WO2016070156A2 - C1 esterase inhibitor fusion proteins and uses thereof - Google Patents
C1 esterase inhibitor fusion proteins and uses thereof Download PDFInfo
- Publication number
- WO2016070156A2 WO2016070156A2 PCT/US2015/058521 US2015058521W WO2016070156A2 WO 2016070156 A2 WO2016070156 A2 WO 2016070156A2 US 2015058521 W US2015058521 W US 2015058521W WO 2016070156 A2 WO2016070156 A2 WO 2016070156A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- fusion protein
- days
- seq
- human
- amino acid
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/70535—Fc-receptors, e.g. CD16, CD32, CD64 (CD2314/705F)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/81—Protease inhibitors
- C07K14/8107—Endopeptidase (E.C. 3.4.21-99) inhibitors
- C07K14/811—Serine protease (E.C. 3.4.21) inhibitors
- C07K14/8121—Serpins
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/177—Receptors; Cell surface antigens; Cell surface determinants
- A61K38/1774—Immunoglobulin superfamily (e.g. CD2, CD4, CD8, ICAM molecules, B7 molecules, Fc-receptors, MHC-molecules)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/38—Albumins
- A61K38/385—Serum albumin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/55—Protease inhibitors
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
- A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P17/00—Drugs for dermatological disorders
- A61P17/02—Drugs for dermatological disorders for treating wounds, ulcers, burns, scars, keloids, or the like
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P21/00—Drugs for disorders of the muscular or neuromuscular system
- A61P21/04—Drugs for disorders of the muscular or neuromuscular system for myasthenia gravis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/14—Drugs for disorders of the nervous system for treating abnormal movements, e.g. chorea, dyskinesia
- A61P25/16—Anti-Parkinson drugs
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P27/00—Drugs for disorders of the senses
- A61P27/02—Ophthalmic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/06—Immunosuppressants, e.g. drugs for graft rejection
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P7/00—Drugs for disorders of the blood or the extracellular fluid
- A61P7/10—Antioedematous agents; Diuretics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/76—Albumins
- C07K14/765—Serum albumin, e.g. HSA
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/30—Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/31—Fusion polypeptide fusions, other than Fc, for prolonged plasma life, e.g. albumin
Definitions
- CI -inhibitor also known as CI esterase inhibitor
- Cl-INH is the largest member of the serpin protein superfamily. It is a heavily glycosylated serine proteinase inhibitor having the main function of inhibiting the spontaneous activation of the complement system.
- Cl-INH regulates the complement cascade system, plays a key role in the regulation of the contact (kallikrein-kinin) amplification cascade, and participates in the regulation of the coagulation and fibrinolytic systems.
- HAE hereditary angioedema
- Symptoms of HAE attacks include swelling of the face, mouth and/or airway that occur spontaneously or are triggered by mild trauma. Such swelling can also occur in any part of the body.
- HAE is associated with low plasma levels of CI -inhibitor, while in other cases the protein circulates in normal or elevated amounts but it is dysfunctional. In addition to the episodes of inflammation, it also can cause more serious or life threatening indications, such as autoimmune diseases or lupus erythematosus.
- CINRYZE ® a human plasma derived CI esterase inhibitor
- Berinert ® also a plasma-derived human Cl-INH, CSL Behring
- the supply of human plasma derived CI esterase inhibitor is tied to the availability of blood and plasma donations.
- Ruconest ® conestat alfa, Pharming N.V.
- a recombinant Cl-INH expressed in engineered rabbits is indicated for IV administration for treatment of acute HAE attack.
- Ruconest ® is made in rabbits, its glycosylation profile is different from that of human plasma-derived Cl-INH. The result is that Ruconest has an extremely short half- life of about 2.4-2.7 hours. See Ruconest ® FDA Label and Prescribing Information.
- the present invention provides, among other things, improved long-acting recombinant C 1 esterase inhibitors that can be used to effectively treat various complement- mediated disorders and that can be manufactured in a cost-effective matter.
- the present invention provides CI esterase inhibitor fusion proteins that exhibit longer half-life than Ruconest ® .
- the CI inhibitor fusion proteins of the invention exhibit a half-life comparable to or longer than plasma-derived Cl-INH.
- the present inventors have demonstrated that certain exemplary CI inhibitor fusion proteins according to the present invention have extended serum half-life of at least 4 days. It is contemplated that the long serum half- life of a recombinant C 1 inhibitor leads to superior in vivo efficacy and permits a preferable dosing regimen and route of administration.
- the CI inhibitor fusion proteins of the invention may be administered
- the CI inhibitor fusion proteins of the invention can be produced recombinantly in host cells such that the disclosed CI inhibitor fusion proteins are not dependent on blood supply, do not pose a risk of transmission of infectious agents, and are less expensive to manufacture. Since they are recombinantly produced in host cells, they offer more consistency in production and final product than those products purified from human blood, human blood components (e.g. plasma), or animal milk.
- the CI inhibitor fusion proteins provided herein are not dependent on animal husbandry considerations, including animal age and/or maturity, milk production, animal illness, etc., all of which may affect both quantity and quality (e.g., glycosylation profile, heterogeneity of expressed protein, etc.) of the rabbit expressed Cl-INH.
- the present invention provides for the cost effective and reliable manufacturing of recombinant CI esterase inhibitors, and safer, more effective treatment of HAE and other complement-mediated disorders.
- the present invention provides a fusion protein comprising a human
- the human CI -inhibitor polypeptide comprises an amino acid sequence at least at least 50% (e.g., at least 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the full length human CI -inhibitor having SEQ ID NO: l .
- the fusion protein comprising a human CI -inhibitor polypeptide and an Fc domain includes an amino acid sequence at least 70% identical to the full length human CI -inhibitor protein SEQ ID NO: 1. In some embodiments, the fusion protein comprising a human CI -inhibitor polypeptide and an Fc domain includes an amino acid sequence at least 80% identical to the full length human CI -inhibitor protein SEQ ID NO: l . In some embodiments, the fusion protein comprising a human CI -inhibitor polypeptide and an Fc domain includes an amino acid sequence at least 90% identical to the full length human Cl- inhibitor protein SEQ ID NO: 1.
- the fusion protein comprising a human CI -inhibitor polypeptide and an Fc domain includes an amino acid sequence at least 95% identical to the full length human CI -inhibitor protein SEQ ID NO: 1. In some embodiments, the fusion protein comprising a human CI -inhibitor polypeptide and an Fc domain includes an amino acid sequence identical to the full length human CI -inhibitor protein SEQ ID NO: 1. In some embodiments, the fusion protein comprising a human CI -inhibitor polypeptide and an Fc domain comprises one or more truncations, deletions, mutations or insertions compared to SEQ ID NO: l .
- the fusion protein comprising a human CI -inhibitor polypeptide and an Fc domain comprises an amino acid sequence at least 50% (e.g., at least 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:2.
- the fusion protein comprising a human CI -inhibitor comprises an amino acid sequence at least 50% (e.g., at least 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:2.
- the polypeptide and an Fc domain includes an amino acid sequence at least 70% identical to the full length human Cl-inhibitor protein SEQ ID NO:2. In some embodiments, the fusion protein comprising a human Cl-inhibitor polypeptide and an Fc domain includes an amino acid sequence at least 80% identical to the full length human Cl-inhibitor protein SEQ ID NO:2. In some embodiments, the fusion protein comprising a human Cl-inhibitor polypeptide and an Fc domain includes an amino acid sequence at least 90% identical to the full length human Cl- inhibitor protein SEQ ID NO:2.
- the fusion protein comprising a human Cl-inhibitor polypeptide and an Fc domain includes an amino acid sequence at least 95% identical to the full length human Cl-inhibitor protein SEQ ID NO:2. In some embodiments, the fusion protein comprising a human Cl-inhibitor polypeptide and an Fc domain includes an amino acid sequence identical to the full length human Cl-inhibitor protein SEQ ID NO:2. In some embodiments, the fusion protein comprising a human Cl-inhibitor polypeptide and an Fc domain comprises one or more truncations, deletions, mutations or insertions compared to SEQ ID NO:2.
- the Fc domain is attached to the N-terminus of the human Cl- inhibitor polypeptide.
- the Fc domain is a human IgGl Fc domain.
- the Fc domain is attached to the N-terminus of the human Cl-inhibitor polypeptide.
- the Fc domain is derived from human IgGl Fc domain.
- an Fc domain suitable for the present invention comprises an amino acid sequence at least 50% (e.g., at least 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%), or 100%)) identical to SEQ ID NO:3.
- the fusion protein comprising a human Cl-inhibitor polypeptide and an Fc domain includes an amino acid sequence at least 70% identical to the human IgGl Fc domain SEQ ID NO:3.
- the fusion protein comprising a human Cl-inhibitor polypeptide and an Fc domain includes an amino acid sequence at least 80% identical to the human IgGl Fc domain SEQ ID NO:3.
- the fusion protein comprising a human CI -inhibitor polypeptide and an Fc domain includes an amino acid sequence at least 90% identical to the human IgGl Fc domain SEQ ID NO:3. In some embodiments, the fusion protein comprising a human CI -inhibitor polypeptide and an Fc domain includes an amino acid sequence at least 95% identical to the human IgGl Fc domain SEQ ID NO:3. In some embodiments, the fusion protein comprising a human Cl- inhibitor polypeptide and an Fc domain includes an amino acid sequence identical to the human IgGl Fc domain SEQ ID NO:3. In some embodiments, the fusion protein comprising a human CI -inhibitor polypeptide and an Fc domain comprises one or more truncations, deletions, mutations or insertions compared to SEQ ID NO:3.
- an Fc domain suitable for the present invention comprises a L234A mutation. In some embodiments, an Fc domain suitable for the present invention comprises a L235A mutation. In some embodiments, an Fc domain suitable for the present invention comprises a L234A mutation and a L235A mutation. In some embodiments, an Fc domain suitable for the present invention comprises a L234A mutation or a L235A mutation.
- an Fc domain suitable for the present invention comprises the amino acid sequence of SEQ ID NO:4.
- an Fc domain suitable for the present invention comprises one or more mutations that prolong the half-life of the fusion protein comprising a human CI -inhibitor polypeptide and an Fc domain.
- the mutation of the Fc domain comprises one or more mutations are selected from one or more positions corresponding to Thr 250, Met 252, Ser 254, Thr 256, Thr 307, Glu 380, Met 428, His 433, and/or Asn 434 of human IgGl .
- an Fc domain suitable for the present invention comprises a H433K mutation. In some embodiments, an Fc domain suitable for the present invention comprises a N434F mutation. In some embodiments, an Fc domain suitable for the present invention comprises a H433K mutation and a N434F mutation. In some embodiments, an Fc domain suitable for the present invention comprises a H433K mutation or a N434F mutation.
- fusion protein comprising a human CI -inhibitor polypeptide and an Fc domain comprises an amino acid sequence at least 50%> (e.g., at least 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:5.
- the fusion protein comprising a human CI -inhibitor polypeptide and an Fc domain includes an amino acid sequence at least 70% identical to SEQ ID NO:5.
- the fusion protein comprising a human CI -inhibitor polypeptide and an Fc domain includes an amino acid sequence at least 80% identical to SEQ ID NO:5.
- the fusion protein comprising a human CI -inhibitor polypeptide and an Fc domain includes an amino acid sequence at least 90% identical to SEQ ID NO:5. In some embodiments, the fusion protein comprising a human CI -inhibitor polypeptide and an Fc domain includes an amino acid sequence at least 95% identical to SEQ ID NO:5. In some embodiments, the fusion protein comprising a human CI -inhibitor polypeptide and an Fc domain includes an amino acid sequence identical to SEQ ID NO:5. In some embodiments, the fusion protein comprising a human CI -inhibitor polypeptide and an Fc domain comprises one or more truncations, deletions, mutations or insertions compared to SEQ ID NO:5.
- fusion protein comprising a human CI -inhibitor polypeptide and an Fc domain comprises an amino acid sequence at least 50%> (e.g., at least 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:6.
- the fusion protein comprising a human CI -inhibitor comprises an amino acid sequence at least 50%> (e.g., at least 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:6.
- the fusion protein comprising a human CI -inhibitor comprises an amino acid sequence at least 50%> (e.g., at least 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO
- the polypeptide and an Fc domain includes an amino acid sequence at least 70% identical to SEQ ID NO:6.
- the fusion protein comprising a human CI -inhibitor polypeptide and an Fc domain includes an amino acid sequence at least 80% identical to SEQ ID NO:6.
- the fusion protein comprising a human CI -inhibitor polypeptide and an Fc domain includes an amino acid sequence at least 90% identical to SEQ ID NO:6.
- the fusion protein comprising a human CI -inhibitor polypeptide and an Fc domain includes an amino acid sequence at least 95% identical to SEQ ID NO:6.
- the fusion protein comprising a human CI -inhibitor polypeptide and an Fc domain includes an amino acid sequence identical to SEQ ID NO:6. In some embodiments, the fusion protein comprising a human CI -inhibitor polypeptide and an Fc domain comprises one or more truncations, deletions, mutations or insertions compared to SEQ ID NO:6.
- fusion protein comprising a human CI -inhibitor polypeptide and an Fc domain comprises an amino acid sequence at least 50%> (e.g., at least 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:7.
- the fusion protein comprising a human CI -inhibitor polypeptide and an Fc domain includes an amino acid sequence at least 70% identical to SEQ ID NO:7.
- the fusion protein comprising a human CI -inhibitor polypeptide and an Fc domain includes an amino acid sequence at least 80% identical to SEQ ID NO:7. In some embodiments, the fusion protein comprising a human CI -inhibitor polypeptide and an Fc domain includes an amino acid sequence at least 90% identical to SEQ ID NO:7. In some embodiments, the fusion protein comprising a human CI -inhibitor polypeptide and an Fc domain includes an amino acid sequence at least 95% identical to SEQ ID NO:7. In some embodiments, the fusion protein comprising a human CI -inhibitor polypeptide and an Fc domain includes an amino acid sequence identical to SEQ ID NO:7. In some embodiments, the fusion protein comprising a human CI -inhibitor polypeptide and an Fc domain comprises one or more truncations, deletions, mutations or insertions compared to SEQ ID NO:7.
- fusion protein comprising a human CI -inhibitor polypeptide and an Fc domain comprises an amino acid sequence at least 50%> (e.g., at least 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:8.
- the fusion protein comprising a human CI -inhibitor comprises an amino acid sequence at least 50%> (e.g., at least 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:8.
- the fusion protein comprising a human CI -inhibitor comprises an amino acid sequence at least 50%> (e.g., at least 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO
- the polypeptide and an Fc domain includes an amino acid sequence at least 70% identical to SEQ ID NO:8.
- the fusion protein comprising a human CI -inhibitor polypeptide and an Fc domain includes an amino acid sequence at least 80% identical to SEQ ID NO:8.
- the fusion protein comprising a human CI -inhibitor polypeptide and an Fc domain includes an amino acid sequence at least 90% identical to SEQ ID NO:8.
- the fusion protein comprising a human CI -inhibitor polypeptide and an Fc domain includes an amino acid sequence at least 95% identical to SEQ ID NO:8.
- the fusion protein comprising a human CI -inhibitor polypeptide and an Fc domain includes an amino acid sequence identical to SEQ ID NO:8. In some embodiments, the fusion protein comprising a human CI -inhibitor polypeptide and an Fc domain comprises one or more truncations, deletions, mutations or insertions compared to SEQ ID NO:8. In some
- fusion protein comprising a human CI -inhibitor polypeptide and an Fc domain comprises an amino acid sequence at least 50%> (e.g., at least 55%, 60%>, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to any one of SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7, or SEQ ID NO:8.
