.
  • phage vector refers to a viral vector, wherein additional DNA segments may be ligated into the viral genome.
  • viral vector is capable of autonomous replication in a host cell into which they are introduced (e.g. , bacterial vectors having a bacterial origin of replication and episomal mammalian vectors).
  • vectors e.g., non-episomal mammalian vectors
  • vectors can be integrated into the genome of a host cell upon introduction into the host cell, and thereby are replicated along with the host genome.
  • certain vectors are capable of directing the expression of genes to which they are operatively linked.
  • Such vectors are referred to herein as "recombinant expression vectors," or simply, "expression vectors.”
  • expression vectors of utility in recombinant DNA techniques are often in the form of plasmids.
  • "plasmid” and vector” may be used
  • plasmid is the most commonly used form of vector.
  • Polynucleotide or “nucleic acid” as used interchangeably herein, refer to polymers of nucleotides of any length, and include DNA and RNA.
  • the nucleotides can be deoxyribonucleotides, ribonucleotides, modified nucleotides or bases, and/or their analogs, or any substrate that can be incorporated into a polymer by DNA or RNA polymerase or by a synthetic reaction.
  • a polynucleotide may comprise modified nucleotides, such as methylated nucleotides and their analogs. If present, modification to the nucleotide structure may be imparted before or after assembly of the polymer.
  • sequence of nucleotides may be interrupted by non-nucleotide components.
  • a polynucleotide may comprise modification(s) made after synthesis, such as conjugation to a label.
  • modifications include, for example, "caps,” substitution of one or more of the naturally occurring nucleotides with an analog, internucleotide modifications such as, for example, those with uncharged linkages ⁇ e.g., methyl phosphonates, phosphotriesters,
  • proteins ⁇ e.g., nucleases, toxins, antibodies, signal peptides, ply-L-lysine, etc.
  • intercalators e.g
  • any of the hydroxy 1 groups ordinarily present in the sugars may be replaced, for example, by phosphonate groups, phosphate groups, protected by standard protecting groups, or activated to prepare additional linkages to additional nucleotides, or may be conjugated to solid or semi-solid supports.
  • the 5' and 3' terminal OH can be phosphorylated or substituted with amines or organic capping group moieties of from 1 to 20 carbon atoms.
  • Other hydroxy Is may also be derivatized to standard protecting groups.
  • Polynucleotides can also contain analogous forms of ribose or deoxyribose sugars that are generally known in the art, including, for example, 2'-0-methyl-, 2'-0-allyl-, 2'- fluoro- or 2'-azido-ribose, carbocyclic sugar analogs, a-anomeric sugars, epimeric sugars such as arabinose, xyloses or lyxoses, pyranose sugars, furanose sugars, sedoheptuloses, acyclic analogs, and basic nucleoside analogs such as methyl riboside.
  • One or more phosphodiester linkages may be replaced by alternative linking groups.
  • linking groups include, but are not limited to, embodiments wherein phosphate is replaced by P(0)S ("thioate”), P(S)S ("dithioate”), (0)NR 2 ("amidate”), P(0)R, P(0)OR', CO, or CH 2 (“formacetal”), in which each R or R' is independently H or substituted or
  • unsubstituted alkyl (1-20 C) optionally containing an ether (-0-) linkage, aryl, alkenyl, cycloalkyl, cycloalkenyl or araldyl. Not all linkages in a polynucleotide need be identical. The preceding description applies to all polynucleotides referred to herein, including RNA and DNA.
  • a "host cell” includes an individual cell or cell culture that can be or has been a recipient for vector(s) for incorporation of polynucleotide inserts.
  • Host cells include progeny of a single host cell, and the progeny may not necessarily be completely identical (in morphology or in genomic DNA complement) to the original parent cell due to natural, accidental, or deliberate mutation.
  • a host cell includes cells transfected in vivo with a polynucleotide(s) of this disclosure.
  • Carriers as used herein include pharmaceutically acceptable carriers, excipients, or stabilizers that are nontoxic to the cell or mammal being exposed thereto at the dosages and concentrations employed.
  • physiologically acceptable carrier is an aqueous pH buffered solution.
  • physiologically acceptable carriers include buffers such as phosphate, citrate, and other organic acids; antioxidants including ascorbic acid; low molecular weight (less than about 10 residues) polypeptide; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as
  • polyvinylpyrrolidone amino acids such as glycine, glutamine, asparagine, arginine or lysine; monosaccharides, disaccharides, and other carbohydrates including glucose, mannose, or dextrins; chelating agents such as EDTA; sugar alcohols such as mannitol or sorbitol; salt-forming counterions such as sodium; and/or nonionic surfactants such as TWEENTM, polyethylene glycol (PEG), and PLURONICSTM.
  • amino acids such as glycine, glutamine, asparagine, arginine or lysine
  • monosaccharides, disaccharides, and other carbohydrates including glucose, mannose, or dextrins chelating agents such as EDTA
  • sugar alcohols such as mannitol or sorbitol
  • salt-forming counterions such as sodium
  • nonionic surfactants such as TWEENTM, polyethylene glycol (PEG), and PLURONICSTM.
  • the present disclosure provides humanized anti-Clq antibodies and uses thereof.
  • the humanized anti-Clq antibodies of the present disclosure specifically bind a Clq protein of this disclosure.
  • the humanized anti-Clq antibodies are Clq neutralizing antibodies.
  • the humanized anti-Clq antibodies of this disclosure may bind to CI complex.
  • the present disclosure provides a humanized antibody that specifically binds to a Clq protein, wherein the antibody comprises a heavy chain variable region and a human heavy chain constant region, wherein the heavy chain variable region comprises an Fab region and the heavy chain constant region comprises an Fc region, wherein the Fab region specifically binds to the Clq protein, and wherein the Fc region is incapable of binding the Clq protein.
  • the present disclosure provides a humanized anti-Clq antibody, or an antigen-binding fragment thereof, the antibody comprising a heavy chain variable domain and a light chain variable domain, wherein the heavy chain variable domain comprises an amino acid sequence selected from SEQ ID NOs: 1-4, or an amino acid sequence with at least about 90% homology to the amino acid sequence selected from SEQ ID NOs: 1-4.
  • the present disclosure provides a humanized anti-Clq antibody, or an antigen-binding fragment thereof, the antibody comprising a heavy chain variable domain and a light chain variable domain, wherein the light chain variable domain comprises an amino acid sequence selected from SEQ ID NOs: 5-8, or an amino acid sequence with at least about 90%> homology to the amino acid sequence selected from SEQ ID NOs: 5-8.
  • the present disclosure provides a humanized anti-Clq antibody, or an antigen-binding fragment thereof, the antibody comprising: a heavy chain variable domain comprising an amino acid sequence selected from SEQ ID NOs: 1-4, or an amino acid sequence with at least about 90%> homology to the amino acid sequence selected from SEQ ID NOs: 1-4; and/or a light chain variable domain comprising an amino acid sequence selected from SEQ ID NOs: 5-8, or an amino acid sequence with at least about 90% homology to the amino acid sequence selected from SEQ ID NOs: 5-8.
  • the humanized anti-Clq antibodies of the present disclosure neutralize a biological activity of Clq.
  • Uses for humanized anti-Clq antibodies include, without limitation, the detection of complement factor Clq, e.g., in individuals having a neurodegenerative disorder associated with complement factor 1 (CF Independent pathological synapse loss. Additional non-limiting uses include the inhibition of the classical pathway of complement activation, e.g. , in cases where the classical complement pathway is activated by autoantibodies. Further non- limiting uses for humanized anti-Clq antibodies include the diagnosis and treatment of disorders that are associated with elevated expression of complement factors, such as Clq, or associated with the activation of the complement pathway. Such disorders may include, without limitation, autoimmune disorders, inflammatory disorders, and neurodegenerative disorders, including
  • the present disclosure provides an isolated nucleic acid molecule encoding an antibody of the present disclosure.
  • the present disclosure also provides isolated host cells containing a nucleic acid molecule that encodes an antibody of this disclosure. Additionally, pharmaceutical compositions are provided containing anti-Clq antibodies, such as humanized Clq neutralizing antibodies of this disclosure, in combination with pharmaceutically acceptable carriers. The present disclosure also provides a kit containing a humanized anti-Clq antibody for use in any of the methods described herein.
  • the present disclosure further provides methods of using the humanized anti- Clq antibodies of the present disclosure (e.g., humanized Clq neutralizing antibodies of this disclosure) to treat or prevent a neurodegenerative disease or autoimmune disease in an individual in need of such treatment, to detect synapses in an individual having a neurodegenerative disease or autoimmune disease, and to detect synapses in a biological sample.
  • the present disclosure also provides kits containing humanized anti-Clq antibodies of the present disclosure (e.g., humanized Clq neutralizing antibodies of this disclosure).
  • the antibodies of this disclosure specifically recognize complement factor Clq and/or Clq in the CI complex of the classical complement activation pathway.
  • the recognized complement factor may be derived, without limitation, from any organism having a complement system, including any mammalian organism such as human, mouse, rat, rabbit, monkey, dog, cat, cow, horse, camel, sheep, goat, or pig.
  • C7 complex refers to a protein complex that may include, without limitation, one Clq protein, two Clr proteins, and two Cls proteins ⁇ e.g., ClqrV).
  • complement factor Clq refers to both wild type sequences and naturally occurring variant sequences.
  • a non-limiting example of a complement factor Clq recognized by antibodies of this disclosure is human Clq, including the three polypeptide chains A, B, and C:
  • ATDKNSLLGMEGANSIFSGFLLFPDMEA (SEQ ID NO: 10).
  • GenBank No.: NM 001114101.1 GenBank No.: NM 001114101.1 :
  • a humanized anti-Clq antibody of the present disclosure may bind to polypeptide chain A, polypeptide chain B, and/or polypeptide chain C of a Clq protein.
  • a humanized anti-Clq antibody of the present disclosure binds to polypeptide chain A, polypeptide chain B, and/or polypeptide chain C of human Clq or a homolog thereof, such as mouse, rat, rabbit, monkey, dog, cat, cow, horse, camel, sheep, goat, or pig Clq.
  • Humanized antibodies of the present disclosure specifically bind to a complement factor Clq and/or Clq protein in the CI complex of the classical complement pathway.
  • the humanized anti-Clq antibodies specifically bind to human Clq.
  • the humanized anti-Clq antibodies specifically bind to human and mouse Clq.
  • the humanized anti-Clq antibodies specifically bind to rat Clq.
  • the humanized anti-Clq antibodies specifically bind to human Clq, mouse Clq, and rat Clq.
  • humanized anti-Clq antibodies of the present disclosure include a heavy chain variable region that contains an Fab region and a heavy chain constant regions that contains an Fc region, where the Fab region specifically binds to a Clq protein of the present disclosure, but the Fc region is incapable of binding the Clq protein.
  • the Fc region is from a human IgGl, IgG2, IgG3, or IgG4 isotype.
  • the Fc region is incapable of inducing complement activity and/or incapable of inducing antibody-dependent cellular cytotoxicity (ADCC).
  • the Fc region comprises one or more modifications, including, without limitation, amino acid substitutions.
  • the Fc region of humanized anti-Clq antibodies of the present disclosure comprise an amino acid substitution at position 248 according to Kabat numbering convention or a position corresponding to position 248 according to Kabat numbering convention, and/or at position 241 according to Kabat numbering convention or a position corresponding to position 241 according to Kabat numbering convention.
  • the amino acid substitution at position 248 or a positions corresponding to position 248 inhibits the Fc region from interacting with an Fc receptor.
  • the amino acid substitution at position 248 or a positions corresponding to position 248 is a leucine to glutamate amino acid substitution.
  • the amino acid substitution at position 241 or a positions corresponding to position 241 prevents arm switching in the antibody. In some embodiments, the amino acid substitution at position 241 or a positions corresponding to position 241 is a serine to proline amino acid substitution.
  • the Fc region of humanized anti- Clq antibodies of the present disclosure comprises the amino acid sequence of SEQ ID NO: 37, or an amino acid sequence with at least about 70%, at least about 75%, at least about 80% at least about 85% at least about 90%, or at least about 95% homology to the amino acid sequence of SEQ ID NO: 37.
  • the humanized anti-C lq antibodies of the present disclosure neutralize a biological activity of complement factor Clq. In some embodiments, the humanized anti-C lq antibodies of the present disclosure neutralize a biological activity of complement factor Clq.
  • the antibodies inhibit the interaction between complement factor Clq and other complement factors, such as C lr or Cls or between Clq and an antibody, such as an autoantibody.
  • an autoantibody of the present disclosure includes, without limitation, an antibody that recognizes a host antigen and activates the classical pathway of complement activation.
  • complement factor C lq binds to the autoantibody-autoantigen-immune complex.
  • the antibodies inhibit the interaction between complement factor Clq and a non- complement factor.
  • a non-complement factor may include phosphatidylserine, pentraxin- 3, C-reactive protein (CRP), globular Clq receptor (gCl qR), complement receptor 1 (CRl), ⁇ -amyloid, and calreticulin.
  • the antibodies inhibit the classical complement activation pathway. In certain embodiments, the antibodies further inhibit the alternative pathway. In some embodiments, the antibodies inhibit autoantibody- and complement-dependent cytotoxicity (CDC). In some embodiments, the antibodies inhibit complement-dependent cell-mediated cytotoxicity (CDCC). In some embodiments, the antibodies inhibit B-cell antibody production, dendritic cell maturation, T-cell proliferation, cytokine production, or microglia activation. In some embodiments, the antibodies inhibit the Arthus reaction. In some embodiments, the antibodies inhibit phagocytosis of synapses or nerve endings. In some embodiments, the antibodies inhibit the activation of
  • C3/C3 complement receptor 3
  • the functional properties of the antibodies of the present disclosure may, without limitation, be measured in in vitro, ex vivo, or in vivo experiments.
  • the dissociation constants (K D ) of the humanized anti-Clq antibodies for Clq may be less than 125 nM, less than 120 nM, less than 115 nM, less than 110 nM, less than 100 nM, less than 90 nM, less than 80 nM, less than 70 nM, less than 60 nM, less than 50 nM, less than 40 nM, less than 30 nM, less than 20 nM, less than 10 nM, less than 9 nM, less than 8 nM, less than 7 nM, less than 6 nM, less than 5 nM, less than 4 nM, less than 3 nM, less than 2 nM, less than 1 nM, less than 0.5 nM, less than 0.1 nM, less than 0.05 nM, less than 0.01 nM, or less than 0.005 nM. In some embodiments, dissociation constants range from less than about 125 nM, less than
  • dissociation constants of humanized anti-Clq antibodies of the present disclosure are less than about 10 pM to less than about 5 pM for human Clq. In some embodiments, dissociation constants are less than about 10 pM, less than about 9.9 pm, less than about 9.8 pM, less than about 9.7 pM, less than about 9.6 pM, less than about
  • dissociation constants of humanized anti-Clq antibodies of the present disclosure are less than 125 nM, less than 120 nM, less than 115 nM, less than 110 nM, less than 100 nM, less than 90 nM, less than 80 nM, less than 70 nM, less than 60 nM, less than 50 nM, less than 40 nM, less than 30 nM, less than 20 nM, less than 10 nM, less than 9 nM, less than 8 nM, less than 7 nM, less than 6 nM, less than 5 nM, less than 4 nM, less than 3 nM, less than 2 nM, less than 1 nM, less than 0.5 nM, less than 0.1 nM, or less than 0.05 nM for mouse Clq.
  • Antibody dissociation constants for antigens other than Clq may be least 5-fold, at least 10-fold, at least 100-fold, at least 1,000-fold, at least 10,000-fold, or at least 100,000-fold higher that the dissociation constants for Clq.
  • the dissociation constant of a humanized anti-Clq antibody of the present disclosure may be at least 1,000- fold higher for C Is than for Clq.
  • Dissociation constants may be determined through any analytical technique, including any biochemical or biophysical technique such as ELISA, surface plasmon resonance (SPR), bio-layer interferometry (see, e.g., Octet System by ForteBio), isothermal titration calorimetry (ITC), differential scanning calorimetry (DSC), circular dichroism (CD), stopped-flow analysis, and colorimetric or fluorescent protein melting analyses.
  • Dissociation constants (K D ) of the anti-Clq antibodies for Clq may be determined, e.g., using full-length antibodies or antibody fragments, such as Fab fragments.
  • One exemplary way of determining binding affinity of humanized antibodies to Clq is by measuring binding affinity of mono functional Fab fragments of the antibody.
  • an antibody for example, IgG
  • an antibody can be cleaved with papain or expressed recombinantly.
  • the affinity of an Fab fragment of an antibody can be determined by surface plasmon resonance (Biacore3000TM surface plasmon resonance (SPR) system, Biacore.TM., INC, Piscataway N.J.) equipped with pre-immobilized streptavidin sensor chips (SA) using HBS-EP running buffer (0.01M HEPES, pH 7.4, 0.15 NaCl, 3 mM EDTA, 0.005% v/v Surfactant P20).
  • SPR surface plasmon resonance
  • SA pre-immobilized streptavidin sensor chips
  • Biotinylated human Clq (or any other Clq) can be diluted into HBS-EP buffer to a concentration of less than 0.5 ⁇ g/mL and injected across the individual chip channels using variable contact times, to achieve two ranges of antigen density, either 50-200 response units (RU) for detailed kinetic studies or 800-1,000 RU for screening assays. Regeneration studies have shown that 25 mM NaOH in 25% v/v ethanol effectively removes the bound Fab while keeping the activity of Clq on the chip for over 200 injections. Typically, serial dilutions (spanning concentrations of 0.1 - 10. times, estimated K D ) of purified Fab samples are injected for 1 min at 100 ⁇ / ⁇ and dissociation times of up to 2 hours are allowed.
  • the concentrations of the Fab proteins are determined by ELISA and/or SDS-PAGE electrophoresis using a Fab of known concentration (as determined by amino acid analysis) as a standard.
  • Kinetic association rates (k on ) and dissociation rates (k 0ff ) are obtained simultaneously by fitting the data globally to a 1 : 1 Langmuir binding model (Karlsson, R. Roos, H. Fagerstam, L. Petersson, B. (1994). Methods Enzymology 6. 99-110) using the BIAevaluation program.
  • Equilibrium dissociation constant (K D ) values are calculated as k 0ff /k on .
  • This protocol is suitable for use in determining binding affinity of an antibody to any Clq, including human Clq, Clq of another mammal (such as mouse Clq, rat Clq, primate Clq), as well as different forms of Clq. Binding affinity of an antibody is generally measured at 25°C, but can also be measured at 37°C.
  • the humanized antibodies of the present disclosure may bind to C 1 q antigens derived from any organism having a complement system, including any mammalian organism such as human, mouse, rat, rabbit, monkey, dog, cat, cow, horse, camel, sheep, goat, or pig.
  • the anti-Clq antibodies bind specifically to epitopes on human Clq.
  • the anti-Clq antibodies specifically bind to epitopes on both human and mouse Clq.
  • the anti-Clq antibodies specifically bind to epitopes on human, mouse, and rat Clq.
  • a humanized anti-Clq antibody that binds to an epitope of Clq that is the same as or overlaps with the Clq epitope bound by another antibody of this disclosure.
  • a humanized anti-Clq antibody that binds to an epitope of Clq that is the same as or overlaps with the Clq epitope bound by anti-Clq antibody Ml produced by the hybridoma cell line with ATCC Accession Number PTA-120399.
  • the humanized anti- Clq antibody competes with another antibody of this disclosure for binding to Clq.
  • the anti-Clq antibody competes with anti-Clq antibody Ml produced by the hybridoma cell line with ATCC Accession Number PTA-120399 or anti-Clq binding fragments thereof.
  • Methods that may be used to determine which Clq epitope of a humanized anti- Clq antibody binds to, or whether two antibodies bind to the same or an overlapping epitope may include, without limitation, X-ray crystallography, NMR spectroscopy, Alanine-Scanning Mutagenesis, the screening of peptide libraries that include Clq-derived peptides with overlapping Clq sequences, and competition assays.
  • Competition assays are especially useful to determine whether two antibodies bind the same epitope by recognizing identical or sterically overlapping epitopes or whether one antibody competitively inhibits binding of another antibody to the antigen. These assays are known in the art.
  • an antigen or antigen expressing cells are immobilized on a multi-well plate and the ability of unlabeled antibodies to block the binding of labeled antibodies is measured.
  • Common labels for such competition assays are radioactive labels or enzyme labels.
  • competitive antibodies encompassed herein are humanized antibodies that inhibit (i.e., prevent or interfere with in comparison to a control) or reduce the binding of any anti-Clq antibody of this disclosure (such as Ml or an antigen-binding fragment of Ml) to Clq by at least 50%, 60%, 70%, 80%, 90% and 95% at 1 ⁇ or less.
  • concentration competing antibody in the competition assay may be at or below the K D of antibody Ml or an antigen-binding fragment of Ml .
  • Competition between binding members may be readily assayed in vitro for example using ELISA and/or by monitoring the interaction of the antibodies with Clq in solution. The exact means for conducting the analysis is not critical.
  • Clq may be immobilized to a 96-well plate or may be placed in a homogenous solution.
  • the ability of unlabeled candidate antibody(ies) to block the binding of the labeled anti-Clq antibody, e.g. Ml can be measured using radioactive, enzyme or other labels.
  • the ability of unlabeled antibodies to interfere with the interaction of a labeled anti-Clq antibody with Clq wherein said labeled anti-Clq antibody, e.g., Ml, and Clq are already bound is determined. The readout is through measurement of bound label.
  • Clq and the candidate antibody(ies) may be added in any order or at the same time.
  • the humanized anti-Clq antibody inhibits the interaction between Clq and an autoantibody.
  • a humanized anti-Clq antibody of the present disclosure binds essentially the same Clq epitope as antibody Ml produced by the hybridoma cell line with ATCC Accession Number PTA-120399 or anti-Clq binding fragments thereof.
  • the humanized anti-Clq antibody is an antibody, or an antigen-binding fragment thereof, comprising a heavy chain variable domain comprising an amino acid sequence selected from SEQ ID NOs: 1-4, or an amino acid sequence with at least about 70%, at least about 75%, at least about 80% at least about 85% at least about 90%), or at least about 95% homology to the amino acid sequence selected from SEQ ID NOs: 1-4.
  • the humanized anti-Clq antibody is an antibody, or an antigen-binding fragment thereof, comprising a light chain variable domain comprising an amino acid sequence selected from SEQ ID NOs: 5-8, or an amino acid sequence with at least about 70%, at least about 75%, at least about 80% at least about 85% at least about 90%), or at least about 95% homology to the amino acid sequence selected from SEQ ID NOs: 5-8.
  • the humanized anti-Clq antibody is an antibody, or an antigen-binding fragment thereof, comprising a heavy chain variable domain comprising an amino acid sequence selected from SEQ ID NOs: 1-4, or an amino acid sequence with at least about 70%, at least about 75%, at least about 80% at least about 85% at least about 90%), or at least about 95% homology to the amino acid sequence selected from SEQ ID NOs: 1-4; and/or a light chain variable domain comprising an amino acid sequence selected from SEQ ID NOs: 5-8, or an amino acid sequence with at least about 70%, at least about 75%), at least about 80%> at least about 85% at least about 90%>, or at least about 95% homology to the amino acid sequence selected from SEQ ID NOs: 5-8.
  • the humanized anti-Clq antibody, or an antigen-binding fragment thereof comprises a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 1, or an amino acid sequence with at least about 70%>, at least about 75%, at least about 80% at least about 85% at least about 90%, or at least about 95% homology to the amino acid sequence of SEQ ID NO: 1; and a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 5, or an amino acid sequence with at least about 70%, at least about 75%, at least about 80% at least about 85% at least about 90%), or at least about 95% homology to the amino acid sequence of SEQ ID NO: 5.
  • the humanized anti-Clq antibody, or an antigen-binding fragment thereof comprises a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 1, or an amino acid sequence with at least about 70%, at least about 75%, at least about 80% at least about 85% at least about 90%, or at least about 95% homology to the amino acid sequence of SEQ ID NO: 1; and a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 6, or an amino acid sequence with at least about 70%), at least about 75%, at least about 80% at least about 85% at least about 90%, or at least about 95% homology to the amino acid sequence of SEQ ID NO: 6.
  • the humanized anti-Clq antibody, or an antigen-binding fragment thereof comprises a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 1, or an amino acid sequence with at least about 70%, at least about 75%, at least about 80% at least about 85% at least about 90%, or at least about 95% homology to the amino acid sequence of SEQ ID NO: 1; and a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 7, or an amino acid sequence with at least about 70%, at least about 75%, at least about 80% at least about 85% at least about 90%, or at least about 95%) homology to the amino acid sequence of SEQ ID NO: 7.
  • the humanized anti-Clq antibody, or an antigen-binding fragment thereof comprises a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 1, or an amino acid sequence with at least about 70%, at least about 75%, at least about 80% at least about 85%o at least about 90%>, or at least about 95% homology to the amino acid sequence of SEQ ID NO: 1; and a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 8, or an amino acid sequence with at least about 70%>, at least about 75%, at least about 80% at least about 85% at least about 90%, or at least about 95% homology to the amino acid sequence of SEQ ID NO: 8.
  • the humanized anti-Clq antibody, or an antigen-binding fragment thereof comprises a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 2, or an amino acid sequence with at least about 70%>, at least about 75%, at least about 80% at least about 85% at least about 90%, or at least about 95% homology to the amino acid sequence of SEQ ID NO: 2; and a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 5, or an amino acid sequence with at least about 70%, at least about 75%, at least about 80% at least about 85% at least about 90%), or at least about 95% homology to the amino acid sequence of SEQ ID NO: 5.
  • the humanized anti-Clq antibody, or an antigen-binding fragment thereof comprises a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 2, or an amino acid sequence with at least about 70%, at least about 75%, at least about 80% at least about 85% at least about 90%, or at least about 95% homology to the amino acid sequence of SEQ ID NO: 2; and a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 6, or an amino acid sequence with at least about 70%), at least about 75%, at least about 80% at least about 85% at least about 90%, or at least about 95% homology to the amino acid sequence of SEQ ID NO: 6.
  • the humanized anti-Clq antibody, or an antigen-binding fragment thereof comprises a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 2, or an amino acid sequence with at least about 70%, at least about 75%, at least about 80% at least about 85% at least about 90%, or at least about 95% homology to the amino acid sequence of SEQ ID NO: 2; and a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 7, or an amino acid sequence with at least about 70%, at least about 75%, at least about 80% at least about 85% at least about 90%, or at least about 95%) homology to the amino acid sequence of SEQ ID NO: 7.
  • the humanized anti-Clq antibody, or an antigen-binding fragment thereof comprises a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 2, or an amino acid sequence with at least about 70%, at least about 75%, at least about 80% at least about 85%o at least about 90%>, or at least about 95% homology to the amino acid sequence of SEQ ID NO: 2; and a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 8, or an amino acid sequence with at least about 70%>, at least about 75%, at least about 80% at least about 85% at least about 90%, or at least about 95% homology to the amino acid sequence of SEQ ID NO: 8.
  • the humanized anti-Clq antibody, or an antigen-binding fragment thereof comprises a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 3, or an amino acid sequence with at least about 70%>, at least about 75%, at least about 80% at least about 85% at least about 90%, or at least about 95% homology to the amino acid sequence of SEQ ID NO: 3; and a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 5, or an amino acid sequence with at least about 70%, at least about 75%, at least about 80% at least about 85% at least about 90%), or at least about 95% homology to the amino acid sequence of SEQ ID NO: 5.
  • the humanized anti-Clq antibody, or an antigen-binding fragment thereof comprises a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 3, or an amino acid sequence with at least about 70%>, at least about 75%, at least about 80% at least about 85% at least about 90%, or at least about 95% homology to the amino acid sequence of SEQ ID NO: 3; and a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 6, or an amino acid sequence with at least about 70%), at least about 75%, at least about 80% at least about 85% at least about 90%, or at least about 95% homology to the amino acid sequence of SEQ ID NO: 6.
  • the humanized anti-Clq antibody, or an antigen-binding fragment thereof comprises a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 3, or an amino acid sequence with at least about 70%, at least about 75%, at least about 80% at least about 85% at least about 90%, or at least about 95% homology to the amino acid sequence of SEQ ID NO: 3; and a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 7, or an amino acid sequence with at least about 70%, at least about 75%, at least about 80% at least about 85% at least about 90%, or at least about 95%) homology to the amino acid sequence of SEQ ID NO: 7.
  • the humanized anti-Clq antibody, or an antigen-binding fragment thereof comprises a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 3, or an amino acid sequence with at least about 70%, at least about 75%, at least about 80% at least about 85%o at least about 90%>, or at least about 95% homology to the amino acid sequence of SEQ ID NO: 3; and a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 8, or an amino acid sequence with at least about 70%>, at least about 75%, at least about 80% at least about 85% at least about 90%, or at least about 95% homology to the amino acid sequence of SEQ ID NO: 8.
  • the humanized anti-C lq antibody, or an antigen-binding fragment thereof comprises a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 4, or an amino acid sequence with at least about 70%>, at least about 75%, at least about 80% at least about 85% at least about 90%, or at least about 95% homology to the amino acid sequence of SEQ ID NO: 4; and a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 5, or an amino acid sequence with at least about 70%, at least about 75%, at least about 80% at least about 85% at least about 90%), or at least about 95% homology to the amino acid sequence of SEQ ID NO: 5.
  • the humanized anti-Clq antibody, or an antigen-binding fragment thereof comprises a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 4, or an amino acid sequence with at least about 70%>, at least about 75%, at least about 80% at least about 85% at least about 90%, or at least about 95% homology to the amino acid sequence of SEQ ID NO: 4; and a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 6, or an amino acid sequence with at least about 70%), at least about 75%, at least about 80% at least about 85% at least about 90%, or at least about 95% homology to the amino acid sequence of SEQ ID NO: 6.
  • the humanized anti-C lq antibody, or an antigen-binding fragment thereof comprises a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 4, or an amino acid sequence with at least about 70%, at least about 75%, at least about 80% at least about 85% at least about 90%, or at least about 95% homology to the amino acid sequence of SEQ ID NO: 4; and a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 7, or an amino acid sequence with at least about 70%, at least about 75%, at least about 80% at least about 85% at least about 90%, or at least about 95% homology to the amino acid sequence of SEQ ID NO: 7.
  • the humanized anti-C lq antibody, or an antigen-binding fragment thereof comprises a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 4, or an amino acid sequence with at least about 70%, at least about 75%, at least about 80% at least about 85% at least about 90%, or at least about 95% homology to the amino acid sequence of SEQ ID NO: 4; and a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 8, or an amino acid sequence with at least about 70%, at least about 75%, at least about 80% at least about 85% at least about 90%, or at least about 95%homology to the amino acid sequence of SEQ ID NO: 8.
  • humanized anti-Clq antibodies of the present disclosure may comprise at least one HVR selected from HVR-Ll, HVR-L2, and HVR-L3 of the light chain variable domains of monoclonal antibody Ml produced by the hybridoma cell line having ATCC Accession Number PTA-120399, or progeny thereof.
  • humanized anti-Clq antibodies of the present disclosure may comprise at least one HVR selected from HVR-H1, HVR-H2, and HVR-H3 of the heavy chain variable domains of monoclonal antibody Ml produced by the hybridoma cell line having ATCC Accession Number PTA-120399, or progeny thereof.
  • humanized anti-Clq antibodies of the present disclosure may comprise at least one HVR selected from HVR-Ll, HVR-L2, and HVR-L3 of the light chain variable domains and at least one HVR selected from HVR-H1, HVR-H2, and HVR-H3 of the heavy chain variable domains of monoclonal antibody Ml produced by the hybridoma cell line having ATCC Accession Number PTA- 120399, or progeny thereof.
  • humanized anti-Clq antibodies of the present disclosure may bind to a Clq protein and binds to one or more amino acids of the Clq protein within amino acid residues selected from (a) amino acid residues 196-226 of SEQ ID NO: 9 (SEQ ID NO: 12), or amino acid residues of a Clq protein chain A (ClqA) corresponding to amino acid residues 196-226 (GLFQVVSGGMVLQLQQGDQVWVEKDPK GHI) of SEQ ID NO: 9 (SEQ ID NO: 12); (b) amino acid residues 196-221 of SEQ ID NO: 9 (SEQ ID NO: 13), or amino acid residues of a ClqA corresponding to amino acid residues 196- 221 (GLFQVVSGGMVLQLQQGDQVWVEKDP) of SEQ ID. NO: 9 (SEQ ID NO: 13); (c) amino acid residues 202-221 of SEQ ID NO: 9 (SEQ ID NO: 14),