- the fusion protein comprising a human CI -inhibitor polypeptide and an Fc domain includes an amino acid sequence at least 70% identical to any one of SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7, or SEQ ID NO:8.
- the fusion protein comprising a human CI -inhibitor polypeptide and an Fc domain includes an amino acid sequence at least 80% identical to any one of SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7, or SEQ ID NO:8.
- the fusion protein comprising a human Cl- inhibitor polypeptide and an Fc domain includes an amino acid sequence at least 90% identical to any one of SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7, or SEQ ID NO:8.
- the fusion protein comprising a human CI -inhibitor polypeptide and an Fc domain includes an amino acid sequence at least 95% identical to any one of SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7, or SEQ ID NO:8. In some embodiments, the fusion protein comprising a human CI -inhibitor polypeptide and an Fc domain includes an amino acid sequence identical to any one of SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7, or SEQ ID NO:8. In some
- the fusion protein comprising a human CI -inhibitor polypeptide and an Fc domain comprises one or more truncations, deletions, mutations or insertions compared to SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7, or SEQ ID NO:8.
- the Fc domain is attached to the N-terminus of the human Cl- inhibitor polypeptide.
- the Fc domain is a human IgG4 Fc domain.
- the Fc domain is attached to the N-terminus of the human CI -inhibitor polypeptide.
- the Fc domain is derived from a human IgG4 Fc domain.
- an Fc domain suitable for the present invention comprises an amino acid sequence at least 50% (e.g., at least 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:9.
- the fusion protein comprising a human CI -inhibitor polypeptide and an Fc domain includes an amino acid sequence at least 70% identical to the human IgG4 Fc domain SEQ ID NO:9.
- the fusion protein comprising a human CI -inhibitor polypeptide and an Fc domain includes an amino acid sequence at least 80% identical to the human IgG4 Fc domain SEQ ID NO:9.
- the fusion protein comprising a human CI -inhibitor polypeptide and an Fc domain includes an amino acid sequence at least 90% identical to the human IgG4 Fc domain SEQ ID NO:9. In some embodiments, the fusion protein comprising a human CI -inhibitor polypeptide and an Fc domain includes an amino acid sequence at least 95% identical to the human IgG4 Fc domain SEQ ID NO:9. In some embodiments, the fusion protein comprising a human CI -inhibitor polypeptide and an Fc domain includes an amino acid sequence identical to the human IgG4 Fc domain SEQ ID NO:9. In some embodiments, the fusion protein comprising a human CI -inhibitor polypeptide and an Fc domain comprises one or more truncations, deletions, mutations or insertions compared to SEQ ID NO:9.
- an Fc domain suitable for the present invention comprises a S241P mutation.
- fusion protein comprising a human CI -inhibitor polypeptide and an Fc domain comprises an amino acid sequence at least 50%> (e.g., at least 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO: 10.
- the fusion protein comprising a human CI -inhibitor polypeptide and an Fc domain includes an amino acid sequence at least 70% identical to SEQ ID NO: 10.
- the fusion protein comprising a human Cl-inhibitor polypeptide and an Fc domain includes an amino acid sequence at least 80% identical to SEQ ID NO: 10. In some embodiments, the fusion protein comprising a human Cl-inhibitor polypeptide and an Fc domain includes an amino acid sequence at least 90% identical to SEQ ID NO: 10. In some embodiments, the fusion protein comprising a human Cl-inhibitor polypeptide and an Fc domain includes an amino acid sequence at least 95% identical to SEQ ID NO: 10. In some
- the fusion protein comprising a human Cl-inhibitor polypeptide and an Fc domain includes an amino acid sequence identical to SEQ ID NO: 10. In some embodiments, the fusion protein comprising a human Cl-inhibitor polypeptide and an Fc domain comprises one or more truncations, deletions, mutations or insertions compared to SEQ ID NO: 10.
- fusion protein comprising a human Cl-inhibitor polypeptide and an Fc domain comprises an amino acid sequence at least 50%> (e.g., at least 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO : 11.
- the fusion protein comprising a human C 1 -inhibitor polypeptide and an Fc domain includes an amino acid sequence at least 70% identical to SEQ ID NO: 11.
- the fusion protein comprising a human Cl-inhibitor polypeptide and an Fc domain includes an amino acid sequence at least 80% identical to SEQ ID NO: 11.
- the fusion protein comprising a human CI -inhibitor polypeptide and an Fc domain includes an amino acid sequence at least 90% identical to SEQ ID NO:l 1. In some embodiments, the fusion protein comprising a human CI -inhibitor polypeptide and an Fc domain includes an amino acid sequence at least 95% identical to SEQ ID NO: 11. In some
- the fusion protein comprising a human CI -inhibitor polypeptide and an Fc domain includes an amino acid sequence identical to SEQ ID NO: 11. In some embodiments, the fusion protein comprising a human CI -inhibitor polypeptide and an Fc domain comprises one or more truncations, deletions, mutations or insertions compared to SEQ ID NO:l 1.
- fusion protein comprising a human CI -inhibitor polypeptide and an Fc domain comprises an amino acid sequence at least 50%> (e.g., at least 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO: 12.
- the fusion protein comprising a human CI -inhibitor polypeptide and an Fc domain includes an amino acid sequence at least 70% identical to SEQ ID NO: 12.
- the fusion protein comprising a human Cl-inhibitor polypeptide and an Fc domain includes an amino acid sequence at least 80% identical to SEQ ID NO: 12.
- the fusion protein comprising a human Cl-inhibitor polypeptide and an Fc domain includes an amino acid sequence at least 90% identical to SEQ ID NO: 12. In some embodiments, the fusion protein comprising a human Cl-inhibitor polypeptide and an Fc domain includes an amino acid sequence at least 95% identical to SEQ ID NO: 12. In some
- the fusion protein comprising a human Cl-inhibitor polypeptide and an Fc domain includes an amino acid sequence identical to SEQ ID NO: 12. In some embodiments, the fusion protein comprising a human Cl-inhibitor polypeptide and an Fc domain comprises one or more truncations, deletions, mutations or insertions compared to SEQ ID NO:12.
- fusion protein comprising a human Cl-inhibitor polypeptide and an Fc domain comprises an amino acid sequence at least 50%> (e.g., at least 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO: 13.
- the fusion protein comprising a human Cl-inhibitor polypeptide and an Fc domain includes an amino acid sequence at least 70% identical to SEQ ID NO: 13.
- the fusion protein comprising a human Cl-inhibitor polypeptide and an Fc domain includes an amino acid sequence at least 80% identical to SEQ ID NO: 13.
- the fusion protein comprising a human CI -inhibitor polypeptide and an Fc domain includes an amino acid sequence at least 90% identical to SEQ ID NO: 13. In some embodiments, the fusion protein comprising a human CI -inhibitor polypeptide and an Fc domain includes an amino acid sequence at least 95% identical to SEQ ID NO: 13. In some
- the fusion protein comprising a human CI -inhibitor polypeptide and an Fc domain includes an amino acid sequence identical to SEQ ID NO: 13. In some embodiments, the fusion protein comprising a human CI -inhibitor polypeptide and an Fc domain comprises one or more truncations, deletions, mutations or insertions compared to SEQ ID NO: 13.
- fusion protein comprising a human CI -inhibitor polypeptide and an Fc domain comprises an amino acid sequence at least 50%> (e.g., at least 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO: 14.
- the fusion protein comprising a human CI -inhibitor polypeptide and an Fc domain includes an amino acid sequence at least 70% identical to SEQ ID NO: 14.
- the fusion protein comprising a human Cl-inhibitor polypeptide and an Fc domain includes an amino acid sequence at least 80% identical to SEQ ID NO: 14.
- the fusion protein comprising a human Cl-inhibitor polypeptide and an Fc domain includes an amino acid sequence at least 90% identical to SEQ ID NO: 14. In some embodiments, the fusion protein comprising a human Cl-inhibitor polypeptide and an Fc domain includes an amino acid sequence at least 95% identical to SEQ ID NO: 14. In some
- the fusion protein comprising a human Cl-inhibitor polypeptide and an Fc domain includes an amino acid sequence identical to SEQ ID NO: 14. In some embodiments, the fusion protein comprising a human Cl-inhibitor polypeptide and an Fc domain comprises one or more truncations, deletions, mutations or insertions compared to SEQ ID NO:14.
- fusion protein comprising a human Cl-inhibitor polypeptide and an Fc domain comprises an amino acid sequence at least 50%> (e.g., at least 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO: 15.
- the fusion protein comprising a human Cl-inhibitor polypeptide and an Fc domain includes an amino acid sequence at least 70% identical to SEQ ID NO: 15.
- the fusion protein comprising a human Cl-inhibitor polypeptide and an Fc domain includes an amino acid sequence at least 80% identical to SEQ ID NO: 15.
- the fusion protein comprising a human CI -inhibitor polypeptide and an Fc domain includes an amino acid sequence at least 90% identical to SEQ ID NO: 15. In some embodiments, the fusion protein comprising a human CI -inhibitor polypeptide and an Fc domain includes an amino acid sequence at least 95% identical to SEQ ID NO: 15. In some
- the fusion protein comprising a human CI -inhibitor polypeptide and an Fc domain includes an amino acid sequence identical to SEQ ID NO: 15. In some embodiments, the fusion protein comprising a human CI -inhibitor polypeptide and an Fc domain comprises one or more truncations, deletions, mutations or insertions compared to SEQ ID NO: 15.
- fusion protein comprising a human CI -inhibitor polypeptide and an Fc domain comprises an amino acid sequence at least 50%> (e.g., at least 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO: 16.
- the fusion protein comprising a human CI -inhibitor polypeptide and an Fc domain includes an amino acid sequence at least 70% identical to SEQ ID NO: 16.
- the fusion protein comprising a human Cl-inhibitor polypeptide and an Fc domain includes an amino acid sequence at least 80% identical to SEQ ID NO: 16.
- the fusion protein comprising a human Cl-inhibitor polypeptide and an Fc domain includes an amino acid sequence at least 90% identical to SEQ ID NO: 16. In some embodiments, the fusion protein comprising a human Cl-inhibitor polypeptide and an Fc domain includes an amino acid sequence at least 95% identical to SEQ ID NO: 16. In some
- the fusion protein comprising a human Cl-inhibitor polypeptide and an Fc domain includes an amino acid sequence identical to SEQ ID NO: 16. In some embodiments, the fusion protein comprising a human Cl-inhibitor polypeptide and an Fc domain comprises one or more truncations, deletions, mutations or insertions compared to SEQ ID NO: 16.
- the fusion protein comprises a linker between the human Cl- inhibitor polypeptide and the Fc domain.
- the linker is a peptide comprising 3-100 amino acids.
- the fusion protein comprising a human Cl-inhibitor polypeptide and an Fc domain
- the fusion protein binds FcRN.
- the fusion protein inhibits CI esterase activity.
- the Fc domain comprises a mutation that reduces or eliminates ADCC activity. In some embodiments of the fusion protein comprising a human CI -inhibitor polypeptide and an Fc domain, the Fc domain comprises one or more mutations that reduce or eliminate ADCC activity. In some embodiments of the fusion protein comprising a human Cl- inhibitor polypeptide and an Fc domain, the Fc domain comprises a mutation that reduces or eliminates CDC activity. In some embodiments of the fusion protein comprising a human Cl- inhibitor polypeptide and an Fc domain, the Fc domain comprises one or more mutations that reduce or eliminate CDC activity.
- the Fc domain comprises a mutation that reduce or eliminate FcyR binding. In some embodiments of the fusion protein comprising a human CI -inhibitor polypeptide and an Fc domain, the Fc domain comprises one or more mutations that reduce or eliminate FcyR binding. In some embodiments of the fusion protein comprising a human Cl- inhibitor polypeptide and an Fc domain, the Fc domain comprises a mutation that reduces or eliminates FcyR effector function. In some embodiments of the fusion protein comprising a human CI -inhibitor polypeptide and an Fc domain, the Fc domain comprises one or more mutations that reduce or eliminate FcyR effector function.
- the Fc domain comprises a mutation that reduces or eliminates Clq binding. In some embodiments of the fusion protein comprising a human CI -inhibitor polypeptide and an Fc domain, the Fc domain comprises one or more mutations that reduce or eliminate Clq binding. In some embodiments of the fusion protein comprising a human Cl- inhibitor polypeptide and an Fc domain, the mutation that reduces or eliminates Clq binding is in the Fc domain.
- the fusion protein inhibits and/or inactivates Clr and/or Cls protease activity. In some embodiments of the fusion protein comprising a human CI -inhibitor polypeptide and an Fc domain, the fusion protein inhibits the lysis of red blood cells in vitro.
- the fusion protein comprising a human CI -inhibitor polypeptide and an Fc domain
- the fusion protein has a longer half-life than plasma-derived human CI -inhibitor.
- the fusion protein comprising a human Cl- inhibitor polypeptide and an Fc domain
- the fusion protein has a half-life of at least four days.
- the fusion protein has a half-life of at least five days.
- the fusion protein comprising a human CI -inhibitor polypeptide and an Fc domain
- the fusion protein has a half-life of at least six days. In some embodiments of the fusion protein comprising a human CI -inhibitor polypeptide and an Fc domain, the fusion protein has a half-life of at least seven days.
- the fusion protein comprising a human CI -inhibitor polypeptide and an Fc domain
- the fusion protein has an in vivo half-life of or greater than about 12 hours, 18 hours, 24 hours, 36 hours, 2 days, 2.5 days, 3 days, 3.5 days, 4 days, 4.5 days, 5 days, 5.5 days, 6 days, 6.5 days, 7 days, 7.5 days, 8 days, 8.5 days, 9 days, 9.5 days, or 10 days.
- a recombinant Cl-INH fusion protein has an in vivo half-life of between 0.5 and 10 days, between 1 day and 10 days, between 1 day and 9 days, between 1 day and 8 days, between 1 day and 7 days, between 1 day and 6 days, between 1 day and 5 days, between 1 day and 4 days, between 1 day and 3 days, between 2 days and 10 days, between 2 days and 9 days, between 2 days and 8 days, between 2 days and 7 days, between 2 days and 6 days, between 2 days and 5 days, between 2 days and 4 days, between 2 day and 3 days, between 2.5 days and 10 days, between 2.5 days and 9 days, between 2.5 days and 8 days, between 2.5 days and 7 days, between 2.5 days and 6 days, between 2.5 days and 5 days, between 2.5 days and 4 days, between 3 days and 10 days, between 3 days and 9 days, between 3 days and 8 days, between 3 days and 7 days, between 3 days and 6 days, between 3 days and 5 days, between 3 days and 4 days, between 3.5 days and 10 days, between 0.5 and 10
- the fusion protein comprising a human CI -inhibitor polypeptide and an Fc domain
- the fusion protein is monovalent. In some embodiments of the fusion protein comprising a human CI -inhibitor polypeptide and an Fc domain, the fusion protein is dimeric.
- the present invention provides a fusion protein comprising a human
- the human Cl- inhibitor polypeptide comprises an amino acid sequence at least at least 50% (e.g., at least 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the full length human CI -inhibitor having SEQ ID NO: 1.
- the fusion protein comprising a human CI -inhibitor polypeptide and an albumin polypeptide includes an amino acid sequence at least 70% identical to the full length human CI -inhibitor protein SEQ ID NO: l .
- the fusion protein comprising a human CI -inhibitor polypeptide and an albumin polypeptide includes an amino acid sequence at least 80% identical to the full length human CI -inhibitor protein SEQ ID NO: l . In some embodiments, the fusion protein comprising a human CI -inhibitor polypeptide and an albumin polypeptide includes an amino acid sequence at least 90% identical to the full length human CI -inhibitor protein SEQ ID NO:l . In some embodiments, the fusion protein comprising a human CI -inhibitor polypeptide and an albumin polypeptide includes an amino acid sequence at least 95% identical to the full length human Cl- inhibitor protein SEQ ID NO: 1.