  • the humanized anti-Clq antibodies may further binds to one or more amino acids of the Clq protein within amino acid residues selected from: (a) amino acid residues 218-240 of SEQ ID NO: 11 (SEQ ID NO: 16) or amino acid residues of a Clq protein chain C (ClqC) corresponding to amino acid residues 218-240
  • humanized anti-Clq antibodies of the present disclosure may bind to amino acid residue Lys 219 and Ser 202 of the human ClqA as shown in SEQ ID NO: 9 or amino acids of a human ClqA corresponding to Lys 219 and Ser 202 as shown in SEQ ID NO: 9, and amino acid residue Tyr 225 of the human ClqC as shown in SEQ ID NO: 11 or an amino acid residue of a human ClqC corresponding to Tyr 225 as shown in SEQ ID NO: 11.
  • the anti-Clq antibody binds to amino acid residue Lys 219 of the human ClqA as shown in SEQ ID NO: 9 or an amino acid residue of a human ClqA corresponding to Lys 219 as shown in SEQ ID NO: 9, and amino acid residue Ser 185 of the human ClqC as shown in SEQ ID NO: 11 or an amino acid residue of a human ClqC corresponding to Ser 185 as shown in SEQ ID NO: 11.
  • humanized anti-Clq antibodies of the present disclosure may bind to a Clq protein and binds to one or more amino acids of the Clq protein within amino acid residues selected from: (a) amino acid residues 218-240 of SEQ ID NO: 11 (SEQ ID NO: 16) or amino acid residues of a ClqC corresponding to amino acid residues 218-240 (WLAVNDYYDMVGI QGSDSVFSGF) of SEQ ID NO: 11 (SEQ ID NO: 16); (b) amino acid residues 225-240 of SEQ ID NO: 11 (SEQ ID NO: 17) or amino acid residues of a ClqC corresponding to amino acid residues 225-240 (YDMVGI QGSDSVFSGF) of SEQ ID NO: 11 (SEQ ID NO: 17); (c) amino acid residues 225-232 of SEQ ID NO: 11 (SEQ ID NO: 18) or amino acid residues of a ClqC corresponding to amino acid residues 225-232
  • a humanized anti-Clq antibody of the present disclosure inhibits the interaction between Clq and Cls.
  • the humanized anti- Clq antibody inhibits the interaction between Clq and Clr.
  • the humanized anti-Clq antibody inhibits the interaction between Clq and Cls and between Clq and Clr.
  • the humanized anti-Clq antibody inhibits the interaction between Clq and another antibody, such as an autoantibody.
  • the humanized anti-Clq antibody inhibits the respective interactions, at a stoichiometry of less than 2.5 : 1 ; 2.0: 1 ; 1.5 : 1 ; or 1.0: 1.
  • the humanized Clq antibody inhibits an interaction, such as the Clq-Cls interaction, at approximately equimolar concentrations of Clq and the anti-Clq antibody.
  • the anti-Clq antibody binds to Clq with a stoichiometry of less than 20: 1; less than 19.5: 1; less thanl9: l; less than 18.5: 1; less than 18: 1; less than 17.5: 1; less than 17: 1; less than 16.5:1 ; less than 16: 1; less than 15.5: 1; less than 15: 1; less than 14.5: 1; less than 14: 1; less than 13.5: 1; less than 13: 1; less than 12.5: 1; less than 12: 1; less than 11.5: 1; less than 11 : 1; less than 10.5: 1; less than 10: 1; less than 9.5: 1; less than 9: 1; less than 8.5: 1; less than 8: 1; less than 7.5: 1; less than 7: 1
  • the humanized anti-Clq antibody binds Clq with a binding stoichiometry that ranges from 20: 1 to 1.0: 1 or less thanl .0: 1. In certain embodiments, the humanized anti-Clq antibody binds Clq with a binding stoichiometry that ranges from 6: 1 to 1.0: 1 or less thanl .0: 1. In certain
  • the humanized anti-Clq antibody binds Clq with a binding stoichiometry that ranges from 2.5: 1 to 1.0: 1 or less thanl .0: 1.
  • an anti-Clq antibody of the present disclosure having a binding stoichiometry for Clq of 1.0: 1 yeilds approximately 50% inhibition of C1F hemolysis, as deptermined for example by CH50 assays of the present disclosure.
  • the humanized anti-Clq antibody inhibits the interaction between Clq and Clr, or between Clq and Cls, or between Clq and both Clr and Cls.
  • the humanized anti-Clq antibody inhibits the interaction between Clq and Clr, between Clq and Cls, and/or between Clq and both Clr and Cls. In some embodiments, the humanized anti-Clq antibody binds to the Clq A- chain. In other embodiments, the humanized anti-Clq antibody binds to the Clq B-chain. In other embodiments, the humanized anti-Clq antibody binds to the Clq C-chain. In some embodiments, the humanized anti-Clq antibody binds to the Clq A-chain, the Clq B-chain and/or the Clq C-chain.
  • the humanized anti-Clq antibody binds to the globular domain of the Clq A-chain, B-chain, and/or C-chain. In other embodiments, the humanized anti-Clq antibody binds to the collagen-like domain of the Clq A-chain, the Clq B-chain, and/or the Clq C-chain.
  • humanized antibodies of this disclosure inhibit the interaction between two or more complement factors, such as the interaction of Clq and Cls, or the interaction between Clq and Clr
  • the interaction occurring in the presence of the antibody may be reduced by at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, or at least 99% relative to a control wherein the antibodies of this disclosure are absent.
  • the interaction occurring in the presence of the humanized antibody is reduced by an amount that ranges from at least 30% to at least 99% relative to a control wherein the humanized antibodies of this disclosure are absent.
  • humanized anti-Clq antibodies of the present disclosure inhibit C4-cleavage by at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, or at least 99%, or by an amount that ranges from at least 30% to at least 99%, relative to a control wherein the antibodies of this disclosure are absent.
  • Methods for measuring C4-cleavage are well known in the art.
  • the EC50 values for antibodies of this disclosure with respect C4-cleavage may be less than 3 ⁇ g/ml; 2.5 ⁇ g/ml; 2.0 ⁇ g/ml; 1.5 ⁇ g/ml; 1.0 ⁇ g/ml; 0.5 ⁇ g/ml; 0.25 ⁇ g/ml; 0.1 ⁇ g/ml; 0.05 ⁇ g/ml.
  • the antibodies of this disclosure inhibit C4-cleavage at approximately equimolar concentrations of Clq and the respective anti-Clq antibody.
  • humanized anti-Clq antibodies of the present disclosure inhibit autoantibody-dependent and complement-dependent cytotoxicity (CDC) by at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, or at least 99%, or by an amount that ranges from at least 30% to at least 99%, relative to a control wherein the antibodies of this disclosure are absent.
  • CDC complement-dependent cytotoxicity
  • the EC50 values for antibodies of this disclosure with respect to inhibition of autoantibody- dependent and complement-dependent cytotoxicity may be less than 3 ⁇ g/ml; 2.5 ⁇ g/ml; 2.0 ⁇ g/ml; 1.5 ⁇ g/ml; 1.0 ⁇ g/ml; 0.5 ⁇ g/ml; 0.25 ⁇ g/ml; 0.1 ⁇ g/ml; 0.05 ⁇ g/ml.
  • humanized anti-Clq antibodies of the present disclosure inhibit complement-dependent cell-mediated cytotoxicity (CDCC) by at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, or at least 99%, or by an amount that ranges from at least 30% to at least 99%, relative to a control wherein the antibodies of this disclosure are absent.
  • CDCC complement-dependent cell-mediated cytotoxicity
  • the EC50 values for antibodies of this disclosure with respect CDCC inhibition may be 1 less than 3 ⁇ g/ml; 2.5 ⁇ g/ml; 2.0 ⁇ g/ml; 1.5 ⁇ g/ml; 1.0 ⁇ g/ml; 0.5 ⁇ g/ml; 0.25 ⁇ g/ml; 0.1 ⁇ g/ml; 0.05 ⁇ g/ml.
  • the antibodies of this disclosure inhibit CDCC but not antibody-dependent cellular cytotoxicity (ADCC).
  • ADCC antibody-dependent cellular cytotoxicity
  • humanized anti-Clq antibodies of the present disclosure inhibit C1F hemolysis (also referred to as CH50 hemolysis) by at least 20%>, at least 30%>, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, or at least 99%, or by an amount that ranges from at least 30% to at least 99%,relative to a control wherein the antibodies of this disclosure are absent or wherein control antibodies are used that do not bind to a complement factor or another antibody such as an autoantibody (see, e.g., Examples section below).
  • Methods for measuring CIF hemolysis are well known in the art (see, e.g., Examples section below).
  • the EC 50 values for humanized antibodies of this disclosure with respect to CIF hemolysis may be less than 3 ⁇ g/ml; 2.5 ⁇ g/ml; 2.0 ⁇ g/ml; 1.5 ⁇ g/ml; 1.0 ⁇ g/ml; 0.5 ⁇ g/ml; 0.25 ⁇ g/ml; 0.1 ⁇ g/ml; 0.05 ⁇ g/ml.
  • humanized anti-Clq antibodies of this disclosure neutralize at least 50% of CIF hemolysis at a dose of less than 200 ng/ml, less thanlOO ng/ml, less than 50 ng/ml, or less than 20 ng/ml.
  • humanized antibodies of this disclosure neutralize CIF hemolysis at approximately equimolar concentrations of Clq and the anti-Clq antibody. In some embodiments, humanized anti-Clq antibodies of this disclosure neutralize hemolysis in a human CIF hemolysis assay. In some embodiments, humanized anti-Clq antibodies of this disclosure neutralize hemolysis in a human and rat CIF hemolysis assay (see, e.g., see, e.g., Examples section below).
  • the alternative pathway may amplify CDC initiated by Clq binding and subsequent Cls activation; in at least some of these embodiments, the antibodies of this disclosure inhibit the alternative pathway by at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, or at least 99%, or by an amount that ranges from at least 30% to at least 99%, relative to a control wherein the antibodies of this disclosure were absent.
  • humanized anti-Clq antibodies of the present disclosure prevent synaptic loss in a cellular in vitro model or an in vivo model of synaptic loss, such as an in vivo mouse model.
  • In vivo mouse models may include Tg2576, a mouse amyloid precursor protein (APP) transgenic model of Alzheimer's disease, R6/2 NT-CAG150, a transgenic model for Huntington's disease, or SMAA7, a mouse model for Spinal Muscular Atrophy, or DBA/2J, a genetic mouse model of glaucoma.
  • APP mouse amyloid precursor protein
  • neurodegenerative disease model may be used that displays synapse loss.
  • In vitro lesion formation may be reduced by at least 30%, at least 40%, at least 50%, at least 60%), at least 70%>, at least 80%>, at least 90%>, or at least 95%>, or by an amount that ranges from at least 30% to at least 95%, relative to a control experiment in which antibodies of this disclosure are absent.
  • the EC 50 values for antibodies of this disclosure with respect to the prevention of in vitro lesion formation may be less than 3 ⁇ g/ml; 2.5 ⁇ g/ml; 2.0 ⁇ g/ml; 1.5 ⁇ g/ml; 1.0 ⁇ g/ml; 0.5 ⁇ g/ml; 0.25 ⁇ g/ml; 0.1 ⁇ g/ml; 0.05 ⁇ g/ml.
  • In vivo synaptic loss may be reduced by at least 5%>, at least 10%>, at least 15%>, at least 20%>, at least 35%, at least 40%, or at least 50%, or by an amount that ranges from at least 5% to at least 50%, relative to a control experiment in which antibodies of this disclosure are absent.
  • humanized anti-Clq antibodies of the present disclosure prevent lesion formation in an ex vivo spinal cord slice model of NMO or in an in vivo mouse model of NMO.
  • Methods for measuring lesion formation ex vivo or in vivo are well known in the art.
  • Ex vivo lesion formation may be reduced at least by a relative score of 0.5, 1.0, 1.5, 2.0, 2.5, 3.0, 3.5, or 4.0.
  • the EC 50 values for antibodies of this disclosure with respect to the prevention of ex vivo lesion formation may be less than 3 ⁇ g/ml; less than 2.5 ⁇ g/ml; less than 2.0 ⁇ g/ml; less than 1.5 ⁇ g/ml; less than 1.0 ⁇ g/ml; less than 0.5 ⁇ g/ml; less than 0.25 ⁇ g/ml; less than 0.1 ⁇ g/ml; or less than 0.05 ⁇ g/ml.
  • In vivo lesion formation may be reduced by at least 5%, at least 10%>, at least 15%, at least 20%, at least 35%, at least 40%, or at least 50%, or by an amount that ranges from at least 5% to at least 50%, in terms of loss of staining (% of area). Staining may be assessed, without limitation, by APQ4 staining, GFAP staining, or MBP staining.
  • the present disclosure provides humanized anti-Clq antibodies.
  • the humanized antibodies of the present disclosure may have one or more of the following characteristics.
  • the antibodies of this disclosure may be polyclonal antibodies, monoclonal antibodies, chimeric antibodies, human antibodies, antibody fragments, bispecific and polyspecific antibodies, multivalent antibodies, or heteroconjugate antibodies.
  • Antibody fragments of this disclosure may be functional fragments that bind the same epitope as any of the humanized anti-Clq antibodies of this disclosure. In some embodiments, the antibody fragments of this disclosure specifically bind to and neutralize a biological activity of Clq.
  • the antibody fragments are miniaturized versions of the humanized anti-Clq antibodies or antibody fragments of this disclosure that have the same epitope of the corresponding full-length antibody, but have much smaller molecule weight.
  • Such miniaturized anti-Clq antibody fragments may have better brain penetration ability and a shorter half-life, which is advantageous for imaging and diagnostic utilities ⁇ see e.g., Lutje S et al, Bioconjug Chem. 2014 Feb 19;25(2):335-41; Tavare R et al, Proc Natl Acad Sci USA. 2014 Jan 21;111(3): 1108-13; and Wiehr S et al, Prostate. 2014 May;74(7):743- 55).
  • humanized anti-Clq antibody fragments of this disclosure have better brain penetration as compared to their corresponding full-length antibodies and/or have a shorter half-life as compared to their corresponding full-length antibodies.
  • humanized anti-Clq antibodies of the present disclosure are bispecific antibodies recognizing a first antigen and a second antigen.
  • the first antigen is a Clq antigen.
  • the second antigen is an antigen facilitating transport across the blood-brain-barrier, including without limitation, transferrin receptor (TR), insulin receptor (HIR), insulin-like growth factor receptor (IGFR), low-density lipoprotein receptor related proteins 1 and 2 (LPR-1 and 2), diphtheria toxin receptor, CRM197, a llama single domain antibody, TMEM 30(A), a protein transduction domain, TAT, Syn-B, penetratin, a poly-arginine peptide, an angiopep peptide, and ANG 1005.
  • TR transferrin receptor
  • HIR insulin receptor
  • IGFR insulin-like growth factor receptor
  • LPR-1 and 2 low-density lipoprotein receptor related proteins 1 and 2
  • CRM197 a llama single domain antibody
  • TMEM 30(A) a protein transduction domain
  • TAT Syn-B
  • penetratin a poly-arginine peptide
  • an angiopep peptide an angiopep
  • Humanized anti-Clq antibodies of the present disclosure may further contain engineered effector functions, amino acid sequence modifications or other antibody modifications known in the art; e.g., the constant region of the anti-Clq antibodies described herein may be modified to impair complement activation.
  • the Fc region of human IgGl, IgG2, and IgG3 unlike the Fc region of human IgG4 does not bind to Clq. Accordingly, in some
  • humanized anti-Clq antibodies of this disclosure may further comprise the Fc region of human IgG4.
  • humanized anti-Clq antibodies of this disclosure comprise one or more amino acid substitutions within the Fc region that, for example, prevent arm switching and/or reduces or otherwise inhibits the ability of Fc region from interacting with Fc receptors expressed on cells (see e.g., Angal S et al, Mol
  • humanized anti-Clq antibodies of this disclosure comprise an Fc region that comprises an amino acid substitution at position 241 or 248 according to Kabat numbering convention.
  • the Fc region comprises a serine to proline amino acid substitution at position 241 that prevent arm switching.
  • the Fc region comprises a serine to proline amino acid substitution at position 241 according to Kabat numbering convention.
  • the Fc region comprises a serine to proline amino acid substitution at position 248 that reduces or otherwise inhibits the ability of Fc region from interacting with an Fc receptor.
  • the Fc region comprises a leucine to glutamate amino acid substitution at position 248 according to Kabat numbering convention.
  • humanized anti-Clq antibodies of this disclosure comprise an Fc region comprising the amino acid sequence of SEQ ID NO: 37.
  • Additional humanized anti-Clq antibodies e.g., humanized antibodies that specifically bind to a Clq protein of the present disclosure, may be identified, screened, and/or characterized for their physical/chemical properties and/or biological activities by various assays known in the art.
  • Anti-Clq antibodies of the present disclosure may be produced using any methods described herein or known in the art.
  • Monoclonal antibodies ⁇ e.g., humanized antibodies) of the of the present disclosure can be produced using a variety of known techniques, such as the standard somatic cell hybridization technique described by Kohler and Milstein, Nature 256: 495 (1975). Although somatic cell hybridization procedures are preferred, in principle, other techniques for producing monoclonal antibodies also can be employed, e.g., viral or oncogenic transformation of B lymphocytes and phage display technique using libraries of human antibody genes.
  • hybridomas which produce monoclonal antibodies of the present disclosure is the murine system.
  • Hybridoma production in the mouse is well- known in the art, including immunization protocols and techniques for isolating and fusing immunized splenocytes.
  • Polyclonal antibodies can be prepared by immunizing a suitable subject with a polypeptide immunogen.
  • the polypeptide antibody titer in the immunized subject can be monitored over time by standard techniques, such as with an enzyme linked immunosorbent assay (ELISA) using immobilized polypeptide.
  • ELISA enzyme linked immunosorbent assay
  • the antibody directed against the antigen can be isolated from the mammal ⁇ e.g. , from the blood) and further purified by well-known techniques, such as protein A chromatography to obtain the IgG fraction.
  • protein A chromatography to obtain the IgG fraction.
  • antibody- producing cells when the antibody titers are highest, antibody- producing cells can be obtained from the subject and used to prepare monoclonal antibodies by standard techniques, such as the hybridoma technique originally described by Kohler and Milstein (1975) Nature 256:495-497) (see also Brown et al. (1981) J. Immunol.
  • an immortal cell line typically a myeloma
  • lymphocytes typically splenocytes
  • the culture supernatants of the resulting hybridoma cells are screened to identify a hybridoma producing a monoclonal antibody that binds to the polypeptide antigen, preferably specifically.
  • any of the many well-known protocols used for fusing lymphocytes and immortalized cell lines can be applied for the purpose of generating an anti-PD-1, PD-L1, or PD-L2_monoclonal antibody (see, e.g., Galfre, G. et al. (1977) Nature 266:55052; Gefter et al. (1977) supra; Lerner (1981) supra; Kenneth (1980) supra).
  • the immortal cell line ⁇ e.g., a myeloma cell line
  • the immortal cell line is derived from the same mammalian species as the lymphocytes.
  • murine hybridomas can be made by fusing lymphocytes from a mouse immunized with an immunogenic preparation of the present disclosure with an immortalized mouse cell line.
  • Preferred immortal cell lines are mouse myeloma cell lines that are sensitive to culture medium containing hypoxanthine, aminopterin and thymidine ("HAT medium").
  • HAT medium culture medium containing hypoxanthine, aminopterin and thymidine
  • Any of a number of myeloma cell lines can be used as a fusion partner according to standard techniques, e.g., the P3-NSl/l-Ag4-l, P3-x63-Ag8.653 or Sp2/0-Agl4 myeloma lines. These myeloma lines are available from the American Type Culture Collection (ATCC), Rockville, Md.
  • ATCC American Type Culture Collection
  • HAT-sensitive mouse myeloma cells are fused to mouse splenocytes using polyethylene glycol ("PEG").
  • PEG polyethylene glycol
  • Hybridoma cells resulting from the fusion are then selected using HAT medium, which kills unfused and unproductively fused myeloma cells (unfused splenocytes die after several days because they are not transformed).
  • Hybridoma cells producing a monoclonal antibody of the present disclosure are detected by screening the hybridoma culture supernatants for antibodies that bind a given polypeptide, e.g., using a standard ELISA assay.
  • a monoclonal specific for a desired polypeptide ⁇ e.g., Clq can be identified and isolated by screening a recombinant combinatorial immunoglobulin library ⁇ e.g. , an antibody phage display library) with the appropriate polypeptide to thereby isolate immunoglobulin library members that bind the polypeptide.
  • Kits for generating and screening phage display libraries are commercially available (e.g., the Pharmacia Recombinant Phage Antibody System, Catalog No. 27-9400-01; and the Stratagene SurfZAPTM Phage Display Kit, Catalog No. 240612).
  • examples of methods and reagents particularly amenable for use in generating and screening an antibody display library can be found in, for example, Ladner et al. U.S. Patent No. 5,223,409; Kang et al. International Publication No. WO 92/18619; Dower et al. International Publication No. WO 91/17271; Winter et al. International Publication WO 92/20791; Markland et al. International Publication No. WO 92/15679; Breitling et al. International Publication WO 93/01288; McCafferty et al.
  • recombinant anti-Clq antibodies such as humanized and chimeric monoclonal antibodies, which can be made using standard recombinant DNA techniques, can be generated.
  • humanized and chimeric monoclonal antibodies can be produced by recombinant DNA techniques known in the art, for example using methods described in Robinson et al. International Patent Publication PCT/US86/02269; Akira et al. European Patent Application 184,187; Taniguchi, M. European Patent Application 171,496; Morrison et al. European Patent Application 173,494; Neuberger et al. PCT Application WO
  • antibody chains or specific binding pair members can be produced by recombination between vectors comprising nucleic acid molecules encoding a fusion of a polypeptide chain of a specific binding pair member and a component of a replicable generic display package and vectors containing nucleic acid molecules encoding a second polypeptide chain of a single binding pair member using techniques known in the art, e.g., as described in US patents 5,565,332, 5,871,907, or 5,733,743.
  • the use of intracellular antibodies to inhibit protein function in a cell is also known in the art (see e.g., Carlson, J. R. (1988) Mol. Cell. Biol. 8:2638-2646; Biocca, S. et al. (1990) EMBO J. 9: 101-108; Werge, T. M. et al. (1990) FEB S Lett.
  • human monoclonal anti-Clq antibodies can be generated using transgenic or transchromosomal mice carrying parts of the human immune system rather than the mouse system.
  • transgenic mice referred to herein as "HuMAb mice” which contain a human immunoglobulin gene miniloci that encodes unrearranged human heavy ( ⁇ and ⁇ ) and ⁇ light chain immunoglobulin sequences, together with targeted mutations that inactivate the endogenous ⁇ and ⁇ chain loci (Lonberg, N. et al. (1994) Nature 368(6474): 856 859).
  • mice exhibit reduced expression of mouse IgM or ⁇ , and in response to immunization, the introduced human heavy and light chain transgenes undergo class switching and somatic mutation to generate high affinity human IgGK monoclonal antibodies (Lonberg, N. et al. (1994), supra; reviewed in Lonberg, N. (1994) Handbook of Experimental Pharmacology 113:49 101; Lonberg, N. and Huszar, D. (1995) Intern. Rev. Immunol. Vol. 13: 65 93, and Harding, F. and Lonberg, N. (1995) Ann. N. Y Acad. Sci 764:536 546).
  • the preparation of HuMAb mice is described in Taylor, L. et al.
  • Yet another aspect of the present disclosure relates to anti-Clq antibodies that are obtainable by a process comprising, immunizing an animal with an immunogenic Clq polypeptide, respectively, or an immunogenic portion thereof; and then isolating from the animal antibodies that specifically bind to the polypeptide.
  • partial or known antibody sequences can be used to generate and/or express new antibodies.
  • Antibodies interact with target antigens predominantly through amino acid residues that are located in the six heavy and light chain complementarity determining regions (CDRs). For this reason, the amino acid sequences within CDRs are more diverse between individual antibodies than sequences outside of CDRs. Because CDR sequences are responsible for most antibody- antigen interactions, it is possible to express recombinant antibodies that mimic the properties of specific naturally occurring antibodies by constructing expression vectors that include CDR sequences from the specific naturally occurring antibody grafted onto framework sequences from a different antibody with different properties (see, e.g. ,
  • Such framework sequences can be obtained from public DNA databases that include germline or non-germline antibody gene sequences. These germline sequences will differ from mature antibody gene sequences because they will not include completely assembled variable genes, which are formed by V(D)J joining during B cell maturation. Germline gene sequences will also differ from the sequences of a high affinity secondary repertoire antibody at individual evenly across the variable region.
  • somatic mutations are relatively infrequent in the amino-terminal portion of framework region.
  • somatic mutations are relatively infrequent in the amino terminal portion of framework region 1 and in the carboxy-terminal portion of framework region 4.
  • many somatic mutations do not significantly alter the binding properties of the antibody. For this reason, it is not necessary to obtain the entire DNA sequence of a particular antibody in order to recreate an intact recombinant antibody having binding properties similar to those of the original antibody (see PCT/US99/05535 filed on Mar. 12, 1999). Partial heavy and light chain sequence spanning the CDR regions is typically sufficient for this purpose. The partial sequence is used to determine which germline and/or non-germline variable and joining gene segments contributed to the recombined antibody variable genes.
  • variable regions Heavy and light chain leader sequences are cleaved during protein maturation and do not contribute to the properties of the final antibody.
  • cloned cDNA sequences can be combined with synthetic oligonucleotides by ligation or PCR amplification.
  • the entire variable region can be synthesized as a set of short, overlapping, oligonucleotides and combined by PCR amplification to create an entirely synthetic variable region clone. This process has certain advantages such as elimination or inclusion or particular restriction sites, or optimization of particular codons.
  • the process can also be used to screen libraries of particular immunoglobulin encoding sequences in one species (e.g., human) to design cognate immunoglobulin encoding sequences from known antibody sequence in another species (e.g., mouse) (see, for example, the Examples section below).
  • one species e.g., human
  • another species e.g., mouse
  • the nucleotide sequences of heavy and light chain transcripts from a hybridoma may be used to design an overlapping set of synthetic oligonucleotides to create synthetic V sequences with identical amino acid coding capacities as the natural sequences.
  • the synthetic heavy and kappa chain sequences can differ from the natural sequences in three ways: strings of repeated nucleotide bases are interrupted to facilitate oligonucleotide synthesis and PCR amplification; optimal translation initiation sites are incorporated according to Kozak's rules (Kozak, 1991 , J. Biol. Chem. 266L 19867019870); and, Hindlll sites are engineered upstream of the translation initiation sites.
  • the optimized coding, and corresponding non-coding, strand sequences are broken down into 30-50 nucleotide approximately the midpoint of the corresponding non-coding oligonucleotide.
  • the oligonucleotides can be assembled into overlapping double stranded sets that span segments of 150-400 nucleotides. The pools are then used as templates to produce PCR amplification products of 150-400 nucleotides.
  • a single variable region oligonucleotide set will be broken down into two pools which are separately amplified to generate two overlapping PCR products. These overlapping products are then combined by PCR amplification to form the complete variable region. It may also be desirable to include an overlapping fragment of the heavy or light chain constant region in the PCR amplification to generate fragments that can easily be cloned into the expression vector constructs.
  • the reconstructed heavy and light chain variable regions are then combined with cloned promoter, leader sequence, translation initiation, leader sequence, constant region, 3 ' untranslated, polyadenylation, and transcription termination, sequences to form expression vector constructs.
  • the heavy and light chain expression constructs can be combined into a single vector, co-transfected, serially transfected, or separately transfected into host cells which are then fused to form a host cell expressing both chains.
  • Plasmids for this use are known in the art and include the plasmids provided in the Examples section below.
  • Fully human and chimeric antibodies of the present disclosure also include IgGl , IgG2, IgG3, IgG4, IgE, IgA, IgM, and IgD antibodies, and variants and mutants thereof.
  • Similar plasmids can be constructed for expression of other heavy chain isotypes, or for expression of antibodies comprising lambda light chains.
  • the structural features of known, non-human or human antibodies are used to create structurally related human anti-human Clq antibodies that retain at least one functional property of the antibodies of the present disclosure, such as binding to a C lq protein.
  • Another functional property includes inhibiting binding of the monoclonal antibody Ml to C lq in a competition ELISA assay.
  • the structurally related anti-human Clq antibodies have a comparable binding affinity to the antigen as compared to the monoclonal antibody Ml as measured by the IC 50 value as described in the Examples section below. In some embodiments, the structurally related anti-human Clq antibodies have a higher affinity to the antigen as compared to the monoclonal antibody Ml as measured by the IC50 value as described in the Examples section below.
  • one or more CDR or variable regions of an anti-Clq antibody can be combined recombinantly with known human framework regions and CDRs to create additional, recombinantly- engineered, human anti-Clq antibodies of the present disclosure.
  • the recombinant antibodies of the present disclosure prepared as set forth above may, in some embodiments, comprise the heavy and light chain CDR3s of variable regions of the monoclonal antibody Ml produced by the hybridoma cell line having ATCC Accession Number PTA-120399.
  • the antibodies further can comprise the CDR2s of variable regions of the monoclonal antibody Ml .
  • the antibodies further can comprise the CDRls of variable regions of the monoclonal antibody Ml .
  • the antibodies can further comprise any combinations of the CDRs.
  • the CDR1, 2, and/or 3 regions of the engineered antibodies described above may comprise the exact amino acid sequence(s) as those of variable regions of the monoclonal antibody Ml produced by the hybridoma cell line having ATCC Accession Number PTA-120399.
  • the ordinarily skilled artisan will appreciate that some deviation from the exact CDR sequences may be possible while still retaining the ability of the antibody to bind Clq effectively (e.g., conservative sequence modifications).
  • the engineered antibody may be composed of one or more CDRs that are, for example, 50%, 60%, 70%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 99.5% identical to one or more CDRs of the monoclonal antibody Ml .
  • a anti-Clq antibody fragments can also be isolated from the antibody phage libraries as discussed above.
  • Fab'-SH fragments can be directly recovered from E. coli and chemically coupled to form F(ab') 2 fragments (Carter et al, Bio/Technology 10: 163-167 (1992)).
  • F(ab') 2 fragments can be isolated directly from recombinant host-cell culture. Production of Fab and F(ab') 2 antibody fragments with increased in vivo half-lives are described in U.S. Patent No.
  • the antibody of choice is a single chain Fv fragment (scFv). See WO 93/16185; U.S. Patent No. 5,571,894 and U.S. Patent No. 5,587,458.
  • the anti-Clq, anti-Clr, or anti-Clq antibody fragment may also be a "linear antibody," e.g., as described in U.S. Patent 5,641,870. Such linear antibody fragments may be monospecific or bispecific.
  • antibodies of the present disclosure encompass bispecific antibodies and polyspecific antibodies.
  • Bispecific antibodies are antibodies that have binding specificities for at least two different epitopes, including those on the same or another protein (e.g., one or more Clq proteins of the present disclosure). Alternatively, one part of a BsAb can be armed to bind to the target Clq antigen, and another can be combined with an arm that binds to a second protein. Such antibodies can be derived from full length antibodies or antibody fragments (e.g., F(ab') 2 bispecific antibodies).
  • antibody variable domains with the desired binding specificities are fused to immunoglobulin constant domain sequences.
  • the fusion may be with an immunoglobulin heavy chain constant domain, comprising at least part of the hinge, C H 2, and C H 3 regions.
  • the first heavy-chain constant region (C R I) containing the site necessary for light chain binding is present in at least one of the fusions.
  • immunoglobulin heavy chain fusions and, if desired, the immunoglobulin light chain are inserted into separate expression vectors, and are co-transfected into a suitable host organism.
  • This provides great flexibility in adjusting the mutual proportions of the three polypeptide fragments in embodiments when unequal ratios of the three polypeptide chains used in the construction provide the optimum yields. It is, however, possible to insert the coding sequences for two or all three polypeptide chains in one expression vector when the expression of at least two polypeptide chains in equal ratios results in high yields or when the ratios are of no particular significance.
  • the bispecific antibodies are composed of a hybrid immunoglobulin heavy chain with a first binding specificity in one arm, and a hybrid immunoglobulin heavy chain-light chain pair (providing a second binding specificity) in the other arm. It was found that this asymmetric structure facilitates the separation of the desired bispecific compound from unwanted immunoglobulin chain combinations, as the presence of an immunoglobulin light chain in only half of the bispecific molecules provides an easy way of separation. This approach is disclosed in WO 94/04690. For further details of generating bispecific antibodies, see, for example, Suresh et al., Methods in Enzymology 121 : 210 (1986).
  • the interface between a pair of antibody molecules can be engineered to maximize the percentage of heterodimers which are recovered from recombinant-cell culture.
  • the interface may comprise at least a part of the C H 3 region of an antibody constant domain.
  • one or more small amino acid side chains from the interface of the first antibody molecule are replaced with larger side chains (e.g. , tyrosine or tryptophan).
  • Compensatory "cavities" of identical or similar size to the large side chains(s) are created on the interface of the second antibody molecule by replacing large amino acid side chains with smaller ones (e.g., alanine or threonine). This provides a mechanism for increasing the yield of the heterodimer over other unwanted end-products such as homodimers.
  • bispecific antibodies can be prepared using chemical linkage.
  • Brennan et al., Science 229:81 (1985) describe a procedure wherein intact antibodies are proteolytically cleaved to generate F(ab') 2 fragments. These fragments are reduced in the presence of the dithiol complexing agent sodium arsenite to stabilize vicinal dithiols and prevent intermolecular disulfide formation.
  • the Fab' fragments generated are then converted to thionitrobenzoate (TNB) derivatives.
  • TAB thionitrobenzoate
  • One of the Fab'-TNB derivatives is then reconverted to the Fab'-TNB derivative to form the bispecific antibody.
  • the bispecific antibodies produced can be used as agents for the selective immobilization of enzymes.
  • Fab' fragments may be directly recovered from E. coli and chemically coupled to form bispecific antibodies.
  • Shalaby et al, J. Exp. Med. 175: 217-225 (1992) describes the production of fully humanized bispecific antibody F(ab') 2 molecules.
  • Each Fab' fragment was separately secreted from E. coli and subjected to directed chemical coupling in vitro to form the bispecific antibody.
  • the bispecific antibody thus formed was able to bind to cells overexpressing the ErbB2 receptor and normal human T-cells, as well as trigger the lytic activity of human cytotoxic lymphocytes against human breast tumor targets.
  • bivalent heterodimers have been produced using leucine zippers.
  • the leucine zipper peptides from the Fos and Jun proteins were linked to the Fab' portions of two different antibodies by gene fusion.
  • the antibody homodimers were reduced at the hinge region to form monomers and then re -oxidized to form the antibody heterodimers.
  • the "diabody" technology described by Hollinger et al., Proc. Nat'l Acad. Sci.
  • the fragments comprise a heavy-chain variable domain (V H ) connected to a light-chain variable domain (V L ) by a linker which is too short to allow pairing between the two domains on the same chain. Accordingly, the V H and V L domains of one fragment are forced to pair with the complementary V L and V H domains of another fragment, thereby forming two antigen-binding sites.
  • V H and V L domains of one fragment are forced to pair with the complementary V L and V H domains of another fragment, thereby forming two antigen-binding sites.
  • sFv single-chain Fv
  • Antibodies with more than two valencies are also contemplated.
  • trispecific antibodies can be prepared. Tutt et al., J. Immunol. 147:60 (1991).
  • Exemplary bispecific antibodies may bind to two different antigens.
  • a bispecific antibody binds to a first antigen, Clq, and a second antigen facilitating transport across the blood-brain barrier.
  • Clq first antigen
  • second antigen facilitating transport across the blood-brain barrier.
  • Numerous antigens are known in the art that facilitate transport across the blood-brain barrier ⁇ see, e.g., Gabathuler R.,
  • Such second antigens include, without limitation, transferrin receptor (TR), insulin receptor (HIR), Insulin-like growth factor receptor (IGFR), low-density lipoprotein receptor related proteins 1 and 2 (LPR-1 and 2), diphtheria toxin receptor, including CRM 197 (a non-toxic mutant of diphtheria toxin), llama single domain antibodies such as TMEM 30(A) (Flippase), protein transduction domains such as TAT, Syn-B, or penetratin, poly-arginine or generally positively charged peptides, and Angiopep peptides such as ANG1005 ⁇ see, e.g., Gabathuler, 2010).
  • TR transferrin receptor
  • HIR insulin receptor
  • IGFR Insulin-like growth factor receptor
  • LPR-1 and 2 low-density lipoprotein receptor related proteins 1 and 2
  • diphtheria toxin receptor including CRM 197 (a non-toxic mutant of diphtheria toxin), llama single domain antibodies
  • antibodies of the present disclosure encompass multivalent antibodies.
  • a multivalent antibody may be internalized (and/or catabolized) faster than a bivalent antibody by a cell expressing an antigen to which the antibodies bind.
  • the anti-Clq antibodies of the present disclosure or antibody fragments thereof can be multivalent antibodies (which are other than of the IgM class) with three or more antigen binding sites ⁇ e.g., tetravalent antibodies), which can be readily produced by recombinant expression of nucleic acid encoding the polypeptide chains of the antibody.
  • the multivalent antibody can comprise a dimerization domain and three or more antigen binding sites.
  • the dimerization domain comprises an Fc region or a hinge region.
  • the antibody will comprise an Fc region and three or more antigen binding sites amino-terminal to the Fc region.
  • the multivalent antibody herein contains three to about eight, and in some embodiments four, antigen binding sites.
  • the multivalent antibody contains at least one polypeptide chain (and in some embodiments two polypeptide chains), wherein the polypeptide chain or chains comprise two or more variable domains.
  • the polypeptide chain or chains may comprise VDl-(Xl)n-VD2-(X2)n-Fc, wherein VD1 is a first variable domain, VD2 is a second variable domain, Fc is one polypeptide chain of an Fc region, XI and X2 represent an amino acid or polypeptide, and n is 0 or 1.
  • the polypeptide chain or chains may comprise V H -C H 1 -flexible linker-VH-CHl-Fc region chain; or V H -C H 1-V H -C H 1- Fc region chain.
  • the multivalent antibody herein may further comprise at least two (and in some embodiments four) light chain variable domain polypeptides.
  • the multivalent antibody herein may, for instance, comprise from about two to about eight light chain variable domain polypeptides.
  • the light chain variable domain polypeptides contemplated here comprise a light chain variable domain and, optionally, further comprise a CL domain.
  • Heteroconjugate antibodies are also within the scope of the present disclosure.
  • Heteroconjugate antibodies are composed of two covalently joined antibodies ⁇ e.g., anti- Clq antibodies of the present disclosure or antibody fragments thereof).
  • one of the antibodies in the heteroconjugate can be coupled to avidin, the other to biotin.
  • Such antibodies have, for example, been proposed to target immune system cells to unwanted cells, U.S. Patent No. 4,676,980, and have been used to treat HIV infection.
  • International Publication Nos. WO 91/00360, WO 92/200373 and EP 0308936 It is contemplated that the antibodies may be prepared in vitro using known methods in synthetic protein chemistry, including those involving crosslinking agents.
  • immunotoxins may be constructed using a disulfide exchange reaction or by forming a thioether bond.
  • Suitable reagents for this purpose include iminothiolate and methyl-4- mercaptobutyrimidate and those disclosed, for example, in U.S. Patent No. 4,676,980.
  • Heteroconjugate antibodies may be made using any convenient cross-linking methods. Suitable cross-linking agents are well known in the art, and are disclosed in U.S. Patent No. 4,676,980, along with a number of cross-linking techniques.
  • the Fc receptor binding site on the constant region may be modified or mutated to remove or reduce binding affinity to certain Fc receptors, such as FcyRI, FcyRII, and/or FcyRIII.
  • the effector function is impaired by removing N-glycosylation of the Fc region (e.g., in the CH 2 domain of IgG) of the antibody.
  • the effector function is impaired by modifying regions such as 233-236, 297, and/or 327-331 of human IgG as described in PCT WO 99/58572 and Armour et al, Molecular Immunology 40: 585-593 (2003); Reddy et al, J. Immunology 164: 1925-1933 (2000).
  • the constant region of the anti-complement antibodies described herein may also be modified to impair complement activation.
  • complement activation of IgG antibodies following binding of the CI component of complement may be reduced by mutating amino acid residues in the constant region in a CI binding motif ⁇ e.g., Clq binding motif).
  • Clq binding motif constitutes residues E318, K320, and K322.
  • alkyl-substituted non-ionic residues such as Gly, He, Leu, or Val, or such aromatic non-polar residues as Phe, Tyr, Trp, and Pro in place of any one of the three residues in order to abolish Clq binding.
  • aromatic non-polar residues such as Phe, Tyr, Trp, and Pro
  • polar non-ionic residues such as Ser, Thr, Cys, and Met in place of residues 320 and 322, but not 318, in order to abolish Cls binding activity.
  • Deglycosylation can be performed using glycosidase enzymes for example Endoglycosidase S (EndoS), a 108kDa enzyme encoded by the gene endoS of Streptococcus pyogenes that selectively digests asparagine-linked glycans on the heavy chain of all IgG subclasses, without action on other immunoglobulin classes or other glycoproteins (Collin et al. (2001) E7kffiO J2001;20:3046-3055).
  • EndoS Endoglycosidase S
  • Streptococcus pyogenes a 108kDa enzyme encoded by the gene endoS of Streptococcus pyogenes that selectively digests asparagine-linked glycans on the heavy chain of all IgG subclasses, without action on other immunoglobulin classes or other glycoproteins
  • a salvage receptor binding epitope into the antibody (especially an antibody
  • the term "salvage receptor binding epitope” refers to an epitope of the Fc region of an IgG molecule ⁇ e.g., IgGi, IgG 2 , IgG 3 , or IgG 4 ) that is responsible for increasing the in vivo serum half-life of the IgG molecule.
  • Amino acid sequence modifications of humanized anti-Clq antibodies of the present disclosure, or antibody fragments thereof, are also contemplated. For example, it may be desirable to improve the binding affinity and/or other biological properties of the antibodies or antibody fragments.
  • Amino acid sequence variants of the antibodies or antibody fragments are prepared by introducing appropriate nucleotide changes into the nucleic acid encoding the antibodies or antibody fragments, or by peptide synthesis. Such modifications include, for example, deletions from, and/or insertions into and/or substitutions of, residues within the amino acid sequences of the antibody. Any
  • the amino acid changes also may alter post-translational processes of the antibody, such as changing the number or position of glycosylation sites.
  • a useful method for identification of certain residues or regions of the anti-Clq antibody that are preferred locations for mutagenesis is called "alanine scanning
  • mutagenesis as described by Cunningham and Wells in Science, 244: 1081-1085 (1989).
  • a residue or group of target residues are identified ⁇ e.g., charged residues such as arg, asp, his, lys, and glu) and replaced by a neutral or negatively charged amino acid (most preferably alanine or polyalanine) to affect the interaction of the amino acids with the target antigen.
  • a neutral or negatively charged amino acid most preferably alanine or polyalanine
  • substitutions then are refined by introducing further or other variants at, or for, the sites of substitution.
  • site for introducing an amino acid sequence variation is predetermined, the nature of the mutation per se need not be predetermined.
  • Amino acid sequence insertions include amino- ("N") and/or carboxy- ("C") terminal fusions ranging in length from one residue to polypeptides containing a hundred or more residues, as well as intrasequence insertions of single or multiple amino acid residues.
  • terminal insertions include an antibody with an N-terminal methionyl residue or the antibody fused to a cytotoxic polypeptide.
  • Other insertional variants of the antibody molecule include the fusion to the N- or C-terminus of the antibody to an enzyme or a polypeptide which increases the serum half-life of the antibody.
  • variants are an amino acid substitution variant. These variants have at least one amino acid residue in the antibody molecule replaced by a different residue.
  • the sites of greatest interest for substitutional mutagenesis include the
  • Substantial modifications in the biological properties of the antibody are accomplished by selecting substitutions that differ significantly in their effect on maintaining (a) the structure of the polypeptide backbone in the area of the substitution, for example, as a sheet or helical conformation, (b) the charge or hydrophobicity of the molecule at the target site, or (c) the bulk of the side chain.
  • Naturally occurring residues are divided into groups based on common side-chain properties:
  • hydrophobic norleucine, met, ala, val, leu, ile
  • Non-conservative substitutions entail exchanging a member of one of these classes for another class.
  • cysteine residue not involved in maintaining the proper conformation of the antibody also may be substituted, generally with serine, to improve the oxidative stability of the molecule and prevent aberrant crosslinking.
  • cysteine bond(s) may be added to the antibody to improve its stability (particularly where the antibody is an antibody fragment, such as an Fv fragment).
  • the substitutional variant involves substituting one or more hypervariable region residues of a parent antibody (e.g. a humanized or human anti- Clq antibody).
  • a parent antibody e.g. a humanized or human anti- Clq antibody.
  • the resulting variant(s) selected for further development will have improved biological properties relative to the parent antibody from which they are generated.
  • a convenient way for generating such substitutional variants involves affinity maturation using phage display. Briefly, several hypervariable region sites (e.g. , 6-7 sites) are mutated to generate all possible amino substitutions at each site.
  • the antibody variants thus generated are displayed in a monovalent fashion from filamentous phage particles as fusions to the gene III product of Ml 3 packaged within each particle.
  • the phage-displayed variants are then screened for their biological activity (e.g. , binding affinity) as herein disclosed.
  • alanine scanning mutagenesis can be performed to identify hypervariable region residues contributing significantly to antigen binding.
  • the panel of variants is subjected to screening as described herein and antibodies with superior properties in one or more relevant assays may be selected for further development.
  • Another type of amino acid variant of the antibody alters the original glycosylation pattern of the antibody. By altering is meant deleting one or more amino acid variant of the antibody.
  • carbohydrate moieties found in the antibody and/or adding one or more glycosylation sites that are not present in the antibody.
  • N-linked refers to the attachment of the carbohydrate moiety to the side chain of an asparagine residue.
  • the tripeptide sequences asparagine-X-serine and asparagine-X-threonine, where X is any amino acid except proline, are the recognition sequences for enzymatic attachment of the carbohydrate moiety to the asparagine side chain.
  • X is any amino acid except proline
  • O-linked glycosylation refers to the attachment of one of the sugars N-aceylgalactosamine, galactose, or xylose to a hydroxy amino acid, most commonly serine or threonine, although 5- hydroxyproline or 5 -hydroxy lysine may also be used.
  • Addition of glycosylation sites to the antibody is conveniently accomplished by altering the amino acid sequence such that it contains one or more of the above-described tripeptide sequences (for N-linked glycosylation sites).
  • the alteration may also be made by the addition of, or substitution by, one or more serine or threonine residues to the sequence of the original antibody (for O-linked glycosylation sites).
  • Nucleic acid molecules encoding amino acid sequence variants of the anti-IgE antibody are prepared by a variety of methods known in the art. These methods include, but are not limited to, isolation from a natural source (in the case of naturally occurring amino acid sequence variants) or preparation by oligonucleotide -mediated (or site-directed) mutagenesis, PCR mutagenesis, and cassette mutagenesis of an earlier prepared variant or a non- variant version of the antibodies (e.g., anti-Clq antibody of the present disclosure) or antibody fragments.
  • humanized anti-Clq antibodies of the present disclosure may be further modified to contain additional non-proteinaceous moieties that are known in the art and readily available.
  • additional non-proteinaceous moieties that are known in the art and readily available.
  • the moieties suitable for derivatization of the antibody are water-soluble polymers.
  • water-soluble polymers include, but are not limited to, polyethylene glycol (PEG), copolymers of ethylene glycol/propylene glycol,
  • dextran polyvinyl alcohol, polyvinyl pyrrolidone, poly-1, 3- dioxolane, poly-1, 3, 6-trioxane, ethylene/maleic anhydride copolymer, polyaminoacids (either homopolymers or random copolymers), and dextran or poly(n-vinyl
  • Polyethylene glycol propionaldehyde may have advantages in manufacturing due to its stability in water.
  • the polymer may be of any molecular weight, and may be branched or unbranched.
  • the number of polymers attached to the antibody may vary, and if more than one polymer is attached, they can be the same or different molecules.
  • the number and/or type of polymers used for derivatization can be determined based on considerations including, but not limited to, the particular properties or functions of the antibody to be improved, whether the antibody derivative will be used in a therapy under defined conditions, etc.
  • considerations including, but not limited to, the particular properties or functions of the antibody to be improved, whether the antibody derivative will be used in a therapy under defined conditions, etc.
  • Such techniques and other suitable formulations are disclosed in Remington: The Science and Practice of Pharmacy, 20th Ed., Alfonso Gennaro, Ed., Philadelphia College of Pharmacy and Science (2000).
  • Humanized anti-Clq antibodies of the present disclosure may be produced using recombinant methods and compositions, e.g., as described in U.S. Patent No. 4,816,567.
  • isolated nucleic acids having a nucleotide sequence encoding any of the anti-Clq antibodies of the present disclosure are provided.
  • Such nucleic acids may encode an amino acid sequence containing the VL and/or an amino acid sequence containing the VH of the anti-Clq antibody (e.g., the light and/or heavy chains of the antibody).
  • one or more vectors e.g., expression vectors containing such nucleic acids are provided.
  • a host cell containing such nucleic acid is also provided.
  • the host cell contains (e.g., has been transduced with): (1) a vector containing a nucleic acid that encodes an amino acid sequence containing the VL of the antibody and an amino acid sequence containing the VH of the antibody, or (2) a first vector containing a nucleic acid that encodes an amino acid sequence containing the VL of the antibody and a second vector containing a nucleic acid that encodes an amino acid sequence containing the VH of the antibody.
  • the host cell is eukaryotic, e.g., a Chinese Hamster Ovary (CHO) cell or lymphoid cell (e.g., Y0, NSO, Sp20 cell).
  • Methods of making an anti-Clq antibody of the present disclosure include culturing a host cell of the present disclosure containing a nucleic acid encoding the anti-Clq antibody, under conditions suitable for expression of the antibody.
  • the antibody is subsequently recovered from the host cell (or host cell culture medium).
  • a nucleic acid encoding the anti-Clq antibody is isolated and inserted into one or more vectors for further cloning and/or expression in a host cell.
  • Such nucleic acid may be readily isolated and sequenced using conventional procedures ⁇ e.g., by using
  • oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of the antibody.
  • Suitable vectors containing a nucleic acid sequence encoding any of the anti- Clq antibodies of the present disclosure, or fragments thereof polypeptides (including antibodies) described herein include, without limitation, cloning vectors and expression vectors.
  • Suitable cloning vectors can be constructed according to standard techniques, or may be selected from a large number of cloning vectors available in the art. While the cloning vector selected may vary according to the host cell intended to be used, useful cloning vectors generally have the ability to self-replicate, may possess a single target for a particular restriction endonuclease, and/or may carry genes for a marker that can be used in selecting clones containing the vector.
  • Suitable examples include plasmids and bacterial viruses, e.g., pUC18, pUC19, Bluescript ⁇ e.g., pBS SK+) and its derivatives, mpl8, mpl9, pBR322, pMB9, ColEl, pCRl, RP4, phage DNAs, and shuttle vectors such as pSA3 and pAT28.
  • plasmids and bacterial viruses e.g., pUC18, pUC19, Bluescript ⁇ e.g., pBS SK+) and its derivatives, mpl8, mpl9, pBR322, pMB9, ColEl, pCRl, RP4, phage DNAs, and shuttle vectors such as pSA3 and pAT28.
  • shuttle vectors such as pSA3 and pAT28.
  • Expression vectors generally are replicable polynucleotide constructs that contain a nucleic acid of the present disclosure.
  • the expression vector may replicable in the host cells either as episomes or as an integral part of the chromosomal DNA.
  • Suitable expression vectors include but are not limited to plasmids, viral vectors, including adenoviruses, adeno-associated viruses, retroviruses, cosmids, and expression vector(s) disclosed in PCT Publication No. WO 87/04462.
  • Vector components may generally include, but are not limited to, one or more of the following: a signal sequence; an origin of replication; one or more marker genes; suitable transcriptional controlling elements (such as promoters, enhancers and terminator).
  • suitable transcriptional controlling elements such as promoters, enhancers and terminator
  • one or more translational controlling elements are also usually required, such as ribosome binding sites, translation initiation sites, and stop codons.
  • the vectors containing the nucleic acids of interest can be introduced into the host cell by any of a number of appropriate means, including electroporation, transfection employing calcium chloride, rubidium chloride, calcium phosphate, DEAE-dextran, or other substances; microprojectile bombardment; lipofection; and infection (e.g., where the vector is an infectious agent such as vaccinia virus).
  • electroporation employing calcium chloride, rubidium chloride, calcium phosphate, DEAE-dextran, or other substances
  • microprojectile bombardment e.g., where the vector is an infectious agent such as vaccinia virus.
  • infection e.g., where the vector is an infectious agent such as vaccinia virus.
  • the vector contains a nucleic acid containing one or more amino acid sequences encoding an anti-Clq antibody of the present disclosure.
  • Suitable host cells for cloning or expression of antibody-encoding vectors include prokaryotic or eukaryotic cells.
  • anti-Clq antibodies of the present disclosure may be produced in bacteria, in particular when glycosylation and Fc effector function are not needed.
  • For expression of antibody fragments and polypeptides in bacteria e.g., U.S. Patent Nos. 5,648,237, 5,789,199, and 5,840,523; and Charlton, Methods in Molecular Biology, Vol. 248 (B.K.C. Lo, ed., Humana Press, Totowa, NJ, 2003), pp. 245- 254, describing expression of antibody fragments in E. coli .
  • the antibody may be isolated from the bacterial cell paste in a soluble fraction and can be further purified.
  • eukaryotic microorganisms such as filamentous fungi or yeast
  • suitable cloning or expression hosts for antibody-encoding vectors including fungi and yeast strains whose glycosylation pathways have been "humanized,” resulting in the production of an antibody with a partially or fully human glycosylation pattern (e.g., Gerngross, Nat. Biotech. 22: 1409-1414 (2004); and Li et al, Nat. Biotech. 24:210-215 (2006)).
  • Suitable host cells for the expression of glycosylated antibody can also be derived from multicellular organisms (invertebrates and vertebrates). Examples of invertebrate cells include plant and insect cells. Numerous baculoviral strains have been identified which may be used in conjunction with insect cells, particularly for transfection of Spodoptera frugiperda cells. Plant cell cultures can also be utilized as hosts (e.g., U.S. Patent Nos. 5,959,177, 6,040,498, 6,420,548, 7,125,978, and 6,417,429, describing PLANTIBODIESTM technology for producing antibodies in transgenic plants.).
  • Vertebrate cells may also be used as hosts.
  • mammalian cell lines that are adapted to grow in suspension may be useful.
  • useful mammalian host cell lines are monkey kidney CV1 line transformed by SV40 (COS-7); human embryonic kidney line (293 or 293 cells as described, e.g., in Graham et al, J. Gen Virol. 36:59 (1977)); baby hamster kidney cells (BHK); mouse Sertoli cells (TM4 cells as described, e.g., in Mather, Biol. Reprod.
  • monkey kidney cells (CV1); African green monkey kidney cells (VERO-76); human cervical carcinoma cells (HELA); canine kidney cells (MDCK; buffalo rat liver cells (BRL 3A); human lung cells (W138); human liver cells (Hep G2); mouse mammary tumor (MMT 060562); TRI cells, as described, e.g., in Mather et al, Annals N. Y. Acad. Sci. 383:44-68 (1982); MRC 5 cells; and FS4 cells.
  • Other useful mammalian host cell lines include Chinese hamster ovary (CHO) cells, including DHFR-CHO cells (Urlaub et al, Proc. Natl. Acad. Sci.
  • Humanized anti-Clq antibodies of the present disclosure can be incorporated into a variety of formulations for therapeutic use ⁇ e.g., by administration) or in the manufacture of a medicament ⁇ e.g., for treating or preventing a neurodegenerative disease or autoimmune disease) by combining the antibodies with appropriate pharmaceutically acceptable carriers or diluents, and may be formulated into preparations in solid, semisolid, liquid or gaseous forms.
  • formulations include, without limitation, tablets, capsules, powders, granules, ointments, solutions, suppositories, injections, inhalants, gels, microspheres, and aerosols.
  • compositions can include, depending on the formulation desired, pharmaceutically-acceptable, non-toxic carriers of diluents, which are vehicles commonly used to formulate pharmaceutical compositions for animal or human administration.
  • diluents are vehicles commonly used to formulate pharmaceutical compositions for animal or human administration.
  • the diluent is selected so as not to affect the biological activity of the combination.
  • examples of such diluents include, without limitation, distilled water, buffered water, physiological saline, PBS, Ringer's solution, dextrose solution, and Hank's solution.
  • a pharmaceutical composition or formulation of the present disclosure can further include other carriers, adjuvants, or non-toxic, nontherapeutic, nonimmunogenic stabilizers, excipients and the like.
  • the compositions can also include additional substances to approximate physiological conditions, such as pH adjusting and buffering agents, toxicity adjusting agents, wetting agents and detergents.
  • a pharmaceutical composition of the present disclosure can also include any of a variety of stabilizing agents, such as an antioxidant for example.
  • stabilizing agents such as an antioxidant for example.
  • composition includes a polypeptide
  • the polypeptide can be complexed with various well-known compounds that enhance the in vivo stability of the polypeptide, or otherwise enhance its pharmacological properties ⁇ e.g. , increase the half-life of the polypeptide, reduce its toxicity, and enhance solubility or uptake).
  • modifications or complexing agents include, without limitation, sulfate, gluconate, citrate and phosphate.
  • the polypeptides of a composition can also be complexed with molecules that enhance their in vivo attributes. Such molecules include, without limitation, carbohydrates, polyamines, amino acids, other peptides, ions ⁇ e.g., sodium, potassium, calcium, magnesium, manganese), and lipids.
  • the active ingredient can be administered in solid dosage forms, such as capsules, tablets, and powders, or in liquid dosage forms, such as elixirs, syrups, and suspensions.
  • the active component(s) can be encapsulated in gelatin capsules together with inactive ingredients and powdered carriers, such as glucose, lactose, sucrose, mannitol, starch, cellulose or cellulose derivatives, magnesium stearate, stearic acid, sodium saccharin, talcum, magnesium carbonate.
  • inactive ingredients examples include red iron oxide, silica gel, sodium lauryl sulfate, titanium dioxide, and edible white ink. Similar diluents can be used to make compressed tablets. Both tablets and capsules can be manufactured as sustained release products to provide for continuous release of medication over a period of hours.
  • Compressed tablets can be sugar coated or film coated to mask any unpleasant taste and protect the tablet from the atmosphere, or enteric-coated for selective disintegration in the gastrointestinal tract.
  • Liquid dosage forms for oral administration can contain coloring and flavoring to increase patient acceptance.
  • Formulations suitable for parenteral administration include aqueous and nonaqueous, isotonic sterile injection solutions, which can contain antioxidants, buffers, bacteriostats, and solutes that render the formulation isotonic with the blood of the intended recipient, and aqueous and non-aqueous sterile suspensions that can include suspending agents, solubilizers, thickening agents, stabilizers, and preservatives.
  • compositions intended for in vivo use are usually sterile. To the extent that a given compound must be synthesized prior to use, the resulting product is typically substantially free of any potentially toxic agents, particularly any endotoxins, which may be present during the synthesis or purification process.
  • compositions for parental administration are also sterile, substantially isotonic and made under GMP conditions.
  • Formulations may be optimized for retention and stabilization in the brain or central nervous system.
  • Stabilization techniques include cross-linking, multimerizing, or linking to groups such as polyethylene glycol, polyacrylamide, neutral protein carriers, etc. in order to achieve an increase in molecular weight.
  • Other strategies for increasing retention include the entrapment of the antibody, such as a humanized anti-Clq antibody of the present disclosure, in a biodegradable or bioerodible implant.
  • the rate of release of the therapeutically active agent is controlled by the rate of transport through the polymeric matrix, and the biodegradation of the implant.
  • the transport of drug through the polymer barrier will also be affected by compound solubility, polymer hydrophilicity, extent of polymer cross-linking, expansion of the polymer upon water absorption so as to make the polymer barrier more permeable to the drug, geometry of the implant, and the like.
  • the implants are of dimensions commensurate with the size and shape of the region selected as the site of implantation.
  • Implants may be particles, sheets, patches, plaques, fibers, microcapsules and the like and may be of any size or shape compatible with the selected site of insertion.
  • the implants may be monolithic, i.e. having the active agent homogenously distributed through the polymeric matrix, or encapsulated, where a reservoir of active agent is encapsulated by the polymeric matrix.
  • the selection of the polymeric composition to be employed will vary with the site of administration, the desired period of treatment, patient tolerance, the nature of the disease to be treated and the like. Characteristics of the polymers will include biodegradability at the site of implantation, compatibility with the agent of interest, ease of encapsulation, a half-life in the physiological environment.
  • Biodegradable polymeric compositions which may be employed may be organic esters or ethers, which when degraded result in physiologically acceptable degradation products, including the monomers. Anhydrides, amides, orthoesters or the like, by themselves or in combination with other monomers, may find use.
  • the polymers will be condensation polymers.
  • the polymers may be cross-linked or non-cross-linked.
  • Of particular interest are polymers of hydroxyaliphatic carboxylic acids, either homo- or copolymers, and polysaccharides. Included among the polyesters of interest are polymers of D-lactic acid, L-lactic acid, racemic lactic acid, glycolic acid, polycapro lactone, and combinations thereof. By employing the L-lactate or D-lactate, a slowly biodegrading polymer is achieved, while degradation is substantially enhanced with the racemate.
  • Copolymers of glycolic and lactic acid are of particular interest, where the rate of biodegradation is controlled by the ratio of glycolic to lactic acid.
  • the most rapidly degraded copolymer has roughly equal amounts of glycolic and lactic acid, where either homopolymer is more resistant to degradation.
  • the ratio of glycolic acid to lactic acid will also affect the brittleness of in the implant, where a more flexible implant is desirable for larger geometries.
  • the polysaccharides of interest are calcium alginate, and functionalized celluloses, particularly carboxymethylcellulose esters characterized by being water insoluble, a molecular weight of about 5 kD to 500 kD, etc.
  • Biodegradable hydrogels may also be employed in the implants of the present disclosure. Hydrogels are typically a copolymer material, characterized by the ability to imbibe a liquid.
  • biodegradable hydrogels which may be employed are described in Heller in: Hydrogels in Medicine and Pharmacy, N. A. Peppes ed., Vol. Ill, CRC Press, Boca Raton, Fla., 1987, pp 137-149.
  • compositions of the present disclosure containing a humanized anti-Clq antibody of the present disclosure may be used ⁇ e.g., administered to an individual in need of treatment with an anti-Clq antibody, such as a human individual) in accordance with known methods, such as intravenous administration as a bolus or by continuous infusion over a period of time, by intramuscular, intraperitoneal, intracerobrospinal, intracranial, intraspinal, subcutaneous, intra-articular, intrasynovial, intrathecal, oral, topical, or inhalation routes.
  • intravenous administration as a bolus or by continuous infusion over a period of time
  • intramuscular, intraperitoneal, intracerobrospinal, intracranial, intraspinal, subcutaneous, intra-articular, intrasynovial, intrathecal, oral, topical, or inhalation routes such as intravenous administration as a bolus or by continuous infusion over a period of time, by intramuscular, intraperitone
  • Dosages and desired drug concentration of pharmaceutical compositions of the present disclosure may vary depending on the particular use envisioned. The determination of the appropriate dosage or route of administration is well within the skill of an ordinary artisan. Animal experiments provide reliable guidance for the determination of effective doses for human therapy. Interspecies scaling of effective doses can be performed following the principles described in Mordenti, J. and Chappell, W. "The Use of
  • normal dosage amounts may vary from about 10 ng/kg up to about 100 mg/kg of an individual's body weight or more per day, depending upon the route of administration. In some embodiments, the dose amount is about 1 mg/kg/day to 10 mg/kg/day. For repeated administrations over several days or longer, depending on the severity of the disease, disorder, or condition to be treated, the treatment is sustained until a desired suppression of symptoms is achieved.
  • An exemplary dosing regimen may include administering an initial dose of a humanized anti-Clq antibody, of about 2 mg/kg, followed by a weekly maintenance dose of about 1 mg/kg every other week.
  • Other dosage regimens may be useful, depending on the pattern of pharmacokinetic decay that the physician wishes to achieve. For example, dosing an individual from one to twenty-one times a week is contemplated herein. In certain embodiments, dosing ranging from about 3 ⁇ g/kg to about 2 mg/kg (such as about 3 ⁇ g/kg, about 10 ⁇ g/kg, about 30 ⁇ g/kg, about 100 ⁇ g/kg, about 300 ⁇ g/kg, about 1 mg/kg, or about 2 mg/kg) may be used.
  • dosing frequency is three times per day, twice per day, once per day, once every other day, once weekly, once every two weeks, once every four weeks, once every five weeks, once every six weeks, once every seven weeks, once every eight weeks, once every nine weeks, once every ten weeks, or once monthly, once every two months, once every three months, or longer. Progress of the therapy is easily monitored by conventional techniques and assays.
  • the dosing regimen, including the humanized anti-Clq antibody administered, can vary over time independently of the dose used.
  • Dosages for a particular humanized anti-Clq antibody may be determined empirically in individuals who have been given one or more administrations of the humanized anti-Clq antibody. Individuals are given incremental doses of a humanized anti-Clq antibody. To assess efficacy of a humanized anti-Clq antibody, any clinical symptom of a neurodegenerative disorder, inflammatory disorder, or autoimmune disorder can be monitored.
  • Administration of a humanized anti-Clq antibody of the present disclosure can be continuous or intermittent, depending, for example, on the recipient's physiological condition, whether the purpose of the administration is therapeutic or prophylactic, and other factors known to skilled practitioners.
  • the administration of a humanized anti-Clq antibody may be essentially continuous over a preselected period of time or may be in a series of spaced doses.