- the fusion protein comprising a human CI -inhibitor polypeptide and an albumin polypeptide includes an amino acid sequence identical to the full length human CI -inhibitor protein SEQ ID NO: 1. In some embodiments, the fusion protein comprising a human CI -inhibitor polypeptide and an albumin polypeptide comprises one or more truncations, deletions, mutations or insertions compared to SEQ ID NO: l .
- the fusion protein comprising a human CI -inhibitor polypeptide and an albumin polypeptide comprises an amino acid sequence at least 50% (e.g., at least 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:2.
- the fusion protein comprising a human Cl- inhibitor polypeptide and an albumin polypeptide includes an amino acid sequence at least 70%> identical to the full length human Cl-inhibitor protein SEQ ID NO:2.
- the fusion protein comprising a human Cl-inhibitor polypeptide and an albumin polypeptide includes an amino acid sequence at least 80% identical to the full length human Cl-inhibitor protein SEQ ID NO:2. In some embodiments, the fusion protein comprising a human Cl- inhibitor polypeptide and an albumin polypeptide includes an amino acid sequence at least 90%> identical to the full length human Cl-inhibitor protein SEQ ID NO:2. In some embodiments, the fusion protein comprising a human Cl-inhibitor polypeptide and an albumin polypeptide includes an amino acid sequence at least 95% identical to the full length human Cl-inhibitor protein SEQ ID NO:2.
- the fusion protein comprising a human Cl- inhibitor polypeptide and an albumin polypeptide includes an amino acid sequence identical to the full length human Cl-inhibitor protein SEQ ID NO:2. In some embodiments, the fusion protein comprising a human Cl-inhibitor polypeptide and an albumin polypeptide comprises one or more truncations, deletions, mutations or insertions compared to SEQ ID NO:2.
- the albumin is attached to the N-terminus of the human Cl-inhibitor polypeptide.
- the albumin polypeptide comprises one or more domains of human serum albumin.
- the albumin polypeptide comprises the D3 domain of human serum albumin.
- the albumin polypeptide is derived from human serum albumin. .
- the albumin polypeptide is human serum albumin.
- an albumin polypeptide suitable for the present invention comprises an amino acid sequence at least 50%> (e.g., at least 55%, 60%>, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:20.
- the fusion protein comprising a human Cl-inhibitor polypeptide and an albumin polypeptide includes an amino acid sequence at least 70% identical to the human albumin polypeptide SEQ ID NO:20.
- the fusion protein comprising a human Cl- inhibitor polypeptide and an albumin polypeptide includes an amino acid sequence at least 80% identical to the human albumin polypeptide SEQ ID NO:20.
- the fusion protein comprising a human CI -inhibitor polypeptide and an albumin polypeptide includes an amino acid sequence at least 90% identical to the human albumin polypeptide SEQ ID NO:20. In some embodiments, the fusion protein comprising a human CI -inhibitor polypeptide and an albumin polypeptide includes an amino acid sequence at least 95% identical to the human albumin polypeptide SEQ ID NO:20. In some embodiments, the fusion protein comprising a human CI -inhibitor polypeptide and an albumin polypeptide includes an amino acid sequence identical to the human albumin polypeptide SEQ ID NO:20. In some embodiments, the fusion protein comprising a human CI -inhibitor polypeptide and an albumin polypeptide comprises one or more truncations, deletions, mutations or insertions compared to SEQ ID NO:20.
- an albumin polypeptide suitable for the present invention comprises an amino acid sequence at least 50%> (e.g., at least 55%, 60%>, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO: 17.
- the fusion protein comprising a human CI -inhibitor polypeptide and an albumin polypeptide includes an amino acid sequence at least 70% identical to the human albumin polypeptide SEQ ID NO: 17.
- the fusion protein comprising a human Cl- inhibitor polypeptide and an albumin polypeptide includes an amino acid sequence at least 80% identical to the human albumin polypeptide SEQ ID NO: 17.
- the fusion protein comprising a human CI -inhibitor polypeptide and an albumin polypeptide includes an amino acid sequence at least 90% identical to the human albumin polypeptide SEQ ID NO: 17. In some embodiments, the fusion protein comprising a human CI -inhibitor polypeptide and an albumin polypeptide includes an amino acid sequence at least 95% identical to the human albumin polypeptide SEQ ID NO: 17. In some embodiments, the fusion protein comprising a human CI -inhibitor polypeptide and an albumin polypeptide includes an amino acid sequence identical to the human albumin polypeptide SEQ ID NO: 17.
- the fusion protein comprising a human CI -inhibitor polypeptide and an albumin polypeptide comprises one or more truncations, deletions, mutations or insertions compared to SEQ ID NO: 17.
- the fusion protein comprises an amino acid sequence at least 50% (e.g., at least 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%), or 100%)) identical to SEQ ID NO: 18.
- the fusion protein comprising a human CI -inhibitor polypeptide and an albumin polypeptide includes an amino acid sequence at least 70%> identical to SEQ ID NO: 18. In some embodiments, the fusion protein comprising a human CI -inhibitor polypeptide and an albumin polypeptide includes an amino acid sequence at least 80%> identical to SEQ ID NO: 18. In some embodiments, the fusion protein comprising a human CI -inhibitor polypeptide and an albumin polypeptide includes an amino acid sequence at least 90%> identical to SEQ ID NO: 18.
- the fusion protein comprising a human CI -inhibitor polypeptide and an albumin polypeptide includes an amino acid sequence at least 95% identical to SEQ ID NO: 18. In some embodiments, the fusion protein comprising a human CI -inhibitor polypeptide and an albumin polypeptide includes an amino acid sequence identical to SEQ ID NO: 18. In some embodiments, the fusion protein comprising a human CI -inhibitor polypeptide and an albumin polypeptide comprises one or more truncations, deletions, mutations or insertions compared to SEQ ID NO: 18.
- the fusion protein comprising a human CI -inhibitor polypeptide and an albumin polypeptide
- the fusion protein comprises an amino acid sequence at least 50% (e.g., at least 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%), or 100%)) identical to SEQ ID NO: 19.
- the fusion protein comprising a human CI -inhibitor polypeptide and an albumin polypeptide includes an amino acid sequence at least 70%> identical to SEQ ID NO: 19.
- the fusion protein comprising a human CI -inhibitor polypeptide and an albumin polypeptide includes an amino acid sequence at least 80%> identical to SEQ ID NO: 19. In some embodiments, the fusion protein comprising a human CI -inhibitor polypeptide and an albumin polypeptide includes an amino acid sequence at least 90%> identical to SEQ ID NO: 19. In some embodiments, the fusion protein comprising a human CI -inhibitor polypeptide and an albumin polypeptide includes an amino acid sequence at least 95% identical to SEQ ID NO: 19.
- the fusion protein comprising a human CI -inhibitor polypeptide and an albumin polypeptide includes an amino acid sequence identical to SEQ ID NO: 19. In some embodiments, the fusion protein comprising a human CI -inhibitor polypeptide and an albumin polypeptide comprises one or more truncations, deletions, mutations or insertions compared to SEQ ID NO: 19.
- the fusion protein comprising a human CI -inhibitor polypeptide and an albumin polypeptide
- the fusion protein comprises an amino acid sequence at least 50% (e.g., at least 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%), or 100%)) identical to SEQ ID NO:21.
- the fusion protein comprising a human CI -inhibitor polypeptide and an albumin polypeptide includes an amino acid sequence at least 70% identical to SEQ ID NO:21.
- the fusion protein comprising a human CI -inhibitor polypeptide and an albumin polypeptide includes an amino acid sequence at least 80% identical to SEQ ID NO:21. In some embodiments, the fusion protein comprising a human CI -inhibitor polypeptide and an albumin polypeptide includes an amino acid sequence at least 90% identical to SEQ ID NO:21. In some embodiments, the fusion protein comprising a human CI -inhibitor polypeptide and an albumin polypeptide includes an amino acid sequence at least 95% identical to SEQ ID NO:21.
- the fusion protein comprising a human CI -inhibitor polypeptide and an albumin polypeptide includes an amino acid sequence identical to SEQ ID NO:21. In some embodiments, the fusion protein comprising a human CI -inhibitor polypeptide and an albumin polypeptide comprises one or more truncations, deletions, mutations or insertions compared to SEQ ID NO:21.
- the fusion protein comprising a human CI -inhibitor polypeptide and an albumin polypeptide
- the fusion protein comprises an amino acid sequence at least 50% (e.g., at least 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%), or 100%)) identical to SEQ ID NO:22.
- the fusion protein comprising a human CI -inhibitor polypeptide and an albumin polypeptide includes an amino acid sequence at least 70% identical to SEQ ID NO:22.
- the fusion protein comprising a human CI -inhibitor polypeptide and an albumin polypeptide includes an amino acid sequence at least 80% identical to SEQ ID NO:22. In some embodiments, the fusion protein comprising a human CI -inhibitor polypeptide and an albumin polypeptide includes an amino acid sequence at least 90% identical to SEQ ID NO:22. In some embodiments, the fusion protein comprising a human CI -inhibitor polypeptide and an albumin polypeptide includes an amino acid sequence at least 95% identical to SEQ ID NO:22.
- the fusion protein comprising a human C I -inhibitor polypeptide and an albumin polypeptide includes an amino acid sequence identical to SEQ ID NO:22. In some embodiments, the fusion protein comprising a human CI -inhibitor polypeptide and an albumin polypeptide comprises one or more truncations, deletions, mutations or insertions compared to SEQ ID NO:22.
- fusion protein comprising a human CI -inhibitor polypeptide and an albumin polypeptide comprises an amino acid sequence at least 50% (e.g., at least 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to any one of SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO:21 , or SEQ ID NO:22.
- the fusion protein comprising a human C I -inhibitor polypeptide and an albumin polypeptide includes an amino acid sequence at least 70%> identical to any one of SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO:21 , or SEQ ID NO:22.
- the fusion protein comprising a human Cl-inhibitor polypeptide and an albumin polypeptide includes an amino acid sequence at least 80% identical to any one of SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO:21 , or SEQ ID NO:22.
- the fusion protein comprising a human C l-inhibitor polypeptide and an albumin polypeptide includes an amino acid sequence at least 90%> identical to any one of SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO:21 , or SEQ ID NO:22. In some embodiments, the fusion protein comprising a human C l-inhibitor polypeptide and an albumin polypeptide includes an amino acid sequence at least 95% identical to any one of SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO:21 , or SEQ ID NO:22.
- the fusion protein comprising a human C l-inhibitor polypeptide and an albumin polypeptide includes an amino acid sequence identical to any one of SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO:21 , or SEQ ID NO:22.
- the fusion protein comprising a human Cl-inhibitor polypeptide and an albumin polypeptide comprises one or more truncations, deletions, mutations or insertions compared to SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO:21 , or SEQ ID NO:22.
- the fusion protein comprising a human C l-inhibitor polypeptide and an albumin polypeptide
- the fusion protein binds FcRN.
- the fusion protein inhibits CI esterase activity.
- the fusion protein inhibits and/or inactivates Clr and/or Cls protease activity.
- the fusion protein inhibits the lysis of red blood cells in vitro.
- the fusion protein comprises a linker between the human CI -inhibitor polypeptide and the albumin polypeptide.
- the linker is a peptide comprising 3-100 amino acids.
- the linker comprises the sequence GGG.
- the linker comprises the sequence of SEQ ID NO:27.
- the albumin polypeptide does not comprise one or more mutations selected from the group consisting of 464His, 510 His, 535 His, and/or a combination thereof.
- the fusion protein comprising a human CI -inhibitor polypeptide and an albumin polypeptide
- the fusion protein has a longer half-life than plasma- derived human CI -inhibitor.
- the fusion protein comprising a human CI -inhibitor polypeptide and an albumin polypeptide
- the fusion protein has a half-life of at least four days.
- the fusion protein has a half-life of at least five days.
- the fusion protein comprising a human CI -inhibitor polypeptide and an albumin polypeptide
- the fusion protein has a half-life of at least six days. In some embodiments of the fusion protein comprising a human CI -inhibitor polypeptide and an albumin polypeptide, the fusion protein has a half-life of at least seven days.
- the fusion protein comprising a human CI -inhibitor polypeptide and an albumin polypeptide
- the fusion protein has an in vivo half-life of or greater than about 12 hours, 18 hours, 24 hours, 36 hours, 2 days, 2.5 days, 3 days, 3.5 days, 4 days, 4.5 days, 5 days, 5.5 days, 6 days, 6.5 days, 7 days, 7.5 days, 8 days, 8.5 days, 9 days, 9.5 days, or 10 days.
- a recombinant Cl-INH fusion protein has an in vivo half- life of between 0.5 and 10 days, between 1 day and 10 days, between 1 day and 9 days, between 1 day and 8 days, between 1 day and 7 days, between 1 day and 6 days, between 1 day and 5 days, between 1 day and 4 days, between 1 day and 3 days, between 2 days and 10 days, between 2 days and 9 days, between 2 days and 8 days, between 2 days and 7 days, between 2 days and 6 days, between 2 days and 5 days, between 2 days and 4 days, between 2 day and 3 days, between 2.5 days and 10 days, between 2.5 days and 9 days, between 2.5 days and 8 days, between 2.5 days and 7 days, between 2.5 days and 6 days, between 2.5 days and 5 days, between 2.5 days and 4 days, between 3 days and 10 days, between 3 days and 9 days, between 3 days and 8 days, between 3 days and 7 days, between 3 days and 6 days, between 3 days and 5 days, between 3 days and 4 days, between 3.5 days and 10 days, between 0.5 and 10
- the present invention provides a nucleic acid encoding a fusion protein of any one of the fusion proteins comprising a human CI -inhibitor polypeptide and an Fc domain disclosed herein. In another aspect the present invention provides a nucleic acid encoding a fusion protein of any one of the fusion proteins comprising a human CI -inhibitor polypeptide and an albumin polypeptide disclosed herein.
- the present invention provides a cell comprising a nucleic acid encoding a fusion protein of any one of the fusion proteins comprising a human CI -inhibitor polypeptide and an Fc domain disclosed herein.
- the present invention provides a cell comprising a nucleic acid encoding a fusion protein of any one of the fusion proteins comprising a human CI -inhibitor polypeptide and an albumin polypeptide disclosed herein.
- the cell is a mammalian cell.
- the mammalian cell is a human cell.
- the mammalian cell is a Chinese Hamster Ovary (CHO) cell.
- the cell is engineered to modify glycosylation of protein expressed by the cell.
- the cell is engineered to modify glycosylation of protein expressed by the cell as compared to the same cell that has not been engineered.
- the cell is engineered to enhance, improve, increase and/or humanize glycosylation of protein expressed by the cell.
- the cell is engineered to enhance, improve, increase and/or humanize glycosylation of protein expressed by the cell as compared to the same cell that has not been engineered. In some embodiments, the cell is engineered to modify sialylation of protein expressed by the cell. In some embodiments, the cell is engineered to modify sialylation of protein expressed by the cell as compared to the same cell that has not been engineered. In some embodiments, the cell is engineered to enhance, improve, increase and/or humanize sialylation of protein expressed by the cell. In some embodiments, the cell is engineered to enhance, improve, increase and/or humanize sialylation of protein expressed by the cell as compared to the same cell that has not been engineered.