  • dosages and methods of delivery are provided in the literature; see, for example, U.S. Patent Nos. 4,657,760; 5,206,344; or 5,225,212. It is within the scope of the present disclosure that different formulations will be effective for different treatments and different disorders, and that administration intended to treat a specific organ or tissue may necessitate delivery in a manner different from that to another organ or tissue. Moreover, dosages may be administered by one or more separate administrations, or by continuous infusion. For repeated administrations over several days or longer, depending on the condition, the treatment is sustained until a desired suppression of disease symptoms occurs. However, other dosage regimens may be useful. The progress of this therapy is easily monitored by conventional techniques and assays.
  • the present disclosure provides humanized anti-Clq antibodies, and antigen- binding fragments thereof, which can bind to and neutralize a biologic activity of Clq. These humanized anti-Clq antibodies are useful for preventing, reducing risk, or treating a range of diseases associated with complement activation, including, without limitation, neurodegenerative disorders, inflammatory disorders, and autoimmune disorders.
  • humanized anti-Clq antibodies of the present disclosure may be used for treating, preventing, or reducing risk of a disease associated with complement activation, including, without limitation, neurodegenerative disorders, inflammatory disorders, and autoimmune disorders, in an individual.
  • a disease associated with complement activation including, without limitation, neurodegenerative disorders, inflammatory disorders, and autoimmune disorders, in an individual.
  • the individual has such a disease. In some embodiments, the individual is a human.
  • Neurodegenerative disorders that may be treated with humanized anti-C 1 q antibodies of this disclosure include disorders associated with loss of nerve connections or synapses, including CF1 -dependent synapse loss.
  • Such disorders may include, without limitation, Alzheimer's disease, amyotrophic lateral sclerosis, multiple sclerosis, glaucoma, myotonic dystrophy, Guillain-Barre ' syndrome (GBS), Myasthenia Gravis, Bullous Pemphigoid, spinal muscular atrophy, Down syndrome, Parkinson's disease, and
  • synapse loss is dependent on the complement receptor 3 (CR3)/C3 or complement receptor CR1.
  • CR3 complement receptor 3
  • C3 complement receptor 3
  • complement receptor CR1 complement receptor 3
  • the humanized anti-C lq antibodies of the present disclosure may be used to treat, prevent, or improve one or more symptoms of a neurodegenerative disorder of the present disclosure.
  • the present disclosure provides methods of treating, preventing, or improving one or more symptoms in individuals having a neurodegenerative disorder of the present disclosure by administering a humanized anti- Clq antibody of the present disclosure to, for example, inhibit the interaction between Clq and an autoantibody, the interaction of Clq and Clr, and/or the interaction of Clq and Cls.
  • Inflammatory or autoimmune diseases that may be treated with humanized anti- Clq antibodies of this disclosure include, without limitation, rheumatoid arthritis (RA), acute respiratory distress syndrome (ARDS), remote tissue injury after ischemia and reperfusion, complement activation during cardiopulmonary bypass surgery,
  • RA rheumatoid arthritis
  • ARDS acute respiratory distress syndrome
  • remote tissue injury after ischemia and reperfusion complement activation during cardiopulmonary bypass surgery
  • autoimmune disease may further include, without limitation, Guillain-Barre syndrome, myasthenia gravis, Diabetes mellitus type 1, Hashimoto's thyroiditis, Addison's disease, Coeliac disease, Crohn's disease, pernicious anaemia, Pemphigus vulgaris, vitiligo, autoimmune hemolytic anemias, paraneoplastic syndromes, a vasculitis disease, hypocomplementemic urticarial vasculitis (HUV), polymyalgia rheumatica, temporal arteritis, and Wegener's
  • UAV hypocomplementemic urticarial vasculitis
  • Autoantibodies activate the complement system.
  • NMO Neuromyelitis Optica
  • the classical complement pathway is triggered by the binding of an autoantibody, such as an AQP4-targeted autoantibody, to its autoantigen, AQP4.
  • AQP4 thereby activates the classical pathway of complement activation.
  • complement factor Clq binds to the autoantibody-autoantigen-immune complex.
  • Autoantibodies may include naturally occurring antibodies, such as serum antibodies from NMO patients (commonly referred to as NMO-IgG) or monoclonal antibodies, such as rAb-53.
  • the humanized anti-Clq antibodies of the present disclosure may be used to treat, prevent, or improve one or more symptoms of an inflammatory or autoimmune disease of the present disclosure.
  • the present disclosure provides methods of treating, preventing, or improving one or more symptoms in individuals having an inflammatory or autoimmune disease of the present disclosure by administering a humanized anti-Clq antibody of the present disclosure to, for example, inhibit the interaction between Clq and an autoantibody, the interaction of Clq and Clr, and/or the interaction of Clq and Cls.
  • Metabolic diseases that may be treated with humanized anti-Clq antibodies include, without limitation, diabetes, such as type II diabetes, and obesity.
  • diabetes such as type II diabetes, and obesity.
  • in vitro and in vivo models of metabolic disorders that can be used for the testing of humanized anti-Clq antibodies are well known in the art. Accordingly, the humanized anti-Clq antibodies of the present disclosure may be used to treat, prevent, or improve one or more symptoms of a metabolic disease of the present disclosure.
  • the present disclosure provides methods of treating, preventing, or improving one or more symptoms in individuals having metabolic disease of the present disclosure by administering a humanized anti-Clq antibody of the present disclosure to, for example, inhibit the interaction between Clq and an autoantibody, such as an anti-ganglioside autoantibody, the interaction of Clq and Clr, and/or the interaction of Clq and Cls.
  • an autoantibody such as an anti-ganglioside autoantibody
  • the antibodies of the present disclosure may be used, without limitation, in combination with any additional treatment for neurodegenerative disorders, inflammatory disorders, and/or autoimmune disorders.
  • a humanized anti-Clq antibody of this disclosure is administered in therapeutically effective amounts in combination with a second anti- complement factor antibody ⁇ e.g., a neutralizing anti-complement factor antibody), such as an anti-Cls or anti-Clr antibody, or a second anti-Clq antibody.
  • a humanized anti-Clq antibody of this disclosure is administered in therapeutically effective amounts with a second and a third neutralizing anti-complement factor antibody, such as a second anti-Clq antibody, an anti-Cls antibody, and/or an anti-Clr antibody.
  • the humanized anti-Clq antibodies of this disclosure are administered in combination with an inhibitor of antibody-dependent cellular cytotoxicity (ADCC).
  • ADCC inhibitors may include, without limitation, soluble NK cell inhibitory receptors such as the killer cell Ig-like receptors (KIRs), which recognize HLA-A, HLA-B, or HLA-C and C-type lectin CD94/NKG2A heterodimers, which recognize HLA-E ⁇ see, e.g., Lopez-Botet M., T. Bellon, M. Llano, F. Navarro, P. Garcia & M. de Miguel. (2000), Paired inhibitory and triggering NK cell receptors for HLA class I molecules. Hum.
  • KIRs killer cell Ig-like receptors
  • CD94/NKG2A heterodimers which recognize HLA-E ⁇ see, e.g., Lopez-Botet M., T. Bellon, M. Llano, F. Navarro, P. Garcia & M.
  • the humanized anti-Clq antibodies of this disclosure are administered in combination with an inhibitor of the alternative pathway of complement activation.
  • inhibitors may include, without limitation, factor B blocking antibodies, factor D blocking antibodies, soluble, membrane -bound, tagged or fusion-protein forms of CD59, DAF, CR1, CR2, Crry or Comstatin-like peptides that block the cleavage of C3, non-peptide C3aR antagonists such as SB 290157, Cobra venom factor or non-specific complement inhibitors such as nafamostat mesilate (FUTHAN; FUT-175), aprotinin, K-76 monocarboxylic acid (MX-1) and heparin (see, e.g., T.E.
  • the humanized anti- Clq antibodies of this disclosure are administered in combination with an inhibitor of the interaction between the autoantibody and its autoantigen.
  • inhibitors may include purified soluble forms of the autoantigen, or antigen mimetics such as peptide or RNA- derived mimotopes, including mimotopes of the AQP4 antigen.
  • inhibitors may include blocking agents that recognize the autoantigen and prevent binding of the autoantibody without triggering the classical complement pathway.
  • blocking agents may include, e.g., autoantigen-binding RNA aptamers or antibodies lacking functional Clq binding sites in their Fc domains (e.g., Fab fragments or antibody otherwise engineered not to bind Clq).
  • the humanized anti-Clq antibodies of the present disclosure, or functional fragments thereof also have diagnostic utility.
  • This disclosure therefore provides methods of using the antibodies of this disclosure, or functional fragments thereof, for diagnostic purposes, such as the detection of Clq in an individual or in tissue samples derived from an individual.
  • the individual is a human.
  • the individual is a human patient suffering from a neurodegenerative disorder or an
  • the humanized anti-Clq antibodies of this disclosure are used to detect synapses and synapse loss.
  • synapse loss may be measured in an individual suffering from a neurodegenerative disorder such as Alzheimer's disease or glaucoma.
  • the diagnostic methods involve the steps of administering a humanized anti-Clq antibody of this disclosure, or functional fragment thereof, to an individual and detecting the antibody bound to a synapse of the individual.
  • Antibody- binding to synapses may be quantified, for example, by non-invasive techniques such as positron emission tomography (PET), X-ray computed tomography, single-photon emission computed tomography (SPECT), computed tomography (CT), and computed axial tomography (CAT).
  • PET positron emission tomography
  • SPECT single-photon emission computed tomography
  • CT computed tomography
  • CAT computed axial tomography
  • the diagnostic methods involve detecting synapses in a biological sample, such as a biopsy specimen, a tissue, or a cell.
  • a humanized anti-Clq antibody, or functional fragment thereof is contacted with the biological sample and synapse-bound antibody is detected.
  • the detection method may involve quantification of the synapse-bound antibody.
  • Antibody detection in biological samples may occur with any method known in the art, including immunofluorescence microscopy,
  • the antibody is radiolabeled, for example with 18 F and subsequently detected utilizing micro- positron emission tomography analysis.
  • the quantification of synapse-bound antibodies provides a relative measure for the number of synapses present in the individual. Typically, synapses are quantified repeatedly over a period of time. The exact periodicity of synapse quantification depends on many factors, including the nature of the neurodegenerative disease, the stage of disease progression, treatment modalities and many other factors. Repeat measurements commonly reveal progressive synapse loss in individuals having a neurodegenerative disorder.
  • relative synapse counts may be compared in populations of diseased individuals and healthy control individuals at a single time point.
  • the treatment's efficacy can be assessed by comparing the rates of synapse loss in the treated individuals with the rates of synapse loss in a control group.
  • Control group members have received either no treatment or a control treatment, such as a placebo control.
  • kits containing a humanized anti-Clq antibody of the present disclosure include one or more containers comprising a purified humanized anti-Clq antibody of this disclosure.
  • the kits further include instructions for use in accordance with the methods of this disclosure.
  • these instructions comprise a description of administration of the humanized anti-C lq antibody to treat or diagnose a disease associated with complement activation including, without limitation a neurodegenerative disorder (e.g., Alzheimer's disease), inflammatory disease, autoimmune disease, and/or metabolic disorder, according to any methods of this disclosure.
  • the instructions comprise a description of how to detect Clq, for example in an individual, in a tissue sample, or in a cell.
  • the kit may further comprise a description of selecting an individual suitable for treatment based on identifying whether that individual has the disease and the stage of the disease.
  • the instructions generally include information as to dosage, dosing schedule, and route of administration for the intended treatment.
  • the containers may be unit doses, bulk packages (e.g. , multi-dose packages) or sub-unit doses. Instructions supplied in the kits of the present disclosure are typically written instructions on a label or package insert (e.g. , a paper sheet included in the kit), but machine -readable instructions (e.g., instructions carried on a magnetic or optical storage disk) are also acceptable.
  • the label or package insert indicates that the composition is used for treating, e.g., a neurodegenerative disease. Instructions may be provided for practicing any of the methods described herein.
  • kits of this disclosure are in suitable packaging.
  • suitable packaging includes, but is not limited to, vials, bottles, jars, flexible packaging (e.g. , sealed Mylar or plastic bags), and the like.
  • packages for use in combination with a specific device such as an inhaler, nasal administration device (e.g. , an atomizer) or an infusion device such as a minipump.
  • a kit may have a sterile access port (for example the container may be an intravenous solution bag or a vial having a stopper pierceable by a hypodermic injection needle).
  • the container may also have a sterile access port (e.g.
  • the container may be an intravenous solution bag or a vial having a stopper pierceable by a hypodermic injection needle). At least one active agent in the composition is an inhibitor of classical complement pathway.
  • the container may further comprise a second pharmaceutically active agent.
  • Kits may optionally provide additional components such as buffers and interpretive information. Normally, the kit comprises a container and a label or package insert(s) on or associated with the container.
  • This example describes the generation of fully humanized antibodies from the murine hybridoma Ml (expressing the mouse anti-human Clq antibody Ml).
  • Composite human antibody variable region genes were generated using synthetic oligonucleotides encoding combinations of selected human sequence segments. These were then cloned into vectors encoding human IgG4 (S241P L248E) heavy chain and human kappa light chain.
  • Humanized antibodies were stably expressed in NSO (mouse myeloma cell-line) cells, Protein A purified and tested for binding to human Clq using a competition ELISA assay against biotinylated murine Ml antibody. Selected antibodies were also tested for binding to mouse Clq using competition ELISA assay against biotinylated chimeric antibody.
  • VH region amplification products of the expected size were found in IgG primer pools HB and HE.
  • VK region amplification products of the expected size were found in kappa primer pools KC, KE, and KG.
  • the PCR products obtained from each of the successful amplifications were purified and cloned into a 'TA' cloning vector (pGEM-T Easy, Promega cat. no. A1360) and sequenced. A total of 14 VH and 24 VK clones were sequenced.
  • a single functional VH gene was identified in 14 clones from IgG pools HB and HE.
  • a single functional VK gene sequence was identified from 9 clones from primer pool KC. The 3' coding sequence downstream of the variable region obtained from IgG primer pools was consistent with the antibody isotype being IgG.
  • VH and VK gene sequences were identical to the hybridoma sequences with the exception of five amino acids at the beginning of the VH sequence and two amino acids at the beginning of the VK sequence. These differences were most likely due to the method of sequencing, and were a result of using primers that are degenerate to the signal sequence rather than primers that are degenerate to 5' end of V regions.
  • amino acid sequence of the functional VH is:
  • amino acid sequence of the functional VK is:
  • DVQITQSPSYLAASPGETITINCRASKSINKYLAWYQEKPG TNKLLIYSGSTLOSG IPSRFSGSGSGTDFTLTISSLEPEDFAMYYCOOHNEYPLTFGAGTKLEL (SEQ ID NO: 22).
  • the hyper variable regions (HVRs) of the VK are depicted in bolded and underlined text.
  • VH and VK sequences of the murine Ml antibody were PCR amplified using primers that introduced flanking restriction enzyme sites for cloning into the IgG4 (S241P L248E) heavy and kappa chain expression vectors (FIG. 1).
  • the BamHl, HindlU and Sspl restriction sites were removed from the VK sequence in order to clone the gene.
  • the VH region was cloned using Mlul and HindlU sites, and the VK region was cloned using BssHll and BamHl restriction sites. Both constructs were confirmed by sequencing. Design of composite human variable region sequences
  • VH1-VH4 heavy chain sequences
  • VKI - VK4 light chain sequences
  • VH heavy chain variable domain
  • VK kappa light chain variable domain
  • VH1 heavy chain variable domain variant 1
  • the amino acid sequence of heavy chain variable domain variant 1 is: QVQLVQSGAELKKPGASV VSC SSGYHFTSYWMHWV QAPGQGLEWIGVIHP NSGSINYNEKFESKATITVD STSTAYMQLSSLTSEDSAVYYCAGERDSTEVLPM DYWGQGTSVTVSS (SEQ ID NO: 1).
  • the hyper variable regions (HVRs) of VH1 are depicted in bolded and underlined text.
  • VH2 heavy chain variable domain variant 2
  • the amino acid sequence of heavy chain variable domain variant 2 is: QVQLVQSGAELKKPGASV VSC SSGYHFTSYWMHWV QAPGQGLEWIGVIHP NSGSINYNEKFESRATITVD STSTAYMELSSLRSEDTAVYYCAGERDSTEVLPM DYWGQGTTVTVSS (SEQ ID NO: 2).
  • the hyper variable regions (HVRs) of VH2 are depicted in bolded and underlined text.
  • VH3 heavy chain variable domain variant 3
  • the amino acid sequence of heavy chain variable domain variant 3 is: QVQLVQSGAELKKPGASV VSC SSGYHFTSYWMHWV QAPGQGLEWIGVIHP NSGSINYNEKFESRVTITVD STSTAYMELSSLRSEDTAVYYCAGERDSTEVLPM DYWGQGTTVTVSS (SEQ ID NO: 3).
  • the hyper variable regions (HVRs) of VH3 are depicted in bolded and underlined text.
  • VH4 The amino acid sequence of heavy chain variable domain variant 4 (VH4) is:
  • VH4 NSGSINYNEKFESRVTITVD STSTAYMELSSLRSEDTAVYYCAGERDSTEVLPM DYWGQGTTVTVSS (SEQ ID NO: 4).
  • the hyper variable regions (HVRs) of VH4 are depicted in bolded and underlined text.
  • the HVR-H 1 of any one of VH 1 , VH2, VH3 , or VH4 has the sequence GYHFTSYWMH (SEQ ID NO: 23), the HVR-H2 of V any one of VH1, VH2, VH3, or VH4 has the sequence VIHPNSGSINYNEKFES (SEQ ID NO: 24), and the HVR-H3 of any one of VH1, VH2, VH3, or VH4 has the sequence ERDSTEVLPMDY (SEQ ID NO: 25).
  • VH1 heavy chain variable domain variant 1
  • VH2 heavy chain variable domain variant 2
  • VH3 heavy chain variable domain variant 3
  • VH4 heavy chain variable domain variant 4
  • VKI kappa light chain variable domain variant 1
  • VK2 kappa light chain variable domain variant 2
  • VK3 kappa light chain variable domain variant 3
  • the hyper variable regions (HVRs) of VK3 are depicted in bolded and underlined text.
  • VK4 kappa light chain variable domain variant 4
  • the HVR-L1 of any one of VKI , VK2, VK3, or VK4 has the sequence has the sequence RASKSINKYLA (SEQ ID NO: 30)
  • the HVR-L2 of any one of VKI , VK2, VK3, or VK4 has the sequence SGSTLQS (SEQ ID NO: 31)
  • the HVR-L3 of any one of VKI , VK2, VK3, or VK4 has the sequence QQHNEYPLT (SEQ ID NO: 32).
  • VKI kappa light chain variable domain variant 1
  • VK2 kappa light chain variable domain variant 2
  • VK3 kappa light chain variable domain variant 3
  • VK4 kappa light chain variable domain variant 4
  • amino acid sequence of human IgG4 (S241P L248E) heavy chain constant domain is:
  • amino acid sequence of the human IgG4 (S241P L248E) hinge region is: ESKYGPPCPPCP (SEQ ID NO: 39).
  • S241P mutation is depicted in bolded and underlined text.
  • amino acid sequence of the human IgG4 (S241P L248E) CH2 is:
  • the nucleic acid sequence encoding human IgG4 (S241P L248E) heavy chain constant domain is:
  • the nucleic acid sequence encoding the human IgG4 (S241P L248E) heavy chain CHI is:
  • CAACACCAAGGTGGACAAGAGAGTTG (SEQ ID NO: 43).
  • the nucleic acid sequence encoding the human IgG4 (S241P L248E) heavy chain hinge is:
  • the nucleic acid sequence encoding the human IgG4 (S241P L248E) heavy chain CH2 is:
  • AAGCCAAAG (SEQ ID NO: 45).
  • the nucleic acid sequence encoding the human IgG4 (S241P L248E) heavy chain CH3 is:
  • FIG. 2 shows an alignment of the amino acid sequences of the heavy chain variable region (VH) of Ml and the amino acid sequences of the humanized VH variants VH1-VH4, and of the amino acid sequences of the kappa light chain variable region (VK) of Ml and the amino acid sequences of the humanized VK variants VK1-VK4.
  • a total of 16 fully humanized antibodies were stably transfected into NS0 cells via electroporation.
  • the chimeric antibody Ml along with two controls - chimeric VH (ChVH) with variant VKI and variant VH1 with chimeric VK (CIIVK) - were included.
  • Stable transfectants were selected using 200 iiM methotrexate (Sigma Cat. No. M8407). Methotrexate-resistant colonies for each construct were tested for IgG expression levels using an IgG4 ELISA, and the best expressing lines were selected, expanded and frozen under liquid nitrogen.
  • Antibodies were purified from cell culture supernatants on a Protein A sepharose column (GE Healthcare cat. co. 110034-93), buffer exchanged into PBS, pH 7.4 and quantified by OD 2 80nm using an extinction coefficient based on the predicted amino acid sequences. Chimeric and humanized variant IgGs were analyzed by reducing SDS-PAGE. Bands corresponding to the predicted sizes of the VH and VK chains were observed with no evidence of any aggregation, degradation or other unusual features (FIG. 3). Competition ELISA against human Clq antigen
  • FIG. 4 shows that all humanized Ml variants generated have similar binding profiles to the chimeric Ml antibody.
  • the binding curves were used to calculate IC 50 values (concentration of test antibody that inhibits labelled competitor binding by 50%) for each antibody normalized to the IC 50 of chimeric Ml and antibody yields from NS0 transfectants were also compared (Table 1).
  • Table 1 shows calculated relative IC 50 values for humanized Ml variants binding to human Clq and protein expression levels of corresponding NS0 cell line.
  • the normalized IC 50 data for all variants tested were in the range of 0.63 to 1.15 indicating that the binding efficiencies of all of the fully humanized Ml antibodies to human C lq were comparable to that of chimeric Ml . Furthermore, most humanized variants achieved an increase in expression level compared to the chimeric antibody.
  • the binding of chimeric Ml antibody was detected with streptavidin-peroxidase conjugate (Sigma-Aldrich cat. no. S5512) and TMB substrate (Thermo Scientific cat. no. 34029). The reaction was stopped with 1M HC1, absorbance read at 450 nm on a Dynex Technologies MRX TC II plate reader and the binding curves plotted.
  • FIG. 5 shows that humanized Ml variants generated have similar binding profiles to the chimeric Ml antibody.
  • the binding curves were used to calculate IC 50 values for each antibody normalized to the IC 50 of chimeric Ml (Table 2).
  • Table 2 shows calculated relative IC 50 values for humanized Ml variants binding to mouse Clq.
  • V region genes from the murine antibody Ml were cloned into vectors to generate a chimeric antibody comprising the murine V regions combined with the human IgG4 (S241P L248E) heavy chain constant region and ⁇ light chain constant regions.
  • Immunological biosensors for example BiacoreTM surface plasmon resonance (SPR) instruments, that measure the binding and dissociation of antigen-antibody complexes in real time allow the elucidation of binding kinetics. The rate of dissociation and its subsequent optimization is especially important for biopharmaceutical antibody development.
  • SPR surface plasmon resonance
  • the Biacore uses SPR to monitor the interaction between a surface bound molecule 'ligand' and its binding partner in solution 'analyte', in real time.
  • SPR is an electron charge-density wave phenomenon, which arises at the surface of a metallic layer when light is reflected at the layer under conditions of total internal reflectance.
  • the surface plasmons that are generated are sensitive to any changes in the refractive index of the medium on the opposite side of the metallic layer from the reflected light. Protein-protein interactions occurring at the surface affect the refractive index of the medium and can therefore be detected.
  • Binding of molecules to the ligand modified sensor surface generates a response, which is proportional to the bound mass allowing small changes in the amount of bound analyte to be detected (down to low picogram levels).
  • the technique can be used to measure affinity constants (K D ) over the range 10 ⁇ 5 M to 10 ⁇ 12 M, association rate constants (k a) between 10 3 M ' V 1 and 10 7 M ' V 1 , and dissociation rate constants (kd) between 10 "1 s _1 and 10 "6 s "1 .
  • This example describes the kinetic characterization of the interaction between the humanized anti-Clq antibody VH3/VK3 (both Fab fragment and full-length IgG) and the Clq protein utilizing the Biacore T200 surface plasmon resonance instrument for the high resolution.
  • Biacore Preventative Maintenance Kit 2 BR- 1006-51 , Lot No . 164110
  • BSA was obtained from Sigma (A3294).
  • the Fab fragment of the anti-Clq humanized antibody VH3/VK3 was prepared using a Fab Micro Preparation Kit following the manufacturer's protocol. The starting concentration of the full-length IgG VH3/VK3 was 1.88 mg/ml. To obtain sufficient amount of the Fab fragments, 6 reactions of 225 ⁇ g each of full-length IgG were digested, pooled, and purified. The purified Fab and the full-length IgG were further purified by size exclusion chromatography using a Superdex 200 Increase 10/300 GL column (GE
  • FIG. 6 depicts a Coomassie Blue-stained SDS-PAGE gel of gel filtration-purified antibodies. 1 ⁇ g of each sample was loaded on a NuPage 4-12% Bis-Tris gel (Invitrogen Cat. No. NP0322BOX) and run at 200V for 35min.
  • Size marker is prestained protein standard Fermentas PageRuler Plus (Cat. No. SM1811). Lane 1 shows the reduced VH3/VK3 Fab; lane 2 shows the non- reduced VH3/VK3 Fab; lane 3 shows the reduced VH3/VK3 IgG; and lane 4 shows the non- reduced VH3/VK3 IgG.
  • CM5 chip Upon insertion of a CM5 chip the system was primed and then normalized with BIA normalizing solution (Biacore Preventative Maintenance Kit 2). All samples were run at 25°C with a sample rack incubated at 10°C. The chip was added to the system with HBS- EP used as the running buffer; prior to immobilization the chip surface was primed with two injections of 50 mM NaOH.
  • BIA normalizing solution Biacore Preventative Maintenance Kit 2
  • Table 4 depicts the final immobilization levels achieved from Chips Al l and A13 for each flow cell (F c ).
  • NBS Non-specific binding
  • Non-specific binding can be due to either the analyte or analyte contaminants, interacting with the ligand (non-specific and difficult to detect), the capture protein, or the sensor chip surface.
  • the ligand non-specific and difficult to detect
  • the capture protein or the sensor chip surface.
  • NBS non-specific binding
  • the BSA blocking step was also repeated on the reference channel (Fcl); for both, immobilization levels were -8000 RU. No NSB was observed using Fab, or IgG at 500 nM on the CM5 surface, and at the concentration used in the kinetic runs, no NSB to the BSA blocked surface was seen.
  • Mass transport limitation occurs when the rate of association contains a significant component associated with the rate of transport of the analyte to and from the chip surface. Where mass transfer is found to be significant, the resulting kinetic analysis could be inaccurate. Lowering the density of immobilized ligand, or increasing the flow rate, can reduce mass transport limitations. From previous experience of using low density surfaces and similar MW antigens a flow rate of 40 was selected for this study.
  • the linked reaction control experiment is used to assess the ligand-analyte interaction to check for deviations from a 1-to-l binding model.
  • the analyte is injected over the surface for different periods of time (contact times) and the dissociation rate is analyzed to determine if it varies with the contact time. If such a relationship is observed, it indicates that a second interaction event is taking place after the initial binding event that results in a stabilized complex at the surface.
  • a 1 : 1 binding model was initially assumed for all ligand/complex interactions (see Equation 2). Due to ligand activity and drift in the baseline (BSA blocked surfaces) the parameter R max was set to local as opposed to global analysis for selected kinetic analyses. If necessary, additional models, such as Heterogeneous Ligand (see Equation 3) and Bivalent Binding (see Equation 4), were also assessed for goodness of fit.
  • Equation 2 1-to-l binding:
  • Equation 3 Heterogeneous ligand:
  • Equation 4 Bivalent (Avidity):
  • Kinetic data was obtained at a flow rate of 40 to minimize any potential mass transfer effects.
  • Two repeats of the blank (no antigen) and a single concentration of the analyte were programmed into the kinetic run in order to check the stability of both the surface and analyte over the kinetic cycles.
  • 3.33-fold dilutions of analyte were run.
  • 2-fold dilution range was selected.
  • association phase was monitored for 500 seconds to allow some of the higher concentrations of analyte to reach steady state.
  • dissociation was measured for up to 10,800 seconds to allow sufficient dissociation to occur for accurate assessment of the kinetics.
  • the signal from the reference channel F c l was subtracted from that of F c 2, F c 3, and F c 4.
  • the kinetic parameters for the interaction of mClq and the Fab fragment of VH3/VK3 in various assay formats are shown in Table 5.
  • the K D value for mClq when used as an analyte was 123 nM
  • the K D value for mClq when used as a ligand was 677 nM.
  • the difference in the KD values reported could be due to the mode of interaction or the effect of chemically coupling a multi-subunit mClq to a surface, resulting in changes to the secondary or tertiary structure of the protein.
  • Table 5 depicts the kinetic parameters for the 1-to-l interactions of mClq and Fab as determined using the Biacore T200.
  • the Chi2 values show how well the association and dissociation data fits the proposed binding model. The lower the value the better the fit.
  • the associated SE values for the rate constants represent the uncertainty associated with fitting the data to the model described, and do not represent the total uncertainty for the true kinetic values.
  • the mean response data represents the average kinetic values and the associated SD from 2 independent analyses.
  • Table 6 depicts the kinetic parameters for the 1-to-l interactions of hClq with Fab, or IgG as determined using the Biacore T200. Legend as Table 5. Data highlighted in red indicate poor fitting criteria, these data sets have therefore been analyzed using a more complex model (Table 7).
  • Table 7 depicts the kinetic parameters for the heterogeneous ligand interactions of hClq and Fab, or IgG as determined using the Biacore T200. Legend as Table 5. Data fit to a heterogeneous ligand model to represent the expected heterogeneity of immobilizing a multi-subunit protein on a surface.
  • the humanized anti-Clq antibodies utilized in this example were produced as described in Example 1.
  • the following humanized antibodies from Example 1 were utilized: the antibody VHWKI (2B12), the antibody VH3/VK3 (5H7), the antibody VH3/VK4 (3F1), and the antibody VH4/VK3 (1D3).
  • the mouse monoclonal antibody Ml (ANN-005) and the chimeric Ml antibody (3E2) were also utilized as controls.
  • CH50 assays were conducted essentially as described in Current Protocols in Immunology (1994) Supplement 9 Unit 13.1.
  • 5 microliters ( ⁇ ) of human serum (Cedarlane, Burlington, NC) or 0.625 ⁇ of Wistar rat serum was diluted to 50 ⁇ of GVB buffer (Cedarlane, Burlington, NC) and added to 50 ⁇ of the humanized antibodies (1 ⁇ g) diluted in GVB buffer.
  • the antibody:serum mixture was pre-incubated for 30 minutes on ice and then added to 100 ⁇ of EA cells (2xl0 8 /ml) for both rat and human assays.
  • the EA cells were generated exactly as specified in Current Protocols using Sheeps blood in Alsever's (Cedarlane Cat #CL2581) and hemolysin (Cedalane Cat #CL9000).
  • the EA cells, serum and antibody mixture was incubated for 30 minutes at 37°C. and then placed on ice. Next 1.2 ml of 0.15 M NaCl was added to the mixture and the OD412 of the sample was read in a spectrophotometer to determine the amount of cell lysis.
  • the percent inhibition of the test antibodies was determined relative to a control mouse IgGl antibody (Abeam ab 18447).
  • the VH3/VK3 antibody (5H7) inhibited CH50 hemolysis in a dose-dependent manner to degree that was comparable to both the murine Ml antibody and the chimeric Ml antibody (FIG. 7A). Moreover, approximately 60 ng of the VH3/VK3 antibody (5H7), the VH4/VK3 antibody (1D3), and the VHWKI antibody (2B12) was required to inhibit 50% of the hemolysis observed (FIG. 7A). Approximately 250 ng of the antibody VH3/VK4 (3F1) was required to inhibit approximately 95% of the hemolysis observed (FIG. 7A).
  • the VHI/VKI antibody (2B12) inhibited CH50 hemolysis in a dose-dependent manner to degree that was comparable to both the murine Ml antibody and the chimeric Ml antibody (FIG. 7B). Moreover, approximately 60 ng of the VHWKI antibody (2B12), the antibody VH3/VK4 (3F1), the VH3/VK3 antibody (5H7), and the VH4/VK3 antibody (1D3) was required to inhibit approximately 50% to approximately 80% of the hemolysis observed (FIG. 7B).
  • Example 4 Intravenous dosing study in monkey to evaluate pharmacokinetics of humanized anti-Clq antibody, pharmacodynamic effects on serum Clq levels and ex- vivo complement mediated hemolysis
  • Blood samples were collected at the following time points - Day 1 : pre-study, 0.5, 2, 4, 8, 12, 24, 72, 96 and 120 hours post dose and on Days: 7, 9, 12, 15, 18 and 21. Blood samples were allowed to clot, serum was separated by centrifugation and then stored frozen at -80C until analysis.
  • phosphatase conjugated antibodies Ml or JL1 were added, at a final concentration of 200- 400 ng/mL in assay buffer. Samples were incubated overnight with shaking at 4C. Next day, plates were washed three times in DPBS containing 0.05% tween. Each wash was for a duration of 10 minutes with shaking at 300 rpm on a plate shaker. Plates were then tapped dry and developed using alkaline phosphatase substrate incubation for 20 minutes.
  • Luminescence counts were read on a Perkin Elmer envision reader. Standard curves were fit using 4PL logistic fit and unknown signal counts were converted to concentration, dilution correction and then plotted using Graphpad Prism.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Chemical & Material Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Immunology (AREA)
  • Organic Chemistry (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Biomedical Technology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Hematology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Molecular Biology (AREA)
  • Urology & Nephrology (AREA)
  • Biochemistry (AREA)
  • Neurology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Microbiology (AREA)
  • Neurosurgery (AREA)
  • Physics & Mathematics (AREA)
  • Biotechnology (AREA)
  • Cell Biology (AREA)
  • Food Science & Technology (AREA)
  • Pathology (AREA)
  • Analytical Chemistry (AREA)
  • General Physics & Mathematics (AREA)
  • Diabetes (AREA)
  • Epidemiology (AREA)
  • Rheumatology (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Ophthalmology & Optometry (AREA)
  • Rehabilitation Therapy (AREA)
  • Pulmonology (AREA)
PCT/US2015/059185 2014-11-05 2015-11-05 Humanized anti-complement factor c1q antibodies and uses thereof Ceased WO2016073685A1 (en)

Priority Applications (22)

Application Number Priority Date Filing Date Title
PL15857258.6T PL3215527T3 (pl) 2014-11-05 2015-11-05 Humanizowane przeciwciała przeciwko czynnikowi dopełniacza C1Q i ich zastosowanie
RS20250249A RS66604B1 (sr) 2014-11-05 2015-11-05 Humanizovana antitela na faktor komplementa c1q i njihova upotreba
AU2015343029A AU2015343029B2 (en) 2014-11-05 2015-11-05 Humanized anti-complement factor C1q antibodies and uses thereof
SM20250118T SMT202500118T1 (it) 2014-11-05 2015-11-05 Anticorpi umanizzati anti-fattore del complemento c1q e utilizzi degli stessi
SI201532057T SI3215527T1 (sl) 2014-11-05 2015-11-05 Humanizirana protitelesa proti komplementnemu faktorju C1q in njihova uporaba
HRP20250246TT HRP20250246T1 (hr) 2014-11-05 2015-11-05 Humanizirana protutijela na faktor komplementa c1q i njihova uporaba
BR112017009297-2A BR112017009297B1 (pt) 2014-11-05 2015-11-05 Anticorpos antifator de complemento c1q humanizados, composição farmacêutica e kit compreendendo os mesmos, uso terapêutico destes,polinucleotídeo isolado, célula hospedeira isolada, bem como métodos in vitro para detectar sinapses
CA2966894A CA2966894C (en) 2014-11-05 2015-11-05 Humanized anti-complement factor c1q antibodies and uses thereof
LTEPPCT/US2015/059185T LT3215527T (lt) 2014-11-05 2015-11-05 Humanizuoti antikūnai prieš komplemento faktorių c1q ir jų panaudojimas
HK18103938.9A HK1244494B (en) 2014-11-05 2015-11-05 Humanized anti-complement factor c1q antibodies and uses thereof
SG11201703667SA SG11201703667SA (en) 2014-11-05 2015-11-05 Humanized anti-complement factor c1q antibodies and uses thereof
KR1020177015260A KR102626877B1 (ko) 2014-11-05 2015-11-05 인간화 항-보체 인자 c1q 항체 및 이의 용도
FIEP15857258.6T FI3215527T3 (fi) 2014-11-05 2015-11-05 Humanisoituja anti-komplementtitekijä c1q -vasta-aineita ja niiden käyttöjä
EP15857258.6A EP3215527B1 (en) 2014-11-05 2015-11-05 Humanized anti-complement factor c1q antibodies and uses thereof
CN201580072390.6A CN107207587B (zh) 2014-11-05 2015-11-05 人源化抗-补体因子c1q抗体及其应用
JP2017543310A JP6951246B2 (ja) 2014-11-05 2015-11-05 ヒト化抗補体因子C1q抗体及びその使用
ES15857258T ES3013108T3 (en) 2014-11-05 2015-11-05 Humanized anti-complement factor c1q antibodies and uses thereof
NZ732156A NZ732156B2 (en) 2015-11-05 Humanized anti-complement factor c1q antibodies and uses thereof
EP23197405.6A EP4295911A3 (en) 2014-11-05 2015-11-05 Humanized anti-complement factor c1q antibodies and uses thereof
DK15857258.6T DK3215527T3 (da) 2014-11-05 2015-11-05 Humaniserede antikomplementfaktor c1q-antistoffer og anvendelser deraf
IL252026A IL252026B (en) 2014-11-05 2017-04-30 Humanized anti-complement factor c1q antibodies and uses thereof
JP2021155093A JP7275223B2 (ja) 2014-11-05 2021-09-24 ヒト化抗補体因子C1q抗体及びその使用