- the invention provides a method of producing a fusion protein comprising a step of culturing or cultivating a cell comprising a nucleic acid encoding a fusion protein of any one of the fusion proteins comprising a human CI -inhibitor polypeptide and an Fc domain disclosed herein. In one aspect, the invention provides a method of producing a fusion protein comprising a step of culturing or cultivating a cell comprising a nucleic acid encoding a fusion protein of any one of the fusion proteins comprising a human CI -inhibitor polypeptide and an albumin polypeptide disclosed herein.
- the invention provides a fusion protein comprising a human Cl- inhibitor polypeptide and an Fc domain and expressed or produced by a cell engineered to modify, enhance, improve, increase and/or humanize glycosylation.
- the invention provides a fusion protein comprising a human CI -inhibitor polypeptide and an Fc domain and expressed or produced by a cell engineered to modify, enhance, improve, increase and/or humanize sialylation.
- the invention provides a fusion protein comprising a human CI -inhibitor polypeptide and an albumin polypeptide and expressed or produced by a cell engineered to modify, enhance, improve, increase and/or humanize glycosylation.
- the invention provides a fusion protein comprising a human CI -inhibitor polypeptide and an albumin polypeptide and expressed or produced by a cell engineered to modify, enhance, improve, increase and/or humanize sialylation.
- the invention provides a pharmaceutical composition comprising a fusion protein of any one of the fusion proteins comprising a human CI -inhibitor polypeptide and an Fc domain disclosed herein and a pharmaceutically acceptable carrier.
- the invention provides a pharmaceutical composition comprising a fusion protein of any one of the fusion proteins comprising a human CI -inhibitor polypeptide and an albumin polypeptide disclosed herein and a pharmaceutically acceptable carrier.
- the invention provides a method of treating a complement-mediated disorder comprising administering to a subject in need of treatment a pharmaceutical
- composition comprising a fusion protein of any one of the fusion proteins comprising a human CI -inhibitor polypeptide and an Fc domain disclosed herein and a pharmaceutically acceptable carrier.
- the invention provides a method of treating a complement-mediated disorder comprising administering to a subject in need of treatment a pharmaceutical
- composition comprising a fusion protein of any one of the fusion proteins comprising a human CI -inhibitor polypeptide and an albumin polypeptide disclosed herein and a pharmaceutically acceptable carrier.
- the subject in need of treatment has a complement- mediated disorder.
- the complement-mediated disorder is selected from hereditary angioedema, antibody mediated rejection, neuromyelitis optica spectrum disorders, traumatic brain injury, spinal cord injury, ischemic brain injury, burn injury, toxic epidermal necrolysis, multiple sclerosis, amyotrophic lateral sclerosis (ALS), Parkinson's disease, stroke, chronic inflammatory demyelinating polyneuropathy (CIDP), myasthenia gravis, multifocal motor neuropathy.
- FIG. 1A is a schematic representation of Cl-INH. From right to left the three domains are the signal peptide, the N-terminus, also referred to as N-terminal domain, and the serpin domain. N-linked glycans are shown as long vertical lines with diamond heads and O- linked glycans are shown as short vertical lines.
- FIG. IB is a schematic representation of an exemplary dimeric Cl-INH Fc fusion protein. The Cl-INH polypeptide portions are indicated by the rectangles and the Fc portion is indicated by the oval segments.
- FIG. 1C is a schematic representation of an exemplary monomeric Cl-INH Fc fusion protein.
- FIG. 2A-2D are a schematic representations of exemplary Cl-INH fusion proteins.
- FIG. 2A is a representation of an IgGl Fc with LALA mutation fused to a full length Cl-INH polypeptide (shown as shaded rectangle).
- FIG. 2B is a representation of an IgGl Fc with LALA mutation fused to a truncated Cl-INH polypeptide (shown as shaded rectangle).
- FIG. 2C is a representation of an IgG4 Fc with S241P mutation fused to a full length Cl-INH polypeptide (shown as shaded rectangle).
- FIG. 2D is a representation of an IgG4 Fc with S241P mutation fused to a truncated Cl-INH polypeptide (shown as shaded rectangle).
- FIG. 3 shows the results of an exemplary protein A purification of full length Cl-
- INH human Fc (hFc) IgGl LALA fusion protein The graph shows the results of UV 280 nm, UV 260 nm, concentration, and pH over time during the capture and elution of the fusion protein during the purification process.
- FIG. 4 is a chart of the concentration and total protein collected during prufication of four exemplary Fc fusion constructs: full length (FL) Cl-INH hFc IgGl LALA fusion protein; truncated (Tr) Cl-INH hFc IgGl LALA fusion protein; full length (FL) Cl-INH hFc IgG4m (IgG4 S241P) fusion protein; truncated (Tr) Cl-INH hFc IgG4m (IgG4 S241P) fusion protein.
- FIG. 5 is a chart depicting the amount of endotoxin detected in the purified samples of full length (FL) Cl-INH hFc IgGl LALA fusion protein; truncated (Tr) Cl-INH hFc IgGl LALA fusion protein; full length (FL) Cl-INH hFc IgG4m (IgG4 S241P) fusion protein; truncated (Tr) Cl-INH hFc IgG4m (IgG4 S241P) fusion protein.
- FIG. 6 shows the results of an exemplary Clq binding ELISA for the hFc IgGl-
- FIG. 7 is a schematic of the surface plasmon resonance (SPR) Biacore capture approach utilized to measure binding of the exemplary fusion constructs to the extracellular domain of the FcyRl .
- FIG. 8 shows the results of SPR analysis of exemplary effector dead Fc fusion constructs: full length (FL) Cl-INH hFc IgGl LALA fusion protein; truncated (Tr) Cl-INH hFc IgGl LALA fusion protein; full length (FL) Cl-INH hFc IgG4m (IgG4 S241P) fusion protein; truncated (Tr) Cl-INH hFc IgG4m (IgG4 S241P) fusion protein.
- Plasma-derived Cl-INH was included as a positive control.
- FIGs. 9A and 9B present the results of an assay to measure the ability of the effector dead constructs to inhibit Cls cleavage of a colorimetric peptide.
- FIG. 9A shows the titration curve for each of the exemplary effector dead constructs tested using the mass spectrometry calculated molecular weights for each of the constructs.
- FIG. 9B shows the titration curve for each of the exemplary effector dead constructs tested using the gel estimated molecular weights for each of the constructs.
- FIG. 10A depicts a schematic overview of a hemolysis assay to measure the activation of the alternative pathway of complement (APC).
- FIG. 10B depicts a schematic overview of a hemolysis assay to measure the activation of the classical pathway of complement.
- FIGs. 11A, 1 IB, and 11C show the results of a hemolysis assay to measure the activation of the alternative pathway of complement.
- FIG. 11 A shows the results comparing truncated (Tr) Cl-INH hFc IgGl LALA fusion protein, full length (FL) Cl-INH hFc IgGl LALA fusion protein , a plasma-derived Cl-INH preparation, and CalBiochem commercially available plasma-derived Cl-INH. The absorbance readings are plotted as a percentage of the control by the concentration of the tested proteins.
- FIG. 1 IB shows the plot of raw data collected for each of the samples.
- FIG. 11C shows the plot of the controls run in the assay.
- FIG. 12 shows exemplary results of a Rabbit PK study of the effector dead fusion constructs compared with two preparations of plasma-derived CI -inhibitor and HT1080 expressed recombinant Cl-INH. IV administration of plasma-derived Cl-INH exhibits a monophasic serum concentration-time profile.
- FIGs. 13A-13F are schematic representations of exemplary albumin fusion constructs generated.
- FIG. 13A is a schematic representation of a human serum albumin (HSA) fused to Cl-INH.
- FIG. 13B is a schematic representation of HSA joined to Cl-INH via a GGG linker.
- FIG. 13C is a schematic representation of HSA joined to Cl-INH via a (GGGGS)2 linker.
- FIG. 13D is a schematic representation of the D3 domain of HSA fused to Cl-INH.
- FIG. 13E is a schematic representation of the D3 domain of HSA joined to Cl-INH via a GGG linker.
- FIG. 13F is a schematic representation of the D3 domain of HSA joined to Cl-INH via a
- FIG. 14 present the results of an assay to measure the ability of some exemplary albumin Cl-INH fusion constructs to inhibit Cls cleavage of a colorimetric peptide, including a plasma-derived Cl-INH and HT1080 expressed recombinant Cl-INH for comparison.
- animal refers to any member of the animal kingdom. In some embodiments, “animal” refers to humans, at any stage of development. In some embodiments, “animal” refers to non-human animals, at any stage of development. In certain embodiments, the non-human animal is a mammal ⁇ e.g., a rodent, a mouse, a rat, a rabbit, a monkey, a dog, a cat, a sheep, cattle, a primate, and/or a pig). In some embodiments, animals include, but are not limited to, mammals, birds, reptiles, amphibians, fish, insects, and/or worms. In some embodiments, an animal may be a transgenic animal, genetically-engineered animal, and/or a clone.
- the term “approximately” or “about” refers to a range of values that fall within 25%, 20%, 19%, 18%, 17%, 16%, 15%, 14%, 13%, 12%, 11%, 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%), 2%>, 1%), or less in either direction (greater than or less than) of the stated reference value unless otherwise stated or otherwise evident from the context (except where such number would exceed 100% of a possible value).
- Bioavailability As used herein, the term “bioavailability” generally refers to the percentage of the administered dose that reaches the blood stream of a subject.
- biologically active refers to a characteristic of any agent that has activity in a biological system, and particularly in an organism. For instance, an agent that, when administered to an organism, has a biological effect on that organism, is considered to be biologically active.
- an agent that, when administered to an organism, has a biological effect on that organism is considered to be biologically active.
- a portion of that peptide that shares at least one biological activity of the peptide is typically referred to as a "biologically active" portion.
- Carrier or diluent refers to a pharmaceutically acceptable (e.g., safe and non-toxic for administration to a human) carrier or diluting substance useful for the preparation of a pharmaceutical formulation.
- exemplary diluents include sterile water, bacteriostatic water for injection (BWFI), a pH buffered solution (e.g. phosphate-buffered saline), sterile saline solution, Ringer's solution or dextrose solution.
- CI -inhibitor or CI esterase inhibitor or Cl-INH can all be used interchangeably and refer to any wild-type or modified Cl-INH polypeptides (e.g., Cl-INH proteins with amino acid mutations, deletions, insertions, and/or fusion proteins) that retain substantial Cl-INH biological activity unless otherwise specified.
- Cl-INH may be recombinantly expressed in cells. In certain embodiments, the Cl-INH is expressed in mammalian cells, preferably CHO cells or human cells.
- Functional equivalent or derivative denotes, in the context of a functional derivative of an amino acid sequence, a molecule that retains a biological activity (either function or structural) that is substantially similar to that of the original sequence.
- a functional derivative or equivalent may be a natural derivative or is prepared synthetically.
- Exemplary functional derivatives include amino acid sequences having substitutions, deletions, or additions of one or more amino acids, provided that the biological activity of the protein is conserved.
- the substituting amino acid desirably has chemico-physical properties which are similar to that of the substituted amino acid. Desirable similar chemico-physical properties include, similarities in charge, bulkiness, hydrophobicity, hydrophilicity, and the like.
- Fusion protein refers to a protein created through the joining of two or more originally separate proteins, or portions thereof. In some embodiments, a linker or spacer will be present between each protein.
- Half-Life As used herein, the term "half-life" is the time required for a quantity such as protein concentration or activity to fall to half of its value as measured at the beginning of a time period.
- Hereditary angioedema or HAE As used herein, the term "hereditary angioedema or HAE: As used herein, the term "hereditary angioedema or HAE: As used herein, the term "hereditary angioedema or HAE: As used herein, the term "hereditary angioedema or HAE: As used herein, the term "hereditary
- angioedema refers to a blood disorder characterized by unpredictable and recurrent attacks of inflammation. HAE is typically associated with Cl-INH deficiency, which may be the result of low levels of Cl-INH or Cl-INH with impaired or decreased activity. Symptoms include, but are not limited to, swelling that can occur in any part of the body, such as the face, extremities, genitals, gastrointestinal tract and upper airways.
- “reduce,” or grammatical equivalents indicate values that are relative to a baseline measurement, such as a measurement in the same individual prior to initiation of the treatment described herein, or a measurement in a control subject (or multiple control subject) in the absence of the treatment described herein.
- a “control subject” is a subject afflicted with the same form of disease as the subject being treated, who is about the same age as the subject being treated.
- in vitro refers to events that occur in an artificial environment, e.g., in a test tube or reaction vessel, in cell culture, etc., rather than within a multi-cellular organism.
- in vivo refers to events that occur within a multi-cellular organism, such as a human and a non-human animal. In the context of cell-based systems, the term may be used to refer to events that occur within a living cell (as opposed to, for example, in vitro systems).
- Linker refers to, in a fusion protein, an amino acid sequence other than that appearing at a particular position in the natural protein and is generally designed to be flexible or to interpose a structure, such as an a-helix, between two protein moieties.
- a linker is also referred to as a spacer.
- a linker or a spacer typically does not have biological function on its own.
- Polypeptide refers to a sequential chain of amino acids linked together via peptide bonds. The term is used to refer to an amino acid chain of any length, but one of ordinary skill in the art will understand that the term is not limited to lengthy chains and can refer to a minimal chain comprising two amino acids linked together via a peptide bond. As is known to those skilled in the art, polypeptides may be processed and/or modified. As used herein, the terms “polypeptide” and “peptide” are used inter-changeably.
- Prevent As used herein, the term “prevent” or “prevention”, when used in connection with the occurrence of a disease, disorder, and/or condition, refers to reducing the risk of developing the disease, disorder and/or condition. See the definition of "risk.”
- Protein refers to one or more polypeptides that function as a discrete unit. If a single polypeptide is the discrete functioning unit and does not require permanent or temporary physical association with other polypeptides in order to form the discrete functioning unit, the terms “polypeptide” and “protein” may be used interchangeably. If the discrete functional unit is comprised of more than one polypeptide that physically associate with one another, the term “protein” refers to the multiple polypeptides that are physically coupled and function together as the discrete unit.
- a "risk" of a disease, disorder, and/or condition comprises a likelihood that a particular individual will develop a disease, disorder, and/or condition ⁇ e.g., muscular dystrophy).
- risk is expressed as a percentage.
- risk is from 0,1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 20, 30, 40, 50, 60, 70, 80, 90 up to 100%.
- risk is expressed as a risk relative to a risk associated with a reference sample or group of reference samples.
- a reference sample or group of reference samples have a known risk of a disease, disorder, condition and/or event (e.g., muscular dystrophy).
- a reference sample or group of reference samples are from individuals comparable to a particular individual.
- relative risk is 0,1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more.
- Subject refers to a human or any non-human animal (e.g., mouse, rat, rabbit, dog, cat, cattle, swine, sheep, horse or primate).
- a human includes pre- and post-natal forms.
- a subject is a human being.
- a subject can be a patient, which refers to a human presenting to a medical provider for diagnosis or treatment of a disease.
- the term "subject” is used herein interchangeably with “individual” or "patient.”
- a subject can be afflicted with or is susceptible to a disease or disorder but may or may not display symptoms of the disease or disorder.
- the term “substantially” refers to the qualitative condition of exhibiting total or near-total extent or degree of a characteristic or property of interest.
- One of ordinary skill in the biological arts will understand that biological and chemical phenomena rarely, if ever, go to completion and/or proceed to completeness or achieve or avoid an absolute result.
- the term “substantially” is therefore used herein to capture the potential lack of completeness inherent in many biological and chemical phenomena.