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201462075793P 2014-11-05 2014-11-05
US62/075,793 2014-11-05

Publications (1)

Publication Number Publication Date
WO2016073685A1 true WO2016073685A1 (en) 2016-05-12

Family

ID=55909791

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2015/059185 Ceased WO2016073685A1 (en) 2014-11-05 2015-11-05 Humanized anti-complement factor c1q antibodies and uses thereof

Country Status (21)

Country Link
US (4) US10316081B2 (https=)
EP (2) EP3215527B1 (https=)
JP (2) JP6951246B2 (https=)
KR (1) KR102626877B1 (https=)
CN (1) CN107207587B (https=)
AU (1) AU2015343029B2 (https=)
BR (1) BR112017009297B1 (https=)
DK (1) DK3215527T3 (https=)
ES (1) ES3013108T3 (https=)
FI (1) FI3215527T3 (https=)
HR (1) HRP20250246T1 (https=)
HU (1) HUE070383T2 (https=)
IL (1) IL252026B (https=)
LT (1) LT3215527T (https=)
PL (1) PL3215527T3 (https=)
PT (1) PT3215527T (https=)
RS (1) RS66604B1 (https=)
SG (2) SG11201703667SA (https=)
SI (1) SI3215527T1 (https=)
SM (1) SMT202500118T1 (https=)
WO (1) WO2016073685A1 (https=)

Cited By (18)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP2996722A4 (en) * 2013-05-15 2017-01-11 Annexon, Inc. Methods of treatment for guillain-barre syndrome
WO2017091719A1 (en) * 2015-11-24 2017-06-01 Annexon, Inc. Anti-complement factor c1q fab fragments and uses thereof
WO2018081250A1 (en) * 2016-10-26 2018-05-03 The Board Of Trustees Of The Leland Stanford Junior University Neuronal and oligodendrocyte survival modulation
US10227398B2 (en) 2013-07-09 2019-03-12 Annexon, Inc. Anti-complement factor C1q antibodies and uses thereof
EP3487531A4 (en) * 2016-07-19 2020-03-25 Annexon, Inc. TREATMENT OF FRONTO-TEMPORAL DEMENTIA
EP3454901A4 (en) * 2016-05-09 2020-07-29 Annexon, Inc. COMPOSITIONS AND METHODS FOR TREATING PROGRESSIVE SPINAL AMYOTROPHY
CN111556895A (zh) * 2017-11-14 2020-08-18 中外制药株式会社 抗-c1s抗体及使用方法
GB2584105A (en) * 2019-05-21 2020-11-25 Argenx Bvba Methods of treating neuropathy
CN112313249A (zh) * 2018-04-13 2021-02-02 中外制药株式会社 抗补体组分抗体及使用方法
EP3650547A4 (en) * 2017-07-06 2021-03-10 Nitto Boseki Co., Ltd. MONOCLONAL ANTI-HUMAN IGG4 ANTIBODY AND HUMAN IGG4 ASSAY REAGENT USING THIS ANTIBODY
EP3873525A4 (en) * 2018-11-02 2022-07-13 Annexon, Inc. COMPOSITIONS AND METHODS FOR TREATMENT OF BRAIN INJURIES
US11591386B2 (en) 2018-12-13 2023-02-28 argenx BV Antibodies to human complement C2B
WO2023047125A1 (en) 2021-09-24 2023-03-30 Reflection Therapeutics Limited Targeted cell therapies
WO2023047124A2 (en) 2021-09-24 2023-03-30 Reflection Therapeutics Limited Targeted cell therapies
CN115996752A (zh) * 2020-05-05 2023-04-21 J·大卫格莱斯顿研究所-根据J·大卫格莱斯顿遗嘱的遗嘱信托 用于治疗癫痫的组合物和方法
WO2023126821A1 (en) * 2021-12-29 2023-07-06 Curateq Biologics Private Limited C1q binding assay
US12473353B2 (en) 2019-05-15 2025-11-18 Chugai Seiyaku Kabushiki Kaisha Antigen-binding molecule, a pharmaceutical composition, and a method
US12486322B2 (en) * 2021-12-13 2025-12-02 Annexon, Inc. Anti-complement factor C1q antibodies with single binding arms and uses thereof

Families Citing this family (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2020103100A1 (en) * 2018-11-22 2020-05-28 Suzhou Kanova Biopharmaceutical Co., Ltd. An anti-b7-h3 antibody
WO2021076991A1 (en) * 2019-10-17 2021-04-22 Annexon, Inc. Compositions and methods for treating blood disorders
CA3195798A1 (en) * 2020-10-16 2022-04-21 Ted Yednock Compositions and methods for treating blood disorders
CN117241828A (zh) 2021-03-31 2023-12-15 美国比奥维拉迪维股份有限公司 减少冷凝集素病患者的手术相关溶血
AU2022293581A1 (en) * 2021-06-18 2024-01-25 Therini Bio, Inc. ANTIBODIES WHICH BIND HUMAN FIBRIN OR FIBRINOGEN γC DOMAIN AND METHODS OF USE
CN117085132A (zh) * 2022-05-20 2023-11-21 浙江大学 阻断胸膜间皮细胞cd93的活性物质及应用
CN119371528B (zh) * 2024-10-30 2025-06-24 泰州市人民医院 一种C1q抗体及其应用、一种抑制补体经典途径活化的药剂及其应用

Citations (77)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP0125023A1 (en) 1983-04-08 1984-11-14 Genentech, Inc. Recombinant immunoglobulin preparations, methods for their preparation, DNA sequences, expression vectors and recombinant host cells therefor
EP0171496A2 (en) 1984-08-15 1986-02-19 Research Development Corporation of Japan Process for the production of a chimera monoclonal antibody
EP0173494A2 (en) 1984-08-27 1986-03-05 The Board Of Trustees Of The Leland Stanford Junior University Chimeric receptors by DNA splicing and expression
WO1986001533A1 (en) 1984-09-03 1986-03-13 Celltech Limited Production of chimeric antibodies
EP0184187A2 (en) 1984-12-04 1986-06-11 Teijin Limited Mouse-human chimaeric immunoglobulin heavy chain, and chimaeric DNA encoding it
US4657760A (en) 1979-03-20 1987-04-14 Ortho Pharmaceutical Corporation Methods and compositions using monoclonal antibody to human T cells
US4676980A (en) 1985-09-23 1987-06-30 The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services Target specific cross-linked heteroantibodies
WO1987004462A1 (en) 1986-01-23 1987-07-30 Celltech Limited Recombinant dna sequences, vectors containing them and method for the use thereof
EP0308936A2 (en) 1987-09-23 1989-03-29 Bristol-Myers Squibb Company Antibody heteroconjugates for the killing of HIV-infected cells
WO1990002809A1 (en) 1988-09-02 1990-03-22 Protein Engineering Corporation Generation and selection of recombinant varied binding proteins
EP0404097A2 (de) 1989-06-22 1990-12-27 BEHRINGWERKE Aktiengesellschaft Bispezifische und oligospezifische, mono- und oligovalente Rezeptoren, ihre Herstellung und Verwendung
WO1991000360A1 (en) 1989-06-29 1991-01-10 Medarex, Inc. Bispecific reagents for aids therapy
WO1991010741A1 (en) 1990-01-12 1991-07-25 Cell Genesys, Inc. Generation of xenogeneic antibodies
WO1991017271A1 (en) 1990-05-01 1991-11-14 Affymax Technologies N.V. Recombinant library screening methods
WO1992001047A1 (en) 1990-07-10 1992-01-23 Cambridge Antibody Technology Limited Methods for producing members of specific binding pairs
WO1992003918A1 (en) 1990-08-29 1992-03-19 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
WO1992009690A2 (en) 1990-12-03 1992-06-11 Genentech, Inc. Enrichment method for variant proteins with altered binding properties
WO1992015679A1 (en) 1991-03-01 1992-09-17 Protein Engineering Corporation Improved epitode displaying phage
WO1992018619A1 (en) 1991-04-10 1992-10-29 The Scripps Research Institute Heterodimeric receptor libraries using phagemids
WO1992020791A1 (en) 1990-07-10 1992-11-26 Cambridge Antibody Technology Limited Methods for producing members of specific binding pairs
WO1992022645A1 (en) 1991-06-14 1992-12-23 Genpharm International, Inc. Transgenic immunodeficient non-human animals
WO1993001227A1 (en) 1991-07-08 1993-01-21 University Of Massachusetts At Amherst Thermotropic liquid crystal segmented block copolymer
WO1993001288A1 (de) 1991-07-08 1993-01-21 Deutsches Krebsforschungszentrum Stiftung des öffentlichen Rechts Phagemid zum screenen von antikörpern
US5206344A (en) 1985-06-26 1993-04-27 Cetus Oncology Corporation Interleukin-2 muteins and polymer conjugation thereof
WO1993008829A1 (en) 1991-11-04 1993-05-13 The Regents Of The University Of California Compositions that mediate killing of hiv-infected cells
WO1993011161A1 (en) 1991-11-25 1993-06-10 Enzon, Inc. Multivalent antigen-binding proteins
US5223409A (en) 1988-09-02 1993-06-29 Protein Engineering Corp. Directed evolution of novel binding proteins
US5225212A (en) 1989-10-20 1993-07-06 Liposome Technology, Inc. Microreservoir liposome composition and method
US5225539A (en) 1986-03-27 1993-07-06 Medical Research Council Recombinant altered antibodies and methods of making altered antibodies
WO1993016185A2 (en) 1992-02-06 1993-08-19 Creative Biomolecules, Inc. Biosynthetic binding protein for cancer marker
WO1994002610A1 (en) 1992-07-17 1994-02-03 Dana-Farber Cancer Institute Method of intracellular binding of target molecules
WO1994004690A1 (en) 1992-08-17 1994-03-03 Genentech, Inc. Bispecific immunoadhesins
WO1994025585A1 (en) 1993-04-26 1994-11-10 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
WO1995003832A1 (en) 1993-07-30 1995-02-09 Thomas Jefferson University Intracellular immunization
US5545807A (en) 1988-10-12 1996-08-13 The Babraham Institute Production of antibodies from transgenic animals
US5545806A (en) 1990-08-29 1996-08-13 Genpharm International, Inc. Ransgenic non-human animals for producing heterologous antibodies
WO1996027011A1 (en) 1995-03-01 1996-09-06 Genentech, Inc. A method for making heteromultimeric polypeptides
US5565332A (en) 1991-09-23 1996-10-15 Medical Research Council Production of chimeric antibodies - a combinatorial approach
WO1996033735A1 (en) 1995-04-27 1996-10-31 Abgenix, Inc. Human antibodies derived from immunized xenomice
WO1996034096A1 (en) 1995-04-28 1996-10-31 Abgenix, Inc. Human antibodies derived from immunized xenomice
US5571894A (en) 1991-02-05 1996-11-05 Ciba-Geigy Corporation Recombinant antibodies specific for a growth factor receptor
US5587458A (en) 1991-10-07 1996-12-24 Aronex Pharmaceuticals, Inc. Anti-erbB-2 antibodies, combinations thereof, and therapeutic and diagnostic uses thereof
US5625126A (en) 1990-08-29 1997-04-29 Genpharm International, Inc. Transgenic non-human animals for producing heterologous antibodies
US5633425A (en) 1990-08-29 1997-05-27 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
US5641870A (en) 1995-04-20 1997-06-24 Genentech, Inc. Low pH hydrophobic interaction chromatography for antibody purification
US5648237A (en) 1991-09-19 1997-07-15 Genentech, Inc. Expression of functional antibody fragments
US5661016A (en) 1990-08-29 1997-08-26 Genpharm International Inc. Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
US5733743A (en) 1992-03-24 1998-03-31 Cambridge Antibody Technology Limited Methods for producing members of specific binding pairs
US5739277A (en) 1995-04-14 1998-04-14 Genentech Inc. Altered polypeptides with increased half-life
WO1998024884A1 (en) 1996-12-02 1998-06-11 Genpharm International Transgenic non-human animals capable of producing heterologous antibodies
US5770429A (en) 1990-08-29 1998-06-23 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
US5789650A (en) 1990-08-29 1998-08-04 Genpharm International, Inc. Transgenic non-human animals for producing heterologous antibodies
US5789199A (en) 1994-11-03 1998-08-04 Genentech, Inc. Process for bacterial production of polypeptides
WO1998024893A3 (en) 1996-12-03 1998-08-20 Abgenix Inc TRANSGENIC MAMMALS HAVING HUMAN IG LOCI INCLUDING PLURAL VH AND Vλ REGIONS AND ANTIBODIES PRODUCED THEREFROM
US5814318A (en) 1990-08-29 1998-09-29 Genpharm International Inc. Transgenic non-human animals for producing heterologous antibodies
US5840523A (en) 1995-03-01 1998-11-24 Genetech, Inc. Methods and compositions for secretion of heterologous polypeptides
US5869046A (en) 1995-04-14 1999-02-09 Genentech, Inc. Altered polypeptides with increased half-life
US5871907A (en) 1991-05-15 1999-02-16 Medical Research Council Methods for producing members of specific binding pairs
US5874299A (en) 1990-08-29 1999-02-23 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
US5877397A (en) 1990-08-29 1999-03-02 Genpharm International Inc. Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
US5959177A (en) 1989-10-27 1999-09-28 The Scripps Research Institute Transgenic plants expressing assembled secretory antibodies
WO1999058572A1 (en) 1998-05-08 1999-11-18 Cambridge University Technical Services Limited Binding molecules derived from immunoglobulins which do not trigger complement mediated lysis
US6040498A (en) 1998-08-11 2000-03-21 North Caroline State University Genetically engineered duckweed
US6075181A (en) 1990-01-12 2000-06-13 Abgenix, Inc. Human antibodies derived from immunized xenomice
US6150584A (en) 1990-01-12 2000-11-21 Abgenix, Inc. Human antibodies derived from immunized xenomice
US6420548B1 (en) 1999-10-04 2002-07-16 Medicago Inc. Method for regulating transcription of foreign genes
WO2004042072A2 (en) 2002-11-01 2004-05-21 The Regents Of The University Of Colorado, A Body Corporate Quantitative analysis of protein isoforms using matrix-assisted laser desorption/ionization time of flight mass spectrometry
US6982321B2 (en) 1986-03-27 2006-01-03 Medical Research Council Altered antibodies
US7087409B2 (en) 1997-12-05 2006-08-08 The Scripps Research Institute Humanization of murine antibody
US7125978B1 (en) 1999-10-04 2006-10-24 Medicago Inc. Promoter for regulating expression of foreign genes
US20100280227A1 (en) 2004-12-31 2010-11-04 Genentech, Inc. Polypeptides that bind br3 and uses thereof
US20120195880A1 (en) 2005-12-09 2012-08-02 Barres Ben A Modulation of Synaptic Maintenance
US20120328601A1 (en) 2005-12-09 2012-12-27 Barres Ben A Modulation of Synaptic Maintenance
US8602269B2 (en) 2009-09-14 2013-12-10 Guala Dispensing S.P.A. Trigger sprayer
WO2014169076A1 (en) * 2013-04-09 2014-10-16 Annexon,,Inc. Methods of treatment for neuromyelitis optica
WO2015006504A1 (en) * 2013-07-09 2015-01-15 Annexon, Inc. Anti-complement factor c1q antibodies and uses thereof
US9905535B2 (en) 2014-11-21 2018-02-27 Samsung Electronics Co., Ltd. Semiconductor packages and fabrication method thereof

Family Cites Families (35)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5545A (en) 1848-05-02 Improvement in machinery for separating gold
US16567A (en) 1857-02-03 Amos jacobs
US4595654A (en) 1983-11-07 1986-06-17 Immunomedics Inc. Method for detecting immune complexes in serum
US6717031B2 (en) 1995-06-07 2004-04-06 Kate Dora Games Method for selecting a transgenic mouse model of alzheimer's disease
US20020058311A1 (en) * 1995-06-13 2002-05-16 Browne Michael Jospeh Chimeric leptin fused to immunoglobulin domain and use
WO1998023761A1 (en) 1996-11-27 1998-06-04 Genentech, Inc. HUMANIZED ANTI-CD11a ANTIBODIES
US20050197285A1 (en) 1997-03-07 2005-09-08 Rosen Craig A. Human secreted proteins
WO1999010492A1 (en) 1997-08-26 1999-03-04 Zymogenetics, Inc. Adipocyte-specific protein homologs
US20030170781A1 (en) 1999-07-01 2003-09-11 Zymogenetics, Inc. Secreted protein zacrp4
WO2002005634A2 (en) 2000-07-13 2002-01-24 University Of South Florida Transgenic animal and methods
AU2002226074A1 (en) 2000-10-26 2002-05-06 Wisconsin Alumni Research Foundation. E. coli 0157:h7 c1 esterase inhibitor-binding protein stce and uses thereof
US7189830B2 (en) * 2001-02-19 2007-03-13 Merck Patent Gmbh Anti-KSA/IL-2 fusion proteins with reduced immunogenicity
CA2478313A1 (en) 2001-11-07 2003-06-26 Human Genome Sciences, Inc. 41 human secreted proteins
US20040248156A1 (en) 2001-12-03 2004-12-09 Tianhua Hu Methods and materials relating to novel C1q domain-containing polypeptides and polynucleotides
US20050214786A1 (en) 2002-02-22 2005-09-29 Human Genome Sciences, Inc. 26 human secreted proteins
US8329169B2 (en) 2003-05-15 2012-12-11 Genentech, Inc. Methods and compositions for the prevention and treatment of sepsis
US20050019326A1 (en) * 2003-06-16 2005-01-27 The Brigham And Women's Hospital, Inc. C1q complement inhibitors and methods of use thereof
US8501705B2 (en) 2003-09-11 2013-08-06 The Board Of Regents Of The University Of Texas System Methods and materials for treating autoimmune and/or complement mediated diseases and conditions
US7544855B2 (en) 2004-04-23 2009-06-09 Buck Institute Transgenic mouse whose genome comprises an APP having a mutation at amino acid 664
WO2006063150A2 (en) 2004-12-08 2006-06-15 Immunomedics, Inc. Methods and compositions for immunotherapy and detection of inflammatory and immune-dysregulatory disease, infectious disease, pathologic angiogenesis and cancer
TWI319708B (en) 2005-10-14 2010-01-21 Methods and compositions for altering cell fuction
RU2429244C2 (ru) 2006-03-23 2011-09-20 Байоарктик Ньюросайенс Аб Улучшенные селективные в отношении протофибрилл антитела и их применение
CA2662480C (en) 2006-09-05 2016-11-08 Alexion Pharmaceuticals, Inc. Methods and compositions for the treatment of antibody mediated neuropathies
CN101657097A (zh) * 2007-03-01 2010-02-24 先进视觉疗法公司 以炎症为特征的疾病的治疗
UY31520A1 (es) * 2007-12-11 2009-08-03 Proteinas de union a antigenos
WO2010065425A1 (en) * 2008-12-01 2010-06-10 The Board Of Trustees Of The Leland Stanford Junior University Methods and compositions for detection of complement fixing antibodies
WO2012176765A1 (ja) 2011-06-24 2012-12-27 株式会社ペルセウスプロテオミクス 抗ヒトp-カドへリン(cdh3)遺伝子組み換え抗体
LT2794905T (lt) * 2011-12-20 2020-07-10 Medimmune, Llc Modifikuoti polipeptidai, skirti bispecifinių antikūnų karkasams
CN102636654A (zh) * 2012-04-28 2012-08-15 上海北加生化试剂有限公司 检测人血清中补体Clq浓度的试剂盒及其方法
KR102339315B1 (ko) 2012-06-18 2021-12-15 오메로스 코포레이션 다양한 질환 및 장애의 치료를 위해 masp-1 및/또는 masp-2 및/또는 masp-3를 억제하는 조성물 및 방법
CN104870475B (zh) 2012-10-25 2019-11-08 美国比奥维拉迪维股份有限公司 抗补体C1s抗体和其用途
DK2914291T3 (da) 2012-11-02 2022-05-16 Bioverativ Usa Inc Anti-komplement-c1s-antistoffer og anvendelser deraf
WO2014161570A1 (en) * 2013-04-03 2014-10-09 Roche Glycart Ag Antibodies against human il17 and uses thereof
EP2996722A4 (en) * 2013-05-15 2017-01-11 Annexon, Inc. Methods of treatment for guillain-barre syndrome
WO2017091719A1 (en) 2015-11-24 2017-06-01 Annexon, Inc. Anti-complement factor c1q fab fragments and uses thereof

Patent Citations (82)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4657760A (en) 1979-03-20 1987-04-14 Ortho Pharmaceutical Corporation Methods and compositions using monoclonal antibody to human T cells
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
EP0125023A1 (en) 1983-04-08 1984-11-14 Genentech, Inc. Recombinant immunoglobulin preparations, methods for their preparation, DNA sequences, expression vectors and recombinant host cells therefor
EP0171496A2 (en) 1984-08-15 1986-02-19 Research Development Corporation of Japan Process for the production of a chimera monoclonal antibody
EP0173494A2 (en) 1984-08-27 1986-03-05 The Board Of Trustees Of The Leland Stanford Junior University Chimeric receptors by DNA splicing and expression
WO1986001533A1 (en) 1984-09-03 1986-03-13 Celltech Limited Production of chimeric antibodies
EP0184187A2 (en) 1984-12-04 1986-06-11 Teijin Limited Mouse-human chimaeric immunoglobulin heavy chain, and chimaeric DNA encoding it
US5206344A (en) 1985-06-26 1993-04-27 Cetus Oncology Corporation Interleukin-2 muteins and polymer conjugation thereof
US4676980A (en) 1985-09-23 1987-06-30 The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services Target specific cross-linked heteroantibodies
WO1987004462A1 (en) 1986-01-23 1987-07-30 Celltech Limited Recombinant dna sequences, vectors containing them and method for the use thereof
US6982321B2 (en) 1986-03-27 2006-01-03 Medical Research Council Altered antibodies
US5225539A (en) 1986-03-27 1993-07-06 Medical Research Council Recombinant altered antibodies and methods of making altered antibodies
EP0308936A2 (en) 1987-09-23 1989-03-29 Bristol-Myers Squibb Company Antibody heteroconjugates for the killing of HIV-infected cells
WO1990002809A1 (en) 1988-09-02 1990-03-22 Protein Engineering Corporation Generation and selection of recombinant varied binding proteins
US5223409A (en) 1988-09-02 1993-06-29 Protein Engineering Corp. Directed evolution of novel binding proteins
US5545807A (en) 1988-10-12 1996-08-13 The Babraham Institute Production of antibodies from transgenic animals
EP0404097A2 (de) 1989-06-22 1990-12-27 BEHRINGWERKE Aktiengesellschaft Bispezifische und oligospezifische, mono- und oligovalente Rezeptoren, ihre Herstellung und Verwendung
WO1991000360A1 (en) 1989-06-29 1991-01-10 Medarex, Inc. Bispecific reagents for aids therapy
US5225212A (en) 1989-10-20 1993-07-06 Liposome Technology, Inc. Microreservoir liposome composition and method
US5959177A (en) 1989-10-27 1999-09-28 The Scripps Research Institute Transgenic plants expressing assembled secretory antibodies
US6417429B1 (en) 1989-10-27 2002-07-09 The Scripps Research Institute Transgenic plants expressing assembled secretory antibodies
WO1991010741A1 (en) 1990-01-12 1991-07-25 Cell Genesys, Inc. Generation of xenogeneic antibodies
US6150584A (en) 1990-01-12 2000-11-21 Abgenix, Inc. Human antibodies derived from immunized xenomice
US6075181A (en) 1990-01-12 2000-06-13 Abgenix, Inc. Human antibodies derived from immunized xenomice
WO1991017271A1 (en) 1990-05-01 1991-11-14 Affymax Technologies N.V. Recombinant library screening methods
WO1992020791A1 (en) 1990-07-10 1992-11-26 Cambridge Antibody Technology Limited Methods for producing members of specific binding pairs
WO1992001047A1 (en) 1990-07-10 1992-01-23 Cambridge Antibody Technology Limited Methods for producing members of specific binding pairs
US5789650A (en) 1990-08-29 1998-08-04 Genpharm International, Inc. Transgenic non-human animals for producing heterologous antibodies
US5770429A (en) 1990-08-29 1998-06-23 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
US5625126A (en) 1990-08-29 1997-04-29 Genpharm International, Inc. Transgenic non-human animals for producing heterologous antibodies
US5877397A (en) 1990-08-29 1999-03-02 Genpharm International Inc. Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
US5874299A (en) 1990-08-29 1999-02-23 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
WO1992003918A1 (en) 1990-08-29 1992-03-19 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
US5633425A (en) 1990-08-29 1997-05-27 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
US5569825A (en) 1990-08-29 1996-10-29 Genpharm International Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
US5814318A (en) 1990-08-29 1998-09-29 Genpharm International Inc. Transgenic non-human animals for producing heterologous antibodies
US5545806A (en) 1990-08-29 1996-08-13 Genpharm International, Inc. Ransgenic non-human animals for producing heterologous antibodies
US5661016A (en) 1990-08-29 1997-08-26 Genpharm International Inc. Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
WO1992009690A2 (en) 1990-12-03 1992-06-11 Genentech, Inc. Enrichment method for variant proteins with altered binding properties
US5571894A (en) 1991-02-05 1996-11-05 Ciba-Geigy Corporation Recombinant antibodies specific for a growth factor receptor
WO1992015679A1 (en) 1991-03-01 1992-09-17 Protein Engineering Corporation Improved epitode displaying phage
WO1992018619A1 (en) 1991-04-10 1992-10-29 The Scripps Research Institute Heterodimeric receptor libraries using phagemids
US5871907A (en) 1991-05-15 1999-02-16 Medical Research Council Methods for producing members of specific binding pairs
WO1992022645A1 (en) 1991-06-14 1992-12-23 Genpharm International, Inc. Transgenic immunodeficient non-human animals
WO1993001288A1 (de) 1991-07-08 1993-01-21 Deutsches Krebsforschungszentrum Stiftung des öffentlichen Rechts Phagemid zum screenen von antikörpern
WO1993001227A1 (en) 1991-07-08 1993-01-21 University Of Massachusetts At Amherst Thermotropic liquid crystal segmented block copolymer
US5648237A (en) 1991-09-19 1997-07-15 Genentech, Inc. Expression of functional antibody fragments
US5565332A (en) 1991-09-23 1996-10-15 Medical Research Council Production of chimeric antibodies - a combinatorial approach
US5587458A (en) 1991-10-07 1996-12-24 Aronex Pharmaceuticals, Inc. Anti-erbB-2 antibodies, combinations thereof, and therapeutic and diagnostic uses thereof
WO1993008829A1 (en) 1991-11-04 1993-05-13 The Regents Of The University Of California Compositions that mediate killing of hiv-infected cells
WO1993011161A1 (en) 1991-11-25 1993-06-10 Enzon, Inc. Multivalent antigen-binding proteins
WO1993016185A2 (en) 1992-02-06 1993-08-19 Creative Biomolecules, Inc. Biosynthetic binding protein for cancer marker
US5733743A (en) 1992-03-24 1998-03-31 Cambridge Antibody Technology Limited Methods for producing members of specific binding pairs
WO1994002610A1 (en) 1992-07-17 1994-02-03 Dana-Farber Cancer Institute Method of intracellular binding of target molecules
WO1994004690A1 (en) 1992-08-17 1994-03-03 Genentech, Inc. Bispecific immunoadhesins
WO1994025585A1 (en) 1993-04-26 1994-11-10 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
WO1995003832A1 (en) 1993-07-30 1995-02-09 Thomas Jefferson University Intracellular immunization
US5789199A (en) 1994-11-03 1998-08-04 Genentech, Inc. Process for bacterial production of polypeptides
WO1996027011A1 (en) 1995-03-01 1996-09-06 Genentech, Inc. A method for making heteromultimeric polypeptides
US5840523A (en) 1995-03-01 1998-11-24 Genetech, Inc. Methods and compositions for secretion of heterologous polypeptides
US5731168A (en) 1995-03-01 1998-03-24 Genentech, Inc. Method for making heteromultimeric polypeptides
US5869046A (en) 1995-04-14 1999-02-09 Genentech, Inc. Altered polypeptides with increased half-life
US5739277A (en) 1995-04-14 1998-04-14 Genentech Inc. Altered polypeptides with increased half-life
US5641870A (en) 1995-04-20 1997-06-24 Genentech, Inc. Low pH hydrophobic interaction chromatography for antibody purification
WO1996033735A1 (en) 1995-04-27 1996-10-31 Abgenix, Inc. Human antibodies derived from immunized xenomice
WO1996034096A1 (en) 1995-04-28 1996-10-31 Abgenix, Inc. Human antibodies derived from immunized xenomice
WO1998024884A1 (en) 1996-12-02 1998-06-11 Genpharm International Transgenic non-human animals capable of producing heterologous antibodies
WO1998024893A3 (en) 1996-12-03 1998-08-20 Abgenix Inc TRANSGENIC MAMMALS HAVING HUMAN IG LOCI INCLUDING PLURAL VH AND Vλ REGIONS AND ANTIBODIES PRODUCED THEREFROM
US7087409B2 (en) 1997-12-05 2006-08-08 The Scripps Research Institute Humanization of murine antibody
WO1999058572A1 (en) 1998-05-08 1999-11-18 Cambridge University Technical Services Limited Binding molecules derived from immunoglobulins which do not trigger complement mediated lysis
US6040498A (en) 1998-08-11 2000-03-21 North Caroline State University Genetically engineered duckweed
US7125978B1 (en) 1999-10-04 2006-10-24 Medicago Inc. Promoter for regulating expression of foreign genes
US6420548B1 (en) 1999-10-04 2002-07-16 Medicago Inc. Method for regulating transcription of foreign genes
WO2004042072A2 (en) 2002-11-01 2004-05-21 The Regents Of The University Of Colorado, A Body Corporate Quantitative analysis of protein isoforms using matrix-assisted laser desorption/ionization time of flight mass spectrometry
US20100280227A1 (en) 2004-12-31 2010-11-04 Genentech, Inc. Polypeptides that bind br3 and uses thereof
US20120195880A1 (en) 2005-12-09 2012-08-02 Barres Ben A Modulation of Synaptic Maintenance
US20120328601A1 (en) 2005-12-09 2012-12-27 Barres Ben A Modulation of Synaptic Maintenance
US8602269B2 (en) 2009-09-14 2013-12-10 Guala Dispensing S.P.A. Trigger sprayer
WO2014169076A1 (en) * 2013-04-09 2014-10-16 Annexon,,Inc. Methods of treatment for neuromyelitis optica
WO2015006504A1 (en) * 2013-07-09 2015-01-15 Annexon, Inc. Anti-complement factor c1q antibodies and uses thereof
WO2015006507A1 (en) * 2013-07-09 2015-01-15 Annexon, Inc. Methods of treatment for alzheimer's disease and huntington's disease
US9905535B2 (en) 2014-11-21 2018-02-27 Samsung Electronics Co., Ltd. Semiconductor packages and fabrication method thereof

Non-Patent Citations (144)