- Substantial homology is used herein to refer to a comparison between amino acid or nucleic acid sequences. As will be appreciated by those of ordinary skill in the art, two sequences are generally considered to be “substantially homologous” if they contain homologous residues in corresponding positions. Homologous residues may be identical residues. Alternatively, homologous residues may be non-identical residues will appropriately similar structural and/or functional characteristics.
- amino acids are typically classified as “hydrophobic” or “hydrophilic” amino acids, and/or as having "polar” or “non-polar” side chains Substitution of one amino acid for another of the same type may often be considered a
- amino acid or nucleic acid sequences may be compared using any of a variety of algorithms, including those available in commercial computer programs such as BLASTN for nucleotide sequences and BLASTP, gapped BLAST, and PSI- BLAST for amino acid sequences.
- Exemplary such programs are described in Altschul, et al, Basic local alignment search tool, J. Mol. Biol, 215(3): 403-410, 1990; Altschul, et al, Methods in Enzymology; Altschul, et al, "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402, 1997; Baxevanis, et al,
- the relevant stretch is a complete sequence. In some embodiments, the relevant stretch is at least 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 125, 150, 175, 200, 225, 250, 275, 300, 325, 350, 375, 400, 425, 450, 475, 500 or more residues.
- Substantial identity is used herein to refer to a comparison between amino acid or nucleic acid sequences. As will be appreciated by those of ordinary skill in the art, two sequences are generally considered to be “substantially identical” if they contain identical residues in corresponding positions. As is well known in this art, amino acid or nucleic acid sequences may be compared using any of a variety of algorithms, including those available in commercial computer programs such as BLASTN for nucleotide sequences and BLASTP, gapped BLAST, and PSI-BLAST for amino acid sequences. Exemplary such programs are described in Altschul, et al., Basic local alignment search tool, J. Mol.
- two sequences are considered to be substantially identical if at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%), 96%o, 97%), 98%o, 99%> or more of their corresponding residues are identical over a relevant stretch of residues.
- the relevant stretch is a complete sequence.
- the relevant stretch is at least 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 125, 150, 175, 200, 225, 250, 275, 300, 325, 350, 375, 400, 425, 450, 475, 500 or more residues.
- Susceptible to An individual who is "susceptible to" a disease, disorder, and/or condition has not been diagnosed with the disease, disorder, and/or condition. In some embodiments, an individual who is susceptible to a disease, disorder, and/or condition may not exhibit symptoms of the disease, disorder, and/or condition.
- an individual who is susceptible to a disease, disorder, condition, or event may be characterized by one or more of the following: (1) a genetic mutation associated with development of the disease, disorder, and/or condition; (2) a genetic polymorphism associated with development of the disease, disorder, and/or condition; (3) increased and/or decreased expression and/or activity of a protein associated with the disease, disorder, and/or condition; (4) habits and/or lifestyles associated with development of the disease, disorder, condition, and/or event (5) having undergone, planning to undergo, or requiring a transplant.
- a genetic mutation associated with development of the disease, disorder, and/or condition for example, DMD
- a genetic polymorphism associated with development of the disease, disorder, and/or condition
- increased and/or decreased expression and/or activity of a protein associated with the disease, disorder, and/or condition (4) habits and/or lifestyles associated with development of the disease, disorder, condition, and/or event (5) having undergone, planning to undergo, or requiring a transplant.
- an individual who is susceptible to a disease, disorder, and/or condition will develop the disease, disorder, and/or condition. In some embodiments, an individual who is susceptible to a disease, disorder, and/or condition will not develop the disease, disorder, and/or condition.
- therapeutically effective amount As used herein, the term "therapeutically effective amount" of a therapeutic agent means an amount that is sufficient, when administered to a subject suffering from or susceptible to a disease, disorder, and/or condition, to treat, diagnose, prevent, and/or delay the onset of the symptom(s) of the disease, disorder, and/or condition. It will be appreciated by those of ordinary skill in the art that a therapeutically effective amount is typically administered via a dosing regimen comprising at least one unit dose.
- Treating refers to any method used to partially or completely alleviate, ameliorate, relieve, inhibit, prevent, delay onset of, reduce severity of and/or reduce incidence of one or more symptoms or features of a particular disease, disorder, and/or condition. Treatment may be administered to a subject who does not exhibit signs of a disease and/or exhibits only early signs of the disease for the purpose of decreasing the risk of developing pathology associated with the disease.
- the present invention provides, among other things, methods and compositions for treating complement-mediated disorders, including Hereditary angioedema (HAE), based on Cl-INH as a protein therapeutic.
- HAE Hereditary angioedema
- Human C 1 -INH is an important anti-inflammatory plasma protein with a wide range of inhibitory and non-inhibitory biological activities. By sequence homology, structure of its C-terminal domain, and mechanism of protease inhibition, it belongs to the serpin
- Cl-INH is an inhibitor of proteases in the complement system, the contact system of kinin generation, and the intrinsic coagulation pathway.
- Cl-INH has been shown to inhibit Clr and Cls of the complement system.
- Cl-INH is also a major regulator of coagulation factors XI and XII, as well as kallikrein and other serine proteases of the coagulation and fibrinolytic systems including tissue type plasminogen activator and plasmin.
- Low plasma content of Cl-INH or its dysfunction result in the activation of both complement and contact plasma cascades, and may affect other systems as well.
- a decrease in Cl-INH plasma content to levels lower than 55 ⁇ / ⁇ . (-25% of normal) has been shown to induce spontaneous activation of C 1.
- FIG. 1A A schematic depicting the structure of Cl-INH is provided in FIG. 1A.
- the signal peptide, N-terminal domain, and serpin domain are shown.
- Cl-INH is The 22 amino acid signal peptide is required for secretion and cleaved from the rest of the Cl-INH protein.
- Cl-INH has two domains: a C-terminal domain having 365 amino acids, which is a typical serpin domain, and an N-terminal domain having 113 amino acids.
- the protein is stabilized by two disulfide bridges which connect the domains.
- disulfide bridges are formed by CyslOl of the N-terminal domain which forms a disulfide bond with Cys406 of the C-terminal (serpin) domain and Cysl08 of the N-terminal domain which forms a disulfide bond with Cysl83 of C- terminal domain.
- the serpin domain is responsible for the protease activity of Cl-INH.
- Pl-Pl ' denotes the Arg444-Thr445 scissile bond.
- More than 26% of the weight of the glycosylated protein is carbohydrate.
- the glycans are unevenly distributed over human Cl-INH.
- the N-terminus is heavily glycosylated, having three N-linked (shown as long vertical lines with diamond heads) and at least seven O- linked (shown as short vertical lines) carbohydrate groups.
- Three N-attached glycans are attached to asparagine residues Asn216, Asn231, and Asn330 in the serpin domain (shown as long vertical lines with diamond heads).
- the functional role of the exceptionally long and heavily glycosylated N-terminal domain is still unclear, it may be essential for the protein's conformational stability, recognition, affinity to endotoxins and selectins, and clearance.
- the intrinsic heterogeneity of the carbohydrate moiety greatly contributes to the heterogeneity of the whole Cl-INH, one of the reasons why production of a recombinant Cl-INH mimicking the properties of plasma-derived Cl-
- C 1 -INH fusion proteins suitable for the present invention comprise any wild-type and modified Cl-INH polypeptides (e.g., Cl-INH proteins with amino acid mutations, deletions, truncations, and/or insertions) that retain substantial Cl-INH biological activity.
- a Cl-INH fusion protein is produced using recombinant technology.
- a suitable recombinant Cl-INH fusion protein has an in vivo half-life of or greater than about 12 hours, 18 hours, 24 hours, 36 hours, 2 days, 2.5 days, 3 days, 3.5 days, 4 days, 4.5 days, 5 days, 5.5 days, 6 days, 6.5 days, 7 days, 7.5 days, 8 days, 8.5 days, 9 days, 9.5 days, or 10 days.
- a recombinant Cl-INH fusion protein has an in vivo half- life of between 0.5 and 10 days, between 1 day and 10 days, between 1 day and 9 days, between 1 day and 8 days, between 1 day and 7 days, between 1 day and 6 days, between 1 day and 5 days, between 1 day and 4 days, between 1 day and 3 days, between 2 days and 10 days, between 2 days and 9 days, between 2 days and 8 days, between 2 days and 7 days, between 2 days and 6 days, between 2 days and 5 days, between 2 days and 4 days, between 2 day and 3 days, between 2.5 days and 10 days, between 2.5 days and 9 days, between 2.5 days and 8 days, between 2.5 days and 7 days, between 2.5 days and 6 days, between 2.5 days and 5 days, between 2.5 days and 4 days, between 3 days and 10 days, between 3 days and 9 days, between 3 days and 8 days, between 3 days and 7 days, between 3 days and 6 days, between 3 days and 5 days, between 3 days and 4 days, between 3.5 days and 10 days, between 0.5 and 10
- a suitable recombinant Cl-INH fusion protein has an in vivo half-life of or greater than about 4 days, 4.5 days, 5 days, 5.5 days, 6 days, 6.5 days, 7 days, 7.5 days, 8 days, 8.5 days, 9 days, 9.5 days, or 10 days.
- a recombinant Cl-INH fusion protein has an in vivo half- life of between 4 days and 9 days, between 4 days and 8 days, between 4 days and 7 days, between 4 days and 6 days, between 4 days and 5 days, between 4.5 days and 10 days, between 4.5 days and 9 days, between 4.5 days and 8 days, between 4.5 days and 7 days, between 4.5 days and 6 days, between 4.5 days and 5 days, between 5 days and 10 days, between 5 days and 9 days, between 5 days and 8 days, between 5 days and 7 days, between 5 days and 6 days, between 5.5 days and 10 days, between 5.5 days and 9 days, between 5.5 days and 8 days, between 5.5 days and 7 days, between 5.5 days and 6 days, between 6 days and 10 days, between 7 days and 10 days, between 8 days and 10 days, between 9 days and 10 days.
- a recombinant Cl-INH polypeptide suitable for the present invention includes an amino acid sequence at least 50% (e.g., at least 55%, 60%>, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the wild-type human Cl-INH protein (amino acids 1-478) (amino acids 1-97 are underlined):
- a recombinant Cl-INH polypeptide suitable for the present invention includes an amino acid sequence at least 50%> (e.g., at least 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the wild-type human Cl-INH protein (amino acids 98-478):
- SEQ ID NO:l represents the canonical amino acid sequence for the human Cl-INH protein.
- a Cl-INH polypeptide may be a truncated Cl-INH such as SEQ ID NO:2.
- a suitable recombinant Cl-INH polypeptide may be a homologue or an analogue of a wild-type or naturally-occurring protein.
- a homologue or an analogue of human wild-type or naturally-occurring Cl-INH polypeptide may contain one or more amino acid or domain substitutions, deletions, and/or insertions as compared to a wild-type or naturally-occurring Cl-INH protein (e.g., SEQ ID NO: l), while retaining substantial Cl-INH protein activity.
- a recombinant Cl-INH polypeptide suitable for the present invention is substantially homologous to human Cl-INH protein (SEQ ID NO: l).
- a recombinant Cl-INH polypeptide suitable for the present invention has an amino acid sequence at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more homologous to SEQ ID NO: l .
- a recombinant Cl-INH polypeptide suitable for the present invention is substantially identical to human Cl-INH protein (SEQ ID NO: 1).
- a recombinant Cl-INH polypeptide suitable for the present invention has an amino acid sequence at least 50%>, 55%, 60%>, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more identical to SEQ ID NO: l .
- Homologues or analogues of human C 1 -INH proteins can be prepared according to methods for altering polypeptide sequence known to one of ordinary skill in the art such as are found in references that compile such methods.
- two sequences are generally considered to be "substantially homologous” if they contain homologous residues in corresponding positions.
- homologous residues may be identical residues.
- homologous residues may be non-identical residues will appropriately similar structural and/or functional characteristics. For example, as is well known by those of ordinary skill in the art, certain amino acids are typically classified as "hydrophobic" or
- “hydrophilic” amino acids and/or as having "polar” or “non-polar” side chains. Substitution of one amino acid for another of the same type may often be considered a “homologous" substitution.
- conservative substitutions of amino acids include substitutions made among amino acids within the following groups: (a) M, I, L, V; (b) F, Y, W; (c) K, R, H; (d) A, G; (e) S, T; (f) Q, N; and (g) E, D.
- a “conservative amino acid substitution” refers to an amino acid substitution that does not alter the relative charge or size characteristics of the protein in which the amino acid substitution is made.
- amino acid or nucleic acid sequences may be compared using any of a variety of algorithms, including those available in commercial computer programs such as BLASTN for nucleotide sequences and BLASTP, gapped BLAST, and PSI- BLAST for amino acid sequences.
- Exemplary such programs are described in Altschul, et al, Basic local alignment search tool, J. Mo I Biol, 215(3): 403-410, 1990; Altschul, et al, Methods in Enzymology; Altschul, et al, "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402, 1997; Baxevanis, et al,
- a recombinant Cl-INH polypeptide suitable for the present invention contains one or more amino acid deletions, insertions or replacement as compared to a wild-type human Cl-INH protein.
- a suitable recombinant Cl-INH polypeptide may be truncated, such as the polypeptide of SEQ ID NO:2.
- a recombinant Cl-INH polypeptide suitable for the present invention includes an amino acid sequence at least 50% (e.g., at least 55%, 60%>, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the truncated wild-type human Cl-INH protein (amino acids 98-478):
- a Cl-INH polypeptide may be a truncated Cl-INH while retaining substantial Cl-INH protein activity, such as SEQ ID NO:2.
- a recombinant Cl-INH polypeptide suitable for the present invention is substantially homologous to human Cl-INH protein (SEQ ID NO:2).
- a recombinant Cl-INH polypeptide suitable for the present invention has an amino acid sequence at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%), 98%), 99%) or more homologous to SEQ ID NO:2.
- a recombinant Cl-INH polypeptide suitable for the present invention is substantially identical to human Cl- INH protein (SEQ ID NO:2).
- a recombinant Cl-INH polypeptide suitable for the present invention has an amino acid sequence at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more identical to SEQ ID NO:2.
- the recombinant Cl-INH fusion protein suitable for the present invention is a fusion protein between a Cl-INH domain and another domain or moiety that typically can facilitate a therapeutic effect of Cl-INH by, for example, enhancing or increasing half- life, stability, potency, and/or delivery of Cl-INH protein, or reducing or eliminating
- Such suitable domains or moieties for a Cl-INH fusion protein include but are not limited to Fc domains and albumin domains.
- a suitable Cl-INH fusion protein contains an Fc domain or a portion thereof that binds to the FcRn receptor.
- a suitable Fc domain may be derived from an immunoglobulin subclass such as IgG.
- a suitable Fc domain is derived from IgGl, IgG2, IgG3, or IgG4.
- a suitable Fc domain is derived from IgM, IgA, IgD, or IgE.
- Particularly suitable Fc domains include those derived from human or humanized antibodies.
- a suitable Fc domain is a modified Fc portion, such as a modified human Fc portion.
- CI -inhibitor Fc fusion proteins may exist as dimers, as shown in FIG. 1A.
- an Fc domain suitable for the present invention includes an amino acid sequence at least 50% (e.g., at least 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the wild-type human IgGl Fc domain:
- Wild type IgGl has a low level of complement cascade activation, any may undesirable for patients suffering from a complement-mediated disorder.
- IgG choice for effector dead constructs which reduce or eliminate complement activation and antibody-dependent cell- mediated cytotoxicity (ADCC) activity may be important.
- Suitable Fc domains include IgGl with mutations of L234A and L235A (LALA).
- an Fc domain suitable for the present invention includes an amino acid sequence at least 50% (e.g., at least 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to a human IgGl Fc domain having a LALA mutation (mutated residues underlined):
- a suitable Fc domain comprises one or more amino acid mutations that lead to improved binding to FcRn.
- Various mutations within the Fc domain that effect improved binding to FcRn are known in the art and can be adapted to practice the present invention.
- a suitable Fc domain comprises one or more mutations at one or more positions corresponding to Thr 250, Met 252, Ser 254, Thr 256, Thr 307, Glu 380, Met 428, His 433, and/or Asn 434 of human IgGl .
- a suitable Fc domain may contain mutations of H433K (His433Lys) and/or N434F (Asn434Phe).
- a suitable Fc domain may contain mutations H433K (His433Lys) and N434F (Asn434Phe) (Nhance). Additional amino acid substitutions that can be included in a Fc domain include those described in, e.g., U.S. Patent Nos. 6,277,375; 8,012,476; and 8,163,881, which are incorporated herein by reference.
- an Fc domain suitable for the present invention includes an amino acid sequence at least 50% (e.g., at least 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to a human IgGl Fc domain having Nhance mutation (mutated residues underlined):
- an Fc domain suitable for the present invention includes an amino acid sequence at least 50% (e.g., at least 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to a human IgGl Fc domain having both LALA and Nhance mutations (mutated residues underlined):
- an Fc domain suitable for the present invention includes an amino acid sequence at least 50% (e.g., at least 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to a human IgGl Fc domain with a signal peptide, and having Nhance mutation (signal peptide and mutated residues underlined):
- an Fc domain suitable for the present invention includes an amino acid sequence at least 50% (e.g., at least 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to a human IgGl Fc domain with a signal peptide, and having both LALA and Nhance mutations (mutated residues underlined):
- an Fc domain suitable for the present invention includes an amino acid sequence at least 50% (e.g., at least 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the wild-type human IgG4 Fc domain:
- an Fc domain suitable for the present invention includes an amino acid sequence at least 50% (e.g., at least 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the human IgG4 Fc domain having an S241P mutation (mutated residue underlined):
- a suitable Fc domain comprises an amino acid sequence at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more homologous or identical to SEQ ID NO:3, SEQ ID NO:4, or SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7, SEQ ID NO:8, SEQ ID NO:9, or SEQ ID NO:10.
- IgG4 IgG choice for "effector dead" Fc fusion proteins is important in HAE (eliminate complement activation and ADCC). Specifically, IgG4 is reported to have lower complement activation than WT IgGl . Expression of native IgG4 results in mixed species of construct sizing. Accordingly, IgG4 S241P was chosen for this program due to the increased stability and maintenance of dimeric structure exhibited by IgG4 S241P mutants, based on prior art.
- the human IgG4 core hinge region sequence according to the invention preferably comprises an S228P substitution according to the EU index as in Kabat.
- This substitution has also been referred to as S241P according to Kabat et al (1987 Sequences of proteins of immunological interest. United States Department of Health and Human Services, Washington DC).
- the substitution has the effect of making the sequence of the core of the hinge region the same as that of a Wild-type IgGl or IgG2 isotype antibody.
- the IgG4 isotype antibody it results in the production of the homogenous form of the IgG4 antibody and hence abrogates the dissociation and reassociation of the heavy chains which often leads to the production of heterodimeric IgG4 antibodies.
- IgG4 is preferred for stability at high concentrations.
- a suitable recombinant Cl-INH fusion protein includes a Cl-INH polypeptide, an Fc domain, wherein the Cl-INH polypeptide comprises an amino acid sequence at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the wild-type human Cl-INH polypeptide (SEQ ID NO: 1) or a truncated Cl-INH polypeptide (SEQ ID NO:2).
- SEQ ID NO: 1 wild-type human Cl-INH polypeptide
- SEQ ID NO:2 a truncated Cl-INH polypeptide
- a suitable recombinant Cl-INH fusion protein has an in vivo half-life ranging from about 0.5-10 days (e.g., about 0.5-5.5 days, about 0.5-5 days, about 1-5 days, about 1.5-5 days, about 1.5-4.5 days, about 1.5-4.0 days, about 1.5-3.5 days, about 1.5-3 days, about 1.5-2.5 days, about 2-6 days, about 2-5.5 days, about 2-5 days, about 2-4.5 days, about 2-4 days, about 2-3.5 days, about 2-3 days).
- 0.5-10 days e.g., about 0.5-5.5 days, about 0.5-5 days, about 1-5 days, about 1.5-5 days, about 1.5-4.5 days, about 1.5-4.0 days, about 1.5-3.5 days, about 1.5-3 days, about 1.5-2.5 days, about 2-6 days, about 2-5.5 days, about 2-5 days, about 2-4.5 days, about 2-4 days, about 2-3.5 days, about 2-3 days).
- a suitable recombinant Cl-INH fusion protein has an in vivo half-life ranging from about 2-10 days (e.g., ranging from about 2.5-10 days, from about 3-10 days, from about 3.5-10 days, from about 4-10 days, from about 4.5-10 days, from about 5-10 days, from about 3-8 days, from about 3.5-8 days, from about 4-8 days, from about 4.5-8 days, from about 5-8 days, from about 3-6 days, from about 3.5-6 days, from about 4-6 days, from about 4.5-6 days, from about 5-6 days).
- 2-10 days e.g., ranging from about 2.5-10 days, from about 3-10 days, from about 3.5-10 days, from about 4-10 days, from about 4.5-10 days, from about 5-10 days, from about 3-8 days, from about 3.5-8 days, from about 4-8 days, from about 4.5-8 days, from about 5-8 days, from about 3-6 days, from about 3.5-6 days, from about 4-6 days, from about 4.5-6 days, from about 5-6 days).
- a suitable recombinant Cl-INH fusion protein has an in vivo half-life of or greater than about 12 hours, 18 hours, 24 hours, 36 hours, 2 days, 2.5 days, 3 days, 3.5 days, 4 days, 4.5 days, 5 days, 5.5 days, 6 days, 6.5 days, 7 days, 7.5 days, 8 days, 8.5 days, 9 days, 9.5 days, or 10 days.
- a recombinant Cl-INH fusion protein has an in vivo half- life of between 0.5 and 10 days, between 1 day and 10 days, between 1 day and 9 days, between 1 day and 8 days, between 1 day and 7 days, between 1 day and 6 days, between 1 day and 5 days, between 1 day and 4 days, between 1 day and 3 days, between 2 days and 10 days, between 2 days and 9 days, between 2 days and 8 days, between 2 days and 7 days, between 2 days and 6 days, between 2 days and 5 days, between 2 days and 4 days, between 2 day and 3 days, between 2.5 days and 10 days, between 2.5 days and 9 days, between 2.5 days and 8 days, between 2.5 days and 7 days, between 2.5 days and 6 days, between 2.5 days and 5 days, between 2.5 days and 4 days, between 3 days and 10 days, between 3 days and 9 days, between 3 days and 8 days, between 3 days and 7 days, between 3 days and 6 days, between 3 days and 5 days, between 3 days and 4 days, between 3.5 days and 10 days, between 0.5 and 10
- Fc moieties may be directly fused to the N-terminal region of the full length (1-478 aa) as well as truncated (98-478) CI -inhibitor.
- suitable Cl-INH Fc fusion proteins may have an amino acid sequence shown below:
- a suitable recombinant Cl-INH Fc fusion protein has an amino acid sequence at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more homologous or identical to SEQ ID NO: l 1, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO:14, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO:32, or SEQ ID NO:33.
- a Cl-INH-Fc fusion protein may be provided in various configurations including homodimeric or monomeric configurations.
- a suitable homodimeric configuration may be designed to have the C-terminal end of fusion partner (e.g., a Cl-INH polypeptide plus linker) attached to the N-terminal end of both Fc polypeptide strands.
- a suitable monomeric configuration may be designed to have the C-terminal end of fusion partner (e.g., a Cl-INH polypeptide plus linker) fused to one Fc dimer.
- Monomeric, also referred to herein as monovalent, forms may be preferred for certain applications and routes of administration, e.g., subcutaneous administration.
- a monomeric configuration may decrease steric hindrance, increase half-life, and/or may increase bioavailability.
- Cl-INH Fc fusion constructs Monovalent forms may also be preferred for Cl-INH Fc fusion constructs because Cl-INH is a suicide inhibitor. Since it is a suicide inhibitor, the binding of one Cl-INH "arm" of a dimer Fc fusion will result in increased rate of clearance of the bound Cl-INH fusion protein, even in the event that a second arm remain unbound.
- Fc fusion proteins both monomeric and dimeric, is that Fc expression was found to occur at higher levels than expression of Cl-INH alone.
- Activity assays comparing the dimeric Cl-INH Fc constructs with recombinant Cl-INH have been shown to have similar Clq binding activity.
- the inclusion of a linker was also tested and found not to affect the ability of Fc-Cl-INH fusion protein to bind its target.
- Methods of making monomeric antibody fusion proteins include those described in, e.g., PCT Publication Nos. WO2011/063348; WO2012/020096; WO2013/138643;
- Monovalent CI -inhibitor can be made by using a plasmid containing the Fc-Cl co transfected with a plasmid expressing Fc alone. In addition, it could be made by using a dual promoter plasmid with one promoter generating Fc-Cl and the other promoter generating Fc alone. Monovalent Fc could also be made using bispecific technology where specific amino acids in the hinge region of the Fc are mutated to impart stability of the Fc region (e.g. Knob and hole technology or other stabilizing mutations which drive formation of the monovalent CI).
- percent (%) amino acid sequence identity with respect to a reference protein sequence (e.g., a reference Cl-INH protein sequence) identified herein is defined as the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in the reference sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, ALIGN or Megalign (DNASTAR) software.
- WU-BLAST-2 software is used to determine amino acid sequence identity (Altschul et ah, Methods in Enzvmology 266, 460-480 (1996); http://blast.wustl/edu/blast/README.html).
- WU-BLAST- 2 uses several search parameters, most of which are set to the default values.
- HSP score (S) and HSP S2 parameters are dynamic values and are established by the program itself, depending upon the composition of the particular sequence, however, the minimum values may be adjusted and are set as indicated above.
- Albumin is a soluble, monomeric protein which comprises about one-half of the blood serum protein.
- Albumin functions primarily as a carrier protein for steroids, fatty acids, and thyroid hormones and plays a role in stabilizing extracellular fluid volume.
- Alubumin has a globular unglycosylated serum protein of molecular weight 66,500.
- Albumin is synthesized in the liver as preproalbumin which has an N-terminal peptide that is removed before the nascent protein is released from the rough endoplasmic reticulum. The product, proalbumin, is in turn cleaved in the Golgi vesicles to produce the secreted albumin.
- Albumin is made up of three homologous domains ( ⁇ - ⁇ ), and each of these is comprised of two subdomains (A and B).
- the principal regions of ligand binding to human serum albumin are located in cavities in subdomains IIA and IIIA, which are formed mostly of hydrophobic and positively charged residues and exhibit similar chemistry.
- Human serum albumin has 585 amino acids and a molecular mass of 66,500 Da.
- the amino acids include 35 cysteines, all but one of which are involved in the formation of 17 stabilizing disulfide bonds.
- Albumin has a prolonged serum half-life of 19 days.
- FcRn controls the long serum half-life of albumin.
- FcRn is a dual binding receptor that, in addition to albumin, binds IgG, and protects both proteins from intracellular degradation.
- the C-terminal domain of the albumin molecule has been shown to be crucial for binding to FcRn. Lack of domain IIIB or mutations of 464His, 510His, and 535His almost completely abolish FcRn binding.
- Albumin fusion proteins of the invention are monomeric. In some embodiments, this feature may be an advantage over the dimeric Fc fusion embodiments for the reasons described above with regard to monomeric Fc fusion embodiments.
- an albumin polypeptide suitable for the present invention includes an amino acid sequence at least 50% (e.g., at least 55%, 60%>, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the wild-type human serum albumin:
- an albumin polypeptide suitable for the present invention includes an amino acid sequence at least 50% (e.g., at least 55%, 60%>, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the D3 domain of wild-type human serum albumin:
- a Cl-INH domain may be directly or indirectly linked to an Fc domain or an albumin domain.
- a suitable recombinant Cl-INH fusion protein contains a linker or spacer that joins a Cl-INH polypeptide and an Fc domain.
- a suitable recombinant Cl-INH fusion protein contains a linker or spacer that joins a Cl-INH polypeptide and an albumin polypeptide.
- An amino acid linker or spacer is generally designed to be flexible or to interpose a structure, such as an alpha-helix, between the two protein moieties.
- a linker or spacer can be relatively short, or can be longer.
- a linker or spacer contains for example 3-100 (e.g., 5-100, 10-100, 20-100 30-100, 40-100, 50-100, 60-100, 70-100, 80-100, 90-100, 5-55, 10-50, 10-45, 10-40, 10-35, 10-30, 10-25, 10-20) amino acids in length.
- a linker or spacer is equal to or longer than 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, or 100 amino acids in length.
- a longer linker may decrease steric hindrance.
- a linker will comprise a mixture of glycine and serine residues.
- the linker may additionally comprise threonine, proline, and/or alanine residues.
- the linker comprises between 10-100, 10-90, 10-80, 10-70, 10-60, 10-50, 10-40, 10-30, 10-20, 10-15 amino acids.
- the linker comprises at least 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, or 95 amino acids.
- the linker is not a linker consisting of ALEVLFQGP.
- linkers or spacers suitable for the present invention include but are not limited to GGG linker and GGGGSGGGGS ((GGGGS)2 linker SEQ ID NO:27).
- the linker comprises the sequence GGG and/or the sequence of SEQ ID NO:27.
- GAPGGGGGAAAAAGGGGGGAPGGGGGAAAAAGGGGGGAPGGGGGAAAAAGGGGG GAP (GAG3 linker, SEQ ID NO:36).
- Suitable linkers or spacers also include those having an amino acid sequence at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%), 98%o, 99%) or more homologous or identical to the above exemplary linkers, e.g., GGG linker, GGGGSGGGGS ((GGGGS)2 linker SEQ ID NO:27), GAG linker (SEQ ID NO:34), GAG2 linker (SEQ ID NO:35), or GAG3 linker (SEQ ID NO:36). Additional linkers suitable for use with some embodiments may be found in US2012/0232021, filed on March 2, 2012, the disclosure of which is hereby incorporated by reference in its entirety.
- a linker is provided that associates the Cl-INH
- a linker is provided such that the binding of a Cl-INH peptide to one or more of its cognate ligands is not altered as compared to the Cl-INH polypeptide alone. In some embodiments, a linker is provided such that the binding of a Cl-INH peptide to one or more of its cognate ligands is not reduced or decreased as compared to the Cl-INH polypeptide alone.
- a recombinant Cl-INH fusion protein suitable for the present invention may be produced by any available means.
- a recombinant Cl-INH fusion protein may be recombinantly produced by utilizing a host cell system engineered to express a recombinant Cl- INH fusion protein-encoding nucleic acid.
- a recombinant Cl-INH fusion protein may be produced by activating endogenous genes.
- a recombinant Cl-INH fusion protein may be partially or fully prepared by chemical synthesis.
- known expression systems include, for example, E.coli, egg, baculovirus, plant, yeast, or mammalian cells.
- recombinant Cl-INH fusion proteins suitable for the present invention are produced in mammalian cells.
- mammalian cells that may be used in accordance with the present invention include BALB/c mouse myeloma line (NSO/1, ECACC No: 85110503); human retinoblasts (PER.C6, CruCell, Leiden, The
- human embryonic kidney line (HEK293 or 293 cells subcloned for growth in suspension culture, Graham et al, J. Gen Virol, 36:59,1977); human fibrosarcoma cell line (e.g., HT1080); baby hamster kidney cells (BHK21, ATCC CCL 10); Chinese hamster ovary cells +/-DHFR (CHO, Urlaub and Chasin, Proc. Natl. Acad. Sci. USA, 77:4216, 1980); mouse Sertoli cells (TM4, Mather, Biol.