* Cited by examiner, † Cited by third party
Title
"Data Base", Database accession no. NP 001107573.1
"GenBank", Database accession no. NM _001114101.1
"Methods in Enzymology", 1995, ACADEMIC PRESS, INC., article "PCR 2: A Practical Approach"
"Remington's Pharmaceutical Sciences", 1985, MACE PUBLISHING COMPANY
ALHORN ET AL., PLOS ONE, vol. 3, 2008, pages 1413
ANGAL S ET AL., MOL IMMUNOL., vol. 30, no. 1, January 1993 (1993-01-01), pages 105 - 8
ANGAL, S. ET AL.: "A single amino acid substitution abolishes the heterogeneity of chimeric mouse/human (IgG4) antibody.", MOLECULAR IMMUNOLOGY, vol. 30, no. 1, 15 January 1993 (1993-01-15), pages 105 - 108, XP023683005, Retrieved from the Internet <URL:http://europepmc.org/abstract/med/8417368><DOI:10.1016/0161-5890(93)90432-B> [retrieved on 20160125], doi:10.1016/0161-5890(93)90432-B *
ARMOUR ET AL., MOLECULAR IMMUNOLOGY, vol. 248, 2003, pages 585 - 593
BARBAS ET AL., PROC NAT. ACAD. SCI. USA, vol. 91, 1994, pages 3809 - 3813
BARBAS ET AL., PROC. NATL. ACAD. SCI. USA, vol. 88, 1991, pages 7978 - 7982
BEERLI, R. R. ET AL., BIOCHEM. BIOPHYS. RES. COMMUN., vol. 204, 1994, pages 666 - 672
BEERLI, R. R. ET AL., J. BIOL. CHEM., vol. 269, 1994, pages 23931 - 23936
BEIDLER ET AL., J. IMMUNOL., vol. 141, 1988, pages 4053 - 4060
BIOCCA, S. ET AL., BIOTECHNOLOGY, vol. 12, 1994, pages 396 - 399
BIOCCA, S. ET AL., EMBO J., vol. 9, 1990, pages 101 - 108
BOERNER ET AL., J. IMMUNOL., vol. 147, no. 1, 1991, pages 2324 - 2330
BROWN ET AL., J. BIOL. CHEM., vol. 255, 1980, pages 4980 - 83
BROWN ET AL., J. IMMUNOL., vol. 127, 1981, pages 539 - 681
BRUGGEMANN ET AL., YEAR IN IMMUNOL., vol. 7, 1993, pages 33
BRYSON, CJ ET AL., BIODRUGS., vol. 24, no. 1, 1 February 2010 (2010-02-01), pages 1 - 8
C.A. JANEWAYP. TRAVERS, IMMUNOBIOLOGY, 1997
CAPEL ET AL., IMMUNOMETHODS, vol. 4, 1994, pages 25 - 34
CARLSON, J. R., MOL. CELL. BIOL., vol. 8, 1988, pages 2638 - 2646
CARROLL S.GEORGIOU G., IMMUNOBIOLOGY, vol. 218, no. 8, 2013, pages 1041 - 1048
CARTER ET AL., BIO/TECHNOLOGY, vol. 10, 1992, pages 163 - 167
CHEN, J. ET AL., INTERNATIONAL IMMUNOLOGY, vol. 5, 1993, pages 647 - 656
CHEN, S-Y. ET AL., HUM. GENE THER., vol. 5, 1994, pages 595 - 601
CHEN, S-Y., PROC. NATL. ACAD. SCI. USA, vol. 91, 1994, pages 5932 - 5936
CHOI ET AL., NATURE GENETICS, vol. 4, 1993, pages 117 - 123
CHOTHIALESK, J. MOL. BIOL., vol. 196, 1987, pages 901 - 917
CLARKSON ET AL., NATURE, vol. 352, 1991, pages 624 - 628
COLEALAN R. LISS ET AL., MONOCLONAL ANTIBODIES AND CANCER THERAPY,, 1985, pages 77
COLLIN ET AL., EMBO J, vol. 20, 2001, pages 3046 - 3055
CUNNINGHAMWELLS, SCIENCE, vol. 244, 1989, pages 1081 - 1085
E. HARLOWD. LANE: "Using Antibodies: A Laboratory Manual", 1999, COLD SPRING HARBOR LABORATORY PRESS
FELLOUSE, PROC. NAT'LACAD. SCI., vol. 101, no. 34, 2004, pages 12467 - 472
FISHWILD ET AL., NATURE BIOTECHNOL., vol. 14, 1996, pages 826 - 851
FISHWILD, D. ET AL., NATURE BIOTECHNOLOGY, vol. 14, 1996, pages 845 - 851
GABATHULER R.: "Approaches to transport therapeutic drugs across the blood-brain barrier to treat brain diseases", NEUROBIOL. DIS., vol. 37, 2010, pages 48 - 57, XP026765785, DOI: 10.1016/j.nbd.2009.07.028
GALFRE, G. ET AL., NATURE, vol. 266, 1977, pages 55052
GARRARD, BIOTECHNOLOGY, vol. 9, 1991, pages 1373 - 1377
GEFTER, M. L. ET AL., SOMATIC CELL GENET., vol. 3, 1977, pages 231 - 36
GERNGROSS, NAT. BIOTECH., vol. 22, 2004, pages 1409 - 1414
GRAHAM ET AL., J. GEN VIROL., vol. 36, 1977, pages 59
GRAM ET AL., PROC. NATL. ACAD. SCI. USA, vol. 89, 1992, pages 3576 - 3580
GRIFFITHS ET AL., EMBO J., vol. 12, 1993, pages 821 - 830
HAAS ET AL., J. LAB. CLIN. MED., vol. 126, 1995, pages 330 - 41
HAMERS-CASTERMAN ET AL., NATURE, vol. 363, 1993, pages 446 - 448
HARDING, F.LONBERG, N., ANN. N. Y ACAD. SCI, vol. 764, 1995, pages 536 - 546
HARDING, F.LONBERG, N., ANN. N.Y. ACAD. SCI, vol. 764, 1995, pages 536 - 546
HARRIS, BIOCHEM. SOC. TRANSACTIONS, vol. 23, 1995, pages 1035 - 1038
HAWKINS ET AL., J. MOL. BIOL., vol. 226, 1992, pages 889 - 896
HAY ET AL., HUM. ANTIBOD. HYBRIDOMAS, vol. 3, 1992, pages 81 - 85
HEINZ ET AL., J. IMMUNOL., vol. 133, 1984, pages 400 - 404
HELLER: "Hydrogels in Medicine and Pharmacy", vol. 3, 1987, CRC PRESS, pages: 137 - 149
HILLMEN ET AL., N ENGL J MED., vol. 355, no. 12, 2006, pages 1233 - 43
HOLLINGER ET AL., PROC. NAT 7 ACAD. SCI. USA, vol. 90, 1993, pages 6444 - 6448
HONGO ET AL., HYBRIDOMA, vol. 14, no. 3, 1995, pages 253 - 260
HOOGENBOOM ET AL., NUCLEIC ACIDS RES., vol. 19, 1991, pages 4133 - 4137
HOOGENBOOMWINTER, J. MOL. BIOL., vol. 222, 1991, pages 581
HUBERMUELLER, CURR PHARM DES., vol. 12, no. 31, 2006, pages 3999 - 4021
HURLEGROSS, CURR. OP. BIOTECH., vol. 113, 1994, pages 428 - 433
HWANG ET AL., MOL. IMMUNOL., vol. 45, 2008, pages 2570 - 2580
IDUSOGIE ET AL., J. IMMUNOLOGY, vol. 164, 2000, pages 4178 - 4184
IMMUNOPHARMACOLOGY, vol. 20, 1990, pages 73 - 8
JACKSON ET AL., J. IMMUNOL., vol. 154, no. 7, 1995, pages 3310 - 2004
JAKOBOVITS ET AL., PROC. NAT'L ACAD. SCI. USA, vol. 90, 1993, pages 6444 - 48
JEFFERIS, IMMUNOL REV, vol. 163, 1998, pages 59 - 76
JONES, P. ET AL., NATURE, vol. 321, 1986, pages 522 - 525
KARLSSON, R.ROOS, H.FAGERSTAM, L.PETERSSON, B., METHODS ENZYMOLOGY, vol. 6, 1994, pages 99 - 110
KINET, ANNU. REV. IMMUNOL., vol. 9, 1991, pages 457 - 92
KLOS A. ET AL., MOLIMMUNOL., vol. 46, no. 14, 2009, pages 2753 - 2766
KOHLERMILSTEIN, NATURE, vol. 256, 1975, pages 495 - 497
KOSTELNY ET AL., J. IMMUNOL., vol. 148, no. 5, 1992, pages 1547 - 1553
KOZAK, J. BIOL. CHEM., vol. 266, 1991, pages 19867 - 19870
KOZBOR ET AL., IMMUNOL. TODAY, vol. 4, 1983, pages 72
LAKEYRAGGETT, CURR OPIN STRUCT BIOL., vol. 8, no. 1, 1998, pages 119 - 123
LANGER, SCIENCE, vol. 249, 1990, pages 1527 - 1533
LANIER L.L.: "Follow the leader: NK cell receptors for classical and nonclassical MHC class I.", CELL, vol. 92, 1998, pages 705 - 707
LEE ET AL., J. IMMUNOL. METHODS, vol. 284, no. 1-2, 2004, pages 119 - 132
LERNER, E. A., YALE J. BIOL. MED., vol. 54, 1981, pages 387 - 402
LI ET AL., NAT. BIOTECH., vol. 24, 2006, pages 210 - 215
LI ET AL., PROC. NAT'LACAD. SCI. USA, vol. 103, 2006, pages 3557 - 3562
LIU ET AL., J. IMMUNOL., vol. 139, 1987, pages 3521 - 3526
LIU ET AL., PROC. NATL. ACAD. SCI. USA, vol. 84, 1987, pages 3439 - 3443
LONBERG, N. ET AL., NATURE, vol. 368, no. 6474, 1994, pages 856 - 859
LONBERG, N., HANDBOOK OF EXPERIMENTAL PHARMACOLOGY, vol. 113, 1994, pages 49 - 101
LONBERG, N.HUSZAR, D., INTERN. REV. IMMUNOL., vol. 13, 1995, pages 65 - 93
LUTJE S ET AL., BIOCONJUG CHEM., vol. 25, no. 2, 19 February 2014 (2014-02-19), pages 335 - 41
LΔPEZ-BOTET M.T. BELLΔNM. LLANOF. NAVARROP. GARCIAM. DE MIGUEL: "Paired inhibitory and triggering NK cell receptors for HLA class I molecules", HUM. IMMUNOL., vol. 61, 2000, pages 7 - 17
M. DAERON, ANNU. REV. IMMUNOL., vol. 15, 1997, pages 203 - 234
MARASCO, W. A. ET AL., PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 7889 - 7893
MATHER ET AL., ANNALS N.Y. ACAD. SCI., vol. 383, 1982, pages 44 - 68
MATHER, BIOL. REPROD., vol. 23, 1980, pages 243 - 251
MCCAFFERTY ET AL., NATURE, vol. 348, 1990, pages 552 - 554
MHASHILKAR, A. M. ET AL., EMBO J., vol. 14, 1995, pages 1542 - 1551
MILLSTEIN ET AL., NATURE, vol. 305, 1983, pages 537 - 539
MOORE ET AL., MABS., vol. 2, no. 2, March 2010 (2010-03-01), pages 181 - 9
MORDENTI, J.CHAPPELL, W. ET AL.: "Toxicokinetics and New Drug Development", 1989, PERGAMON PRESS, article "The Use of Interspecies Scaling in Toxicokinetics", pages: 42 - 46
MORGAN A ET AL., IMMUNOLOGY, vol. 86, 1995, pages 319 - 324
MORIMOTO ET AL., J. BIOCHEM. BIOPHYS. METHOD., vol. 24, 1992, pages 107 - 117
MORRISON ET AL., PROC. NAT'L ACAD. SCI. USA, vol. 81, 1984, pages 6851 - 55
MORRISON, S. L., SCIENCE, vol. 229, 1985, pages 1202 - 1207
NELSON ET AL., J. CLIN. INVEST., vol. 116, 2006, pages 2892 - 2900
NISHIMURA ET AL., CANCER RES., vol. 47, 1987, pages 999 - 1005
OI ET AL., BIOTECHNIQUES, vol. 4, 1986, pages 214
P. FINCH, ANTIBODIES, 1997
PERRY, LCA ET AL., DRUGS R D., vol. 9, no. 6, 2008, pages 385 - 96
PRESTA, CURR. OP. STRUCT. BIOL., vol. 2, 1992, pages 593 - 596
QUEEN, C. ET AL., PROC. NATL. ACAD. SEE. U.S.A., vol. 86, 1989, pages 10029 - 10033
REDDY, MANJULA P. ET AL.: "Elimination of Fc receptor-dependent effector functions of a modified IgG4 monoclonal antibody to human CD 4.", THE JOURNAL OF IMMUNOLOGY, vol. 164, no. 4, 15 February 2000 (2000-02-15), pages 1925 - 1933, XP001098833, Retrieved from the Internet <URL:http://www.jimmunol.org/content/164/4/1925.full> [retrieved on 20160120] *
RICHARDSON, J. H., PROC. NATL. ACAD. SCI. USA, vol. 92, 1995, pages 3137 - 3141
RIECHMANN ET AL., NATURE, vol. 322, 1988, pages 738 - 740
RIECHMANN, L. ET AL., NATURE, vol. 332, 1998, pages 323 - 327
SCHIER ET AL., GENE, vol. 169, 1995, pages 147 - 155
SHALABY ET AL., J. EXP. MED., vol. 175, 1992, pages 217 - 225
SHAW ET AL., J. NATL. CANCER INST., vol. 80, 1988, pages 1553 - 1559
SHERIFF ET AL., NATURE STRUCT. BIOL., vol. 3, 1996, pages 733 - 736
SHIELDS ET AL., J. BIOL. CHEM., vol. 9, no. 2, 2001, pages 6591 - 6604
SIDHU ET AL., J. MOL. BIOL., vol. 340, no. 5, 2004, pages 1073 - 1093
SUN ET AL., PROC. NATL. ACAD. SCI., vol. 84, 1987, pages 214 - 218
SURESH ET AL., METHODS IN ENZYMOLOGY, vol. 121, 1986, pages 210
T.E. MOLLNESM. KIRSCHFINK, MOLECULAR IMMUNOLOGY, vol. 43, 2006, pages 107 - 121
TAVARE R ET AL., PROC NATL ACAD SCI USA., vol. 111, no. 3, 21 January 2014 (2014-01-21), pages 1108 - 13
TAYLOR, L. ET AL., INTERNATIONAL IMMUNOLOGY, vol. 6, 1994, pages 579 - 591
TAYLOR, L. ET AL., NUCLEIC ACIDS RESEARCH, vol. 20, 1992, pages 6287 - 6295
TRAUNECKER ET AL., EMBO J., vol. 10, 1991, pages 3655 - 3659
TRINDER ET AL., SCAND. J. IMMUNOL., vol. 50, 1999, pages 635 - 641
TUAILLON ET AL., J. IMMUNOL., vol. 152, 1994, pages 5368 - 2920
TUAILLON ET AL., PROC. NATL. ACAD. SCI USA, vol. 90, 1993, pages 3720 - 3724
TUZUN ET AL., J. NEUROIMMUNOL., vol. 182, 2007, pages 167 - 176
TUZUN, ERDEM ET AL.: "Targeting classical complement pathway to treat complement mediated autoimmune diseases.", CURRENT TOPICS IN COMPLEMENT II., vol. 632, 26 July 2008 (2008-07-26), pages 254 - 261, XP009502739, Retrieved from the Internet <URL:http://link.springer.com/chapter/10.1007/978-0-387-78952-1_19> [retrieved on 20160125] *
URLAUB ET AL., PROC. NATL. ACAD. SCI. USA, vol. 77, 1980, pages 4216
VAN DIJKVAN DE WINKEL, CURR. OPIN. PHARMACOL., vol. 5, 2001, pages 368 - 74
VASWANIHAMILTON, ANN. ALLERGY, ASTHMA & IMMUNOL., vol. 1, 1998, pages 105 - 115
VERHOEYAN ET AL., SCIENCE, vol. 239, 1988, pages 1534 - 1043
WERGE, T. M., FEBSLETT., vol. 274, 1990, pages 193 - 198
WIEHR S ET AL., PROSTATE., vol. 74, no. 7, May 2014 (2014-05-01), pages 743 - 55
WOOD ET AL., NATURE, vol. 314, 1985, pages 446 - 449
XU ET AL., IMMUNITY, vol. 13, 2000, pages 37 - 45
YAZAKIWU: "Methods in Molecular Biology", vol. 248, 2003, HUMANA PRESS, pages: 255 - 268
YEH ET AL., INT. J. CANCER, vol. 29, 1982, pages 269 - 75
YEH ET AL., PROC. NATL. ACAD. SCI., vol. 76, 1976, pages 2927 - 31
ZAPATA ET AL., PROTEIN ENG., vol. 8, no. 10, 1995, pages 1057 - 1062

Cited By (37)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP2996722A4 (en) * 2013-05-15 2017-01-11 Annexon, Inc. Methods of treatment for guillain-barre syndrome
US10927167B2 (en) 2013-07-09 2021-02-23 Annexon, Inc. Anti-complement factor C1Q antibodies and uses thereof
US11649279B2 (en) 2013-07-09 2023-05-16 Annexon, Inc. Anti-complement factor C1Q antibodies and uses thereof
US10227398B2 (en) 2013-07-09 2019-03-12 Annexon, Inc. Anti-complement factor C1q antibodies and uses thereof
US12534522B2 (en) 2013-07-09 2026-01-27 Annexon, Inc. Anti-complement factor C1q antibodies and uses thereof
US10590190B2 (en) 2013-07-09 2020-03-17 Annexon, Inc. Anti-complement factor C1q antibodies and uses thereof
US11999779B2 (en) 2015-11-24 2024-06-04 Annexon, Inc. Anti-complement factor C1q Fab fragments and uses thereof
US10723788B2 (en) 2015-11-24 2020-07-28 Annexon, Inc. Anti-complement factor C1q Fab fragments and uses thereof
EP3380518A4 (en) * 2015-11-24 2019-07-31 Annexon, Inc. ANTI-COMPLEMENT FACTOR C1Q FAB FRAGMENTS AND USES THEREOF
AU2016361517C1 (en) * 2015-11-24 2024-06-06 Annexon, Inc. Anti-complement factor C1q Fab fragments and uses thereof
WO2017091719A1 (en) * 2015-11-24 2017-06-01 Annexon, Inc. Anti-complement factor c1q fab fragments and uses thereof
AU2016361517B2 (en) * 2015-11-24 2023-12-14 Annexon, Inc. Anti-complement factor C1q Fab fragments and uses thereof
EP3454901A4 (en) * 2016-05-09 2020-07-29 Annexon, Inc. COMPOSITIONS AND METHODS FOR TREATING PROGRESSIVE SPINAL AMYOTROPHY
EP3487531A4 (en) * 2016-07-19 2020-03-25 Annexon, Inc. TREATMENT OF FRONTO-TEMPORAL DEMENTIA
WO2018081250A1 (en) * 2016-10-26 2018-05-03 The Board Of Trustees Of The Leland Stanford Junior University Neuronal and oligodendrocyte survival modulation
EP3650547A4 (en) * 2017-07-06 2021-03-10 Nitto Boseki Co., Ltd. MONOCLONAL ANTI-HUMAN IGG4 ANTIBODY AND HUMAN IGG4 ASSAY REAGENT USING THIS ANTIBODY
CN111556895A (zh) * 2017-11-14 2020-08-18 中外制药株式会社 抗-c1s抗体及使用方法
US12084513B2 (en) 2017-11-14 2024-09-10 Chugai Seiyaku Kabushiki Kaisha Anti-C1S antibodies and methods of use
CN112313249B (zh) * 2018-04-13 2025-04-11 中外制药株式会社 抗补体组分抗体及使用方法
EP3774892A4 (en) * 2018-04-13 2022-02-16 Chugai Seiyaku Kabushiki Kaisha ANTI-COMPLEMENT COMPONENT ANTIBODIES AND METHODS OF USE
CN112313249A (zh) * 2018-04-13 2021-02-02 中外制药株式会社 抗补体组分抗体及使用方法
EP3873525A4 (en) * 2018-11-02 2022-07-13 Annexon, Inc. COMPOSITIONS AND METHODS FOR TREATMENT OF BRAIN INJURIES
US11591386B2 (en) 2018-12-13 2023-02-28 argenx BV Antibodies to human complement C2B
US11708403B2 (en) 2018-12-13 2023-07-25 argenx BV Antibodies to human complement factor C2B and methods of use
US12473353B2 (en) 2019-05-15 2025-11-18 Chugai Seiyaku Kabushiki Kaisha Antigen-binding molecule, a pharmaceutical composition, and a method
WO2020234432A1 (en) * 2019-05-21 2020-11-26 Argenx Bvba Antagonists of the complement system for use in methods of treating paraproteinemic neuropathies
GB2584105B (en) * 2019-05-21 2023-08-02 Argenx Bvba Methods of treating neuropathy
EP4570316A3 (en) * 2019-05-21 2025-08-13 argenx BV Antagonists of the complement system for use in methods of treating paraproteinemic neuropathies
GB2584105A (en) * 2019-05-21 2020-11-25 Argenx Bvba Methods of treating neuropathy
US20240034775A1 (en) * 2020-05-05 2024-02-01 The J. David Gladstone Institutes, a testamentary trust established under the Will of J. David Glads Compositions and methods for treating epilepsy
EP4146276A4 (en) * 2020-05-05 2024-08-14 The J. David Gladstone Institutes, A Testamentary Trust Established under The Will of J. David Gladstone Compositions and methods for treating epilepsy
CN115996752A (zh) * 2020-05-05 2023-04-21 J·大卫格莱斯顿研究所-根据J·大卫格莱斯顿遗嘱的遗嘱信托 用于治疗癫痫的组合物和方法
WO2023047124A2 (en) 2021-09-24 2023-03-30 Reflection Therapeutics Limited Targeted cell therapies
WO2023047125A1 (en) 2021-09-24 2023-03-30 Reflection Therapeutics Limited Targeted cell therapies
US12486322B2 (en) * 2021-12-13 2025-12-02 Annexon, Inc. Anti-complement factor C1q antibodies with single binding arms and uses thereof
GB2629959A (en) * 2021-12-29 2024-11-13 Curateq Biologics Private Ltd C1Q binding assay
WO2023126821A1 (en) * 2021-12-29 2023-07-06 Curateq Biologics Private Limited C1q binding assay

Also Published As

Publication number Publication date
US20160355574A1 (en) 2016-12-08
KR20170082575A (ko) 2017-07-14
CN107207587B (zh) 2022-04-19
RS66604B1 (sr) 2025-04-30
ES3013108T3 (en) 2025-04-11
EP4295911A2 (en) 2023-12-27
IL252026A0 (en) 2017-06-29
JP6951246B2 (ja) 2021-10-20
PT3215527T (pt) 2025-02-27
JP2022023058A (ja) 2022-02-07
US20210115119A1 (en) 2021-04-22
EP3215527B1 (en) 2025-01-08
EP4295911A3 (en) 2024-03-27
NZ732156A (en) 2023-11-24
FI3215527T3 (fi) 2025-02-18
JP2018501813A (ja) 2018-01-25
KR102626877B1 (ko) 2024-01-19
SG11201703667SA (en) 2017-06-29
DK3215527T3 (da) 2025-03-10
HUE070383T2 (hu) 2025-06-28
BR112017009297B1 (pt) 2024-02-15
US20190315845A1 (en) 2019-10-17
EP3215527A1 (en) 2017-09-13
HRP20250246T1 (hr) 2025-04-11
EP3215527A4 (en) 2018-04-18
IL252026B (en) 2021-10-31
BR112017009297A2 (pt) 2017-12-19
US20240025974A1 (en) 2024-01-25
AU2015343029B2 (en) 2021-07-29
CA2966894A1 (en) 2016-05-12
NZ769628A (en) 2024-10-25
LT3215527T (lt) 2025-04-10
SI3215527T1 (sl) 2025-04-30
PL3215527T3 (pl) 2025-04-28
HK1244494A1 (zh) 2018-08-10
JP7275223B2 (ja) 2023-05-17
US10316081B2 (en) 2019-06-11
AU2015343029A1 (en) 2017-06-15
SMT202500118T1 (it) 2025-05-12
SG10202008810QA (en) 2020-10-29
CN107207587A (zh) 2017-09-26

Similar Documents

Publication Publication Date Title
US20240025974A1 (en) Humanized anti-complement factor c1q antibodies and uses thereof
US12534522B2 (en) Anti-complement factor C1q antibodies and uses thereof
US20160090425A1 (en) Anti-complement factor c1s antibodies and uses thereof
CA2966894C (en) Humanized anti-complement factor c1q antibodies and uses thereof
HK1244494B (en) Humanized anti-complement factor c1q antibodies and uses thereof
EA051984B1 (ru) АНТИТЕЛА ПРОТИВ ФАКТОРА КОМПЛЕМЕНТА C1q И ИХ ПРИМЕНЕНИЯ

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 15857258

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 252026

Country of ref document: IL

ENP Entry into the national phase

Ref document number: 2017543310

Country of ref document: JP

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 122021000434

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 2966894

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 11201703667S

Country of ref document: SG

NENP Non-entry into the national phase

Ref country code: DE

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112017009297

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 20177015260

Country of ref document: KR

Kind code of ref document: A

REEP Request for entry into the european phase

Ref document number: 2015857258

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 2015343029

Country of ref document: AU

Date of ref document: 20151105

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 112017009297

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20170503

WWE Wipo information: entry into national phase

Ref document number: P-2025/0249

Country of ref document: RS

WWG Wipo information: grant in national office

Ref document number: P-2025/0249

Country of ref document: RS