- HEK293 or 293 cells subcloned for growth in suspension culture Graham et al, J. Gen Virol, 36:59,1977
- human fibrosarcoma cell line e.g., HT1080
- baby hamster kidney cells BHK21, ATCC CCL 10
- Chinese hamster ovary cells +/-DHFR (CHO, Urlaub and Chasin, Proc. Natl. Acad. Sci. USA,
- monkey kidney cells (CV1 ATCC CCL 70); African green monkey kidney cells (VERO-76, ATCC CRL-1 587); human cervical carcinoma cells (HeLa, ATCC CCL 2); canine kidney cells (MDCK, ATCC CCL 34); buffalo rat liver cells (BRL 3A, ATCC CRL 1442); human lung cells (W138, ATCC CCL 75); human liver cells (Hep G2, HB 8065); mouse mammary tumor (MMT 060562, ATCC CCL51); TRI cells (Mather et al, Annals N.Y. Acad. Sci., 383:44-68, 1982); MRC 5 cells; FS4 cells; and a human hepatoma line (Hep G2).
- the present invention provides recombinant Cl-FNH fusion proteins produced from human cells.
- the present invention provides recombinant Cl-INH fusion proteins produced from CHO cells or HT1080 cells.
- cells that are engineered to express a recombinant Cl-INH fusion protein may comprise a transgene that encodes a recombinant Cl-INH fusion protein described herein.
- the nucleic acids encoding recombinant Cl-INH fusion protein may contain regulatory sequences, gene control sequences, promoters, non-coding sequences and/or other appropriate sequences for expressing the recombinant Cl-INH fusion protein.
- the coding region is operably linked with one or more of these nucleic acid components.
- the coding region of a transgene may include one or more silent mutations to optimize codon usage for a particular cell type.
- the codons of a Cl-INH fusion transgene may be optimized for expression in a vertebrate cell.
- the codons of a Cl-INH fusion transgene may be optimized for expression in a mammalian cell.
- the codons of a Cl-INH fusion transgene may be optimized for expression in a human cell.
- the codons of a Cl-INH fusion transgene may be optimized for expression in a CHO cell.
- nucleic acid molecules comprising nucleic acid sequences encoding for a recombinant gene of interest (herein referred to as a transgene) such as a CI -inhibitor Fc fusion protein and/or CI -inhibitor albumin fusion protein described in various embodiments herein.
- a transgene such as a CI -inhibitor Fc fusion protein and/or CI -inhibitor albumin fusion protein described in various embodiments herein.
- the nucleic acid encoding a transgene may be modified to provide increased expression of the encoded CI -inhibitor Fc fusion protein and/or CI -inhibitor albumin fusion protein, which is also referred to as codon optimization.
- the nucleic acid encoding a transgene can be modified by altering the open reading frame for the coding sequence.
- the term "open reading frame” is synonymous with "ORF” and means any nucleotide sequence that is potentially able to encode a protein, or a portion of a protein.
- An open reading frame usually begins with a start codon (represented as, e.g. AUG for an RNA molecule and ATG in a DNA molecule in the standard code) and is read in codon-triplets until the frame ends with a STOP codon (represented as, e.g. UAA, UGA or UAG for an RNA molecule and TAA, TGA or TAG in a DNA molecule in the standard code).
- the term "codon” means a sequence of three nucleotides in a nucleic acid molecule that specifies a particular amino acid during protein synthesis; also called a triplet or codon-triplet.
- codons for example, of the 64 possible codons in the standard genetic code, two codons, GAA and GAG encode the amino acid Glutamine whereas the codons AAA and AAG specify the amino acid Lysine.
- three codons are stop codons, which do not specify an amino acid.
- the term “synonymous codon” means any and all of the codons that code for a single amino acid. Except for Methionine and Tryptophan, amino acids are coded by two to six synonymous codons.
- the four synonymous codons that code for the amino acid Alanine are GCA, GCC, GCG and GCU
- the two synonymous codons that specify Glutamine are GAA and GAG
- the two synonymous codons that encode Lysine are AAA and AAG.
- a nucleic acid encoding the open reading frame of a Cl- inhibitor Fc fusion protein and/or C I -inhibitor albumin fusion protein may be modified using standard codon optimization methods.
- codon optimization Various commercial algorithms for codon optimization are available and can be used to practice the present invention. Typically, codon optimization does not alter the encoded amino acid sequences. In some embodiments, codon optimization may lead to amino acids alteration such as substitution, deletion or insertion. Typically, such amino acid alteration does not substantially alter the protein activity.
- nucleic acid sequences encode for C I -inhibitor Fc fusion proteins and CI -inhibitor albumin fusion proteins having an amino acid sequence at least 50%, 55%, 60%, 65%, 70%>, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more identical or homologous to SEQ ID NO: l l , SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO:21 , SEQ ID NO:22, SEQ ID NO:23, SEQ ID NO:24, SEQ ID NO:25, SEQ ID NO:26, SEQ ID NO:28, SEQ ID NO:29, SEQ ID NO:30, SEQ ID NO:31 , SEQ ID NO:32, or SEQ ID NO:33.
- a nucleotide change may alter a synonymous codon within the open reading frame in order to agree with the endogenous codon usage found in a particular heterologous cell selected to express CI -inhibitor Fc fusion protein and/or CI -inhibitor albumin fusion protein.
- a nucleotide change may alter the G+C content within the open reading frame to better match the average G+C content of open reading frames found in endogenous nucleic acid sequence present in the heterologous host cell.
- a nucleotide change may also alter a polymononucleotide region or an internal regulatory or structural site found within a CI -inhibitor Fc fusion protein or CI -inhibitor albumin fusion sequence.
- modified or optimized nucleotide sequences are envisioned including, without limitation, nucleic acid sequences providing increased expression of CI -inhibitor Fc fusion proteins and/or CI -inhibitor albumin fusion proteins in a prokaryotic cell; yeast cell; insect cell; and in a mammalian cell.
- a modified nucleic acid encodes a CI -inhibitor Fc fusion protein and/or
- such alteration increases and/or enhances the CI -inhibitor Fc fusion protein or Cl- inhibitor albumin fusion protein activity.
- Activity may refer to the following non-limiting list of parameters: increased half-life, increased/elevated protein expression by host cells, increased stability of expressed protein, increased solubility of expressed protein, decreased aggregation of expressed protein, simpler formulation of expressed protein, simpler purification of expressed protein, increased tolerance of expressed protein to changes in pH, increased ability of protein to tolerate high and low pH conditions, expressed protein that is suitable for formulating at high concentrations.
- a nucleic acid sequence encoding a C 1 -inhibitor Fc fusion protein and/or C 1 - inhibitor albumin fusion protein as described in the present application can be molecularly cloned (inserted) into a suitable vector for propagation or expression in a host cell.
- a wide variety of expression vectors can be used to practice the present invention, including, without limitation, a prokaryotic expression vector; a yeast expression vector; an insect expression vector and a mammalian expression vector.
- Exemplary vectors suitable for the present invention include, but are not limited to, viral based vectors (e.g., AAV based vectors, retrovirus based vectors, plasmid based vectors).
- a nucleic acid sequence encoding a Cl- inhibitor Fc fusion protein can be inserted into a suitable vector.
- a nucleic acid sequence encoding a CI -inhibitor albumin fusion protein can be inserted into a suitable vector.
- a nucleic acid encoding a CI -inhibitor Fc fusion protein or Cl- inhibitor albumin fusion protein is operably linked to various regulatory sequences or elements.
- regulatory sequences or elements may be incorporated in an expression vector suitable for the present invention.
- exemplary regulatory sequences or elements include, but are not limited to, promoters, enhancers, repressors or suppressors, 5' untranslated (or non- coding) sequences, introns, 3' untranslated (or non-coding) sequences.
- a "Promoter” or “Promoter sequence” is a DNA regulatory region capable of binding an R A polymerase in a cell (e.g., directly or through other promoter bound proteins or substances) and initiating transcription of a coding sequence.
- a promoter sequence is, in general, bound at its 3 ' terminus by the transcription initiation site and extends upstream (5 ' direction) to include the minimum number of bases or elements necessary to initiate transcription at any level.
- the promoter may be operably associated with or operably linked to the expression control sequences, including enhancer and repressor sequences or with a nucleic acid to be expressed. In some embodiments, the promoter may be inducible.
- the inducible promoter may be unidirectional or bio-directional.
- the promoter may be a constitutive promoter.
- the promoter can be a hybrid promoter, in which the sequence containing the transcriptional regulatory region is obtained from one source and the sequence containing the transcription initiation region is obtained from a second source.
- Systems for linking control elements to coding sequence within a transgene are well known in the art (general molecular biological and recombinant DNA techniques are described in Sambrook, Fritsch, and Maniatis, Molecular Cloning: A Laboratory Manual, Second Edition, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY, 1989, which is incorporated herein by reference).
- Commercial vectors suitable for inserting a transgene for expression in various host cells under a variety of growth and induction conditions are also well known in the art.
- a specific promoter may be used to control expression of the transgene in a mammalian host cell such as, but are not limited to, SRa-promoter (Takebe et al, Molec. and Cell. Bio.
- human CMV immediate early promoter Boshart et al, Cell 41 :521-530 (1985); Foecking et al, Gene 45: 101-105 (1986)
- human CMV promoter the human CMV5 promoter
- murine CMV immediate early promoter the EFl-a- promoter
- a hybrid CMV promoter for liver specific expression e.g., made by conjugating CMV immediate early promoter with the transcriptional promoter elements of either human a-1- antitrypsin (HAT) or albumin (HAL) promoter
- promoters for hepatoma specific expression e.g., wherein the transcriptional promoter elements of either human albumin (HAL; about 1000 bp) or human a- 1 -antitrypsin (HAT, about 2000 bp) are combined with a 145 long enhancer element of human a- 1 -microglobulin and bikunin precursor gene (AMBP); HAL-AMBP and H
- the mammalian promoter is a is a constitutive promoter such as, but not limited to, the hypoxanthine phosphoribosyl transferase (HPTR) promoter, the adenosine deaminase promoter, the pyruvate kinase promoter, the beta-actin promoter as well as other constitutive promoters known to those of ordinary skill in the art.
- HPTR hypoxanthine phosphoribosyl transferase
- the adenosine deaminase promoter the pyruvate kinase promoter
- beta-actin promoter as well as other constitutive promoters known to those of ordinary skill in the art.
- a specific promoter may be used to control expression of a transgene in a prokaryotic host cell such as, but are not limited to, the ⁇ -lactamase promoter (Villa- Komaroff et al, Proc. Natl. Acad. Sci. USA 75:3727-3731 (1978)); the tac promoter (DeBoer et al, Proc. Natl. Acad. Sci.
- the T7 promoter, the T3 promoter, the Ml 3 promoter or the M16 promoter in a yeast host cell such as, but are not limited to, the GAL1, GAL4 or GAL 10 promoter, the ADH (alcohol dehydrogenase) promoter, PGK
- phosphoglycerol kinase promoter, alkaline phosphatase promoter, glyceraldehyde-3 -phosphate dehydrogenase III (TDH3) promoter, glyceraldehyde-3 -phosphate dehydrogenase II (TDH2) promoter, glyceraldehyde-3 -phosphate dehydrogenase I (TDH1) promoter, pyruvate kinase (PYK), enolase (ENO), or triose phosphate isomerase (TPI).
- the promoter may be a viral promoter, many of which are able to regulate expression of a transgene in several host cell types, including mammalian cells.
- Viral promoters that have been shown to drive constitutive expression of coding sequences in eukaryotic cells include, for example, simian virus promoters, herpes simplex virus promoters, papilloma virus promoters, adenovirus promoters, human immunodeficiency virus (HIV) promoters, Rous sarcoma virus promoters, cytomegalovirus (CMV) promoters, the long terminal repeats (LTRs) of Moloney murine leukemia virus and other retroviruses, the thymidine kinase promoter of herpes simplex virus as well as other viral promoters known to those of ordinary skill in the art.
- the gene control elements of an expression vector may also include 5' non-transcribing and 5' non-translating sequences involved with the initiation of transcription and translation, respectively, such as a TATA box, capping sequence, CAAT sequence, Kozak sequence and the like.
- Enhancer elements can optionally be used to increase expression levels of a polypeptide or protein to be expressed. Examples of enhancer elements that have been shown to function in mammalian cells include the SV40 early gene enhancer, as described in Dijkema et al., EMBO J.
- Genetic control elements of an expression vector will also include 3' non-transcribing and 3' non-translating sequences involved with the termination of transcription and translation. Respectively, such as a poly polyadenylation (poly A) signal for stabilization and processing of the 3 ' end of an mRNA transcribed from the promoter.
- Poly A signals included, for example, the rabbit beta globin polyA signal, bovine growth hormone polyA signal, chicken beta globin terminator/polyA signal, or SV40 late polyA region.
- Expression vectors will preferably but optionally include at least one selectable marker.
- the selectable maker is a nucleic acid sequence encoding a resistance gene operably linked to one or more genetic regulatory elements, to bestow upon the host cell the ability to maintain viability when grown in the presence of a cytotoxic chemical and/or drug.
- a selectable agent may be used to maintain retention of the expression vector within the host cell.
- the selectable agent is may be used to prevent modification (i.e. methylation) and/or silencing of the transgene sequence within the expression vector.
- a selectable agent is used to maintain episomal expression of the vector within the host cell.
- the selectable agent is used to promote stable integration of the transgene sequence into the host cell genome.
- an agent and/or resistance gene may include, but is not limited to, methotrexate (MTX), dihydrofolate reductase (DHFR, U.S. Pat. Nos. 4,399,216; 4,634,665; 4,656,134;
- Expression vectors may be transfected, transformed or transduced into a host cell.
- transfection As used herein, the terms “transfection,” “transformation” and “transduction” all refer to the introduction of an exogenous nucleic acid sequence into a host cell.
- expression vectors containing nucleic acid sequences encoding for a CI -inhibitor Fc fusion protein and/or a CI -inhibitor albumin fusion protein are transfected, transformed or transduced into a host cell at the same time.
- expression vectors containing nucleic acid sequences encoding for a CI -inhibitor Fc fusion protein and/or a CI -inhibitor albumin fusion protein are transfected, transformed or transduced into a host cell sequentially.
- a vector encoding an CI -inhibitor fusion protein may be transfected, transformed or transduced into a host cell first, followed by the transfection, transformation or transduction of a vector encoding one or more proteins which enhance glycosylation, preferably by increased sialylation, of the expressed CI -inhibitor fusion protein, and vice versa.
- Examples of transformation, transfection and transduction methods include liposome delivery, i.e., lipofectamineTM (Gibco BRL) Method of Hawley-Nelson, Focus 15:73 (1193), electroporation, CaP0 4 delivery method of Graham and van der Erb, Virology, 52:456-457 (1978), DEAE-Dextran medicated delivery, microinjection, biolistic particle delivery, polybrene mediated delivery, cationic mediated lipid delivery, transduction, and viral infection, such as, e.g., retrovirus, lentivirus, adenovirus adeno-associated virus and Baculovirus (Insect cells).
- liposome delivery i.e., lipofectamineTM (Gibco BRL) Method of Hawley-Nelson, Focus 15:73 (1193), electroporation, CaP0 4 delivery method of Graham and van der Erb, Virology, 52:456-457 (1978), DEAE-Dextran medicated delivery, microin
- cells of the invention may contain 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20 or more copies of nucleic acids encoding a Cl- inhibitor fusion protein. In some embodiments, cells of the invention may contain 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20 or more copies of nucleic acids encoding a Cl-inhibitor fusion protein. In some embodiments, cells of the invention may contain multiple copies (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20 or more) of nucleic acids encoding both Cl-inhibitor Fc fusion protein and one or more proteins which enhance glycosylation, preferably by increased sialylation, of the expressed Cl-inhibitor fusion protein.
- Sialylation can also be manipulated through the various methods described herein. Without wishing to be bound by any theory, decreased sialylation was found to be associated with increased heparin binding of the disclosed constructs, thereby preventing the Cl-INH binding site from binding to targets. Heparin binding also increases likelihood of internalization into the lysosome, thereby increasing the rate of clearance.
- host cells refers to cells that can be used to produce recombinant Cl-inhibitor fusion protein.
- host cells are suitable for producing recombinant Cl-inhibitor fusion protein at a large scale.
- Suitable host cells can be derived from a variety of organisms, including, but not limited to, mammals, plants, birds (e.g., avian systems), insects, yeast, and bacteria.
- host cells are mammalian cells.
- a suitable host cell is engineered to improve the glycosylation profile of the expressed recombinant Cl-inhibitor fusion protein.
- the Cl-INH polypeptide has a the same or similar glycosylation profile to the analogous portions of native plasma-derived Cl-INH. In some embodiments, the Cl-INH polypeptide has at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%o, 99%) glycans equivalent to native plasma-derived Cl-INH. In some embodiments, the glycosylation profile of the Cl-INH fusion protein has a humanized glycosylation profile. In some embodiments, the Cl-INH fusion protein has increased sialylation compared to native plasma-derived Cl-INH.
- Improvement of the glycosylation profile may refer to increasing sialylation and/or humanizing the glycosylation profile, e.g., expressing in an engineered cell a recombinant CI -inhibitor fusion protein comprising a Cl-INH polypeptide, thereby producing a glycosylation profile more similar to native human Cl-INH than a Cl-INH polypeptide expressed in a non- engineered cell. Improvement may also refer to increasing, enhancing, and/or optimizing the glycosylation profile of the Cl-INH fusion compared to Ruconest.
- glycosylation profile characterisitcs that may be optimized include the number of glycan residues, location of glycan residue attachment, manner of glycan attachment (e.g., type of bond), process of glycan attachment, and identity of glycan residues attached to the protein or polypeptide.
- the glycosylation profile of any portion of the fusion proteins of the invention are contemplated as suitable targets for glycosylation optimization.
- glycosylation profile of expressed proteins or polypeptides is altered through post-translational and/or chemical modification of the expressed protein or polypeptide.
- the Cl-INH fusion protein that has undergone post- translational and/or chemical modification has a glycosylation profile that is changed, improved, enhanced, humanized, and/or optimized compared to a Cl-INH fusion protein having the same sequence that has not undergone said post-translational and/or chemical modification.
- the Cl-INH fusion protein that has undergone post-translational and/or chemical modification has a sialylation profile that is changed, improved, enhanced, humanized, and/or optimized compared to a Cl-INH fusion protein having the same sequence that has not undergone said post-translational and/or chemical modification.
- the Cl-INH fusion protein is expressed from a cell line engineered to enhance glycosylation has a glycosylation profile that is changed, improved, enhanced, humanized, and/or optimized compared to a Cl-INH fusion protein having the same sequence that is expressed from the same cell line that has not been engineered to enhance glycosylation.
- the Cl-INH fusion protein is expressed from a cell line engineered to enhance sialylation has a sialylation profile that is changed, improved, enhanced, humanized, and/or optimized compared to a Cl-INH fusion protein having the same sequence that is expressed from the same cell line that has not been engineered to enhance sialylation.
- the Cl-INH fusion protein is expressed from a cell line a cell line cultured under conditions to enhance glycosylation has a glycosylation profile that is changed, improved, enhanced, humanized, and/or optimized compared to a Cl-INH fusion protein having the same sequence that is expressed from a cell line cultured under conditions to enhance glycosylation.
- the Cl-INH fusion protein is expressed from a cell line a cell line cultured under conditions to enhance sialylation has a sialylation profile that is changed, improved, enhanced, humanized, and/or optimized compared to a Cl-INH fusion protein having the same sequence that is expressed from a cell line cultured under conditions to enhance sialylation.
- the Cl-INH fusion protein has a glycosylation profile that is changed, improved, enhanced, humanized, and/or optimized compared to Ruconest. In some embodiments the Cl-INH fusion protein has a glycosylation profile that is changed, improved, enhanced, humanized, and/or optimized compared to human plasma-derived Cl-INH.
- the cell culture conditions are manipulated to achieve expression of proteins having a desired glycosylation profile.
- These cell culture conditions include control of the production and culture process including length of culture, additives to culture medium, co-expression of genes to enhance glycosylation via increased glycosylation, and/or engineering of cells to knock out, prevent expression of, inactivate, or disrupt enzymes associated with glycan degradation (e.g., sialyladase).
- Suitable methods for manipulation of glycosylation include, but are not limited to, those described in, e.g., U.S. Patent Nos. 5,047,335; 5,096,816; 5,705,364; 7,645,609; 8,273,723 ; 8,524,477; 8,617,878; 8,871,723; PCT Publication
- Selection of host cells and specific clones of transfected host cells may also be used to enhance glycosylation.
- Other methods of enhancing glycosylation include development of purification processes to enrich for proteins or polypeptides having the desired glycosylation profile.
- Methods of manipulating the sialylation profile of Cl-INH proteins and polypeptides of the invention include in vitro, in situ, and in vivo methods.
- the sialylation profile of expressed proteins or polypeptides is altered through post-expression chemical modification of the expressed protein or polypeptide.
- the cell culture conditions are manipulated to achieve expression of proteins having a desired sialylation profile. These cell culture conditions include control of the production and culture process including length of culture, additives to culture medium, and/or co-expression of genes to enhance sialylation. Selection of host cells and specific clones of transfected host cells may also be used to enhance sialylation. Other methods of enhancing sialylation include development of purification processes to enrich for proteins or polypeptides having the desired sialylation profile.
- Sialylation can also be manipulated through the various methods described herein.
- decreased sialylation was found to be associated with increased heparin binding of the disclosed constructs, thereby preventing the Cl-INH binding site from binding to targets. Heparin binding also increases likelihood of internalization into the lysosome, thereby increasing the rate of clearance.
- Any mammalian cell or cell type susceptible to cell culture, and to expression of polypeptides, may be utilized in accordance with the present invention as a host cell.
- mammalian cells that may be used in accordance with the present invention include human embryonic kidney 293 cells (HEK293), HeLa cells; BALB/c mouse myeloma line (NSO/1, ECACC No: 85110503); human retinoblasts (PER.C6 (CruCell, Leiden, The Netherlands)); monkey kidney CVl line transformed by SV40 (COS-7, ATCC CRL 1651); human embryonic kidney line (293 or 293 cells subcloned for growth in suspension culture, Graham et al, J.
- HEK293 human embryonic kidney 293 cells
- HeLa cells HeLa cells
- BALB/c mouse myeloma line NSO/1, ECACC No: 85110503
- human retinoblasts PER.C6 (CruCell, Leiden
- monkey kidney cells (CVl ATCC CCL 70); African green monkey kidney cells (VERO-76, ATCC CRL- 1 587); human cervical carcinoma cells (HeLa, ATCC CCL 2); canine kidney cells (MDCK, ATCC CCL 34); buffalo rat liver cells (BRL 3A, ATCC CRL 1442); human lung cells (W138, ATCC CCL 75); human liver cells (Hep G2, HB 8065); mouse mammary tumor (MMT 060562, ATCC CCL51); TRI cells (Mather et al, Annals N.Y. Acad.
- a suitable mammalian cell is not an endosomal acidification-deficient cell.
- hybridoma cell lines that express polypeptides or proteins may be utilized in accordance with the present invention.
- hybridoma cell lines might have different nutrition requirements and/or might require different culture conditions for optimal growth and polypeptide or protein expression, and will be able to modify conditions as needed.
- Any non-mammalian derived cell or cell type susceptible to cell culture, and to expression of polypeptides, may be utilized in accordance with the present invention as a host cell.
- Non-limiting examples of non-mammalian host cells and cell lines that may be used in accordance with the present invention include cells and cell lines derived from Pichia pastoris, Pichia methanolica, Pichia angusta, Schizosacccharomyces pombe, Saccharomyces cerevisiae, and Yarrowia lipolytica for yeast; Sodoptera frugiperda, Trichoplusis ni, Drosophila
- a host cell is selected for generating a cell line based on certain preferable attributes or growth under particular conditions chosen for culturing cells. It will be appreciated by one skilled in the art, such attributes may be ascertained based on known characteristic and/or traits of an established line (i.e. a characterized commercially available cell line) or though empirical evaluation.
- a cell line may be selected for its ability to grow on a feeder layer of cells.
- a cell line may be selected for its ability to grow in suspension.
- a cell line may be selected for its ability to grow as an adherent monolayer of cells.
- such cells can be used with any tissue culture vessel or any vessel treated with a suitable adhesion substrate.
- a suitable adhesion substrate is selected from the group consisting of collagen (e.g. collagen I, II, II, or IV), gelatin, fibronectin, laminin, vitronectin, fibrinogen, BD Matrigel TM , basement membrane matrix, dermatan sulfate proteoglycan, Poly-D-Lysine and/or combinations thereof.
- an adherent host cell may be selected and modified under specific growth conditions to grow in suspension. Such methods of modifying an adherent cell to grown in suspension are known in the art. For example, a cell may be conditioned to grow in suspension culture, by gradually removing animal serum from the growth media over time.
- INH fusion protein is selected for its ability to produce the recombinant Cl-INH fusion protein at commercially viable scale.
- engineered cells according to the present invention are able to produce recombinant Cl-INH fusion protein at a high level and/or with high enzymatic activity.
- desirable cells once cultivated under a cell culture condition (e.g., a standard large scale suspension or adherent culture condition), can produce Cl-INH fusion protein in an amount of or greater than about 5 picogram/cell/day (e.g., greater than about 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, or 100 picogram/cell/day).
- desired cells once cultivated under a cell culture condition (e.g., a standard large scale suspension or adherent culture condition), are able to produce Cl-INH fusion protein in an amount ranging from about 5-100 picogram/cell/day (e.g., about 5-90 picogram/cell/day, about 5-80 picogram/cell/day, about 5-70 picogram/cell/day, about 5-60 picogram cell/day, about 5-50 picogram/cell/day, about 5-40 picogram/cell/day, about 5-30 picogram cell/day, about 10-90 picogram/cell/day, about 10-80 picogram/cell/day, about 10-70 picogram/cell/day, about 10-60 picogram/cell/day, about 10-50 picogram cell/day, about 10-40 picogram/cell/day, about 10-30 picogram cell/day, about 20-90 picogram cell/day, about 20-80 picogram cell/day, about 20-70 picogram cell/day, about 20-60 picogram cell/day, about 20-50 picogram cell/day, about 20-40 picogram/cell
- the half-life of Cl-INH may be affected by the glycosylation profile.
- cells of the invention may be engineered to improve the glycosylation profile of the expressed Cl-INH fusion protein.
- Ruconest ® (Pharming N.V.)
- a recombinant Cl-INH polypeptide that is less sialylated and/or has a different sialylation distribution from plasma-derived human Cl-INH has been shown to have a shorter half-life than plasma-derived human Cl-INH.
- a recombinant Cl-INH fusion protein using engineered cells according to the present invention.
- a recombinant Cl-INH fusion protein may be produced in serum-containing or serum- free medium.
- a recombinant Cl-INH fusion protein is produced in serum- free medium.
- a recombinant Cl-INH fusion protein is produced in an animal free medium, i.e., a medium that lacks animal-derived components.
- a recombinant Cl-INH fusion protein is produced in a chemically defined medium.
- the term "chemically-defined nutrient medium" refers to a medium of which substantially all of the chemical components are known.
- a chemically defined nutrient medium is free of animal-derived components such as serum, serum derived proteins (e.g., albumin or fetuin), and other components.
- a chemically- defined medium comprises one or more proteins ⁇ e.g., protein growth factors or cytokines.
- a chemically-defined nutrient medium comprises one or more protein hydrolysates.
- a chemically-defined nutrient medium is a protein-free media, i.e., a serum-free media that contains no proteins, hydrolysates or components of unknown composition.
- a chemically defined medium may be supplemented by one or more animal derived components.
- animal derived components include, but are not limited to, fetal calf serum, horse serum, goat serum, donkey serum, human serum, and serum derived proteins such as albumins (e.g., bovine serum albumin or human serum albumin).
- recombinant Cl-INH fusion proteins may be produced at large scale including, but not limited to, roller bottle cultures, bioreactor batch cultures, perfusion cultures, and bioreactor fed-batch cultures.
- recombinant Cl-INH fusion protein is produced by cells cultured in suspension.
- recombinant Cl-INH fusion protein is produced by adherent cells.
- perfusion culture is used to control glycosylation of expressed protein. Exemplary methods of perfusion culture include, but are not limited to, those described in, e.g., U.S. Patent Nos. 6,528,286 and PCT Publication No. WO1996/039488A1, the disclosures of which are incorporated herein by reference.
- Various methods may be used to purify or isolate C 1 -INH fusion protein produced according to various methods described herein.
- the expressed Cl-INH fusion protein is secreted into the medium and thus cells and other solids may be removed, as by centrifugation or filtering for example, as a first step in the purification process.
- the expressed Cl-INH fusion protein is bound to the surface of the host cell.
- the host cells expressing the polypeptide or protein are lysed for purification. Lysis of mammalian host cells can be achieved by any number of means well known to those of ordinary skill in the art, including physical disruption by glass beads and exposure to high pH conditions.
- the C 1 -INH fusion protein may be isolated and purified by standard methods including, but not limited to, chromatography (e.g., ion exchange, affinity, size exclusion, and hydroxyapatite chromatography), gel filtration, centrifugation, or differential solubility, ethanol precipitation or by any other available technique for the purification of proteins (See, e.g., Scopes, Protein Purification Principles and Practice 2nd Edition, Springer- Verlag, New York, 1987; Higgins, S. J. and Hames, B. D. (eds.), Protein Expression: A Practical Approach, Oxford Univ Press, 1999; and Deutscher, M. P., Simon, M. I., Abelson, J. N.
- the protein may be isolated by binding it to an affinity column comprising antibodies that were raised against that protein and were affixed to a stationary support.
- affinity tags such as an influenza coat sequence, poly-histidine, or glutathione-S-transferase can be attached to the protein by standard recombinant techniques to allow for easy purification by passage over the appropriate affinity column.
- Protease inhibitors such as phenyl methyl sulfonyl fluoride (PMSF), leupeptin, pepstatin, or aprotinin may be added at any or all stages in order to reduce or eliminate degradation of the polypeptide or protein during the purification process. Protease inhibitors are particularly desired when cells must be lysed in order to isolate and purify the expressed polypeptide or protein.
- FIG. 3 Protein A capture of fusion proteins was successful on small scale, but aggregation was observed when scaled up. Without wishing to be bound by any theory, the low pH necessary for elution appeared to cause the aggregation and inactivate Cl-INH. In some embodiments purification does not involve a low pH step. In some embodiments, the fusion proteins are mutated in order to stabilize the protein at low pH. In other embodiments, additives are used to protect the Cl-INH fusion proteins from aggregation during the low pH elution step. In still other embodiments, non-protein A resins are used to purify proteins,
- Suitable resins for purification include, but are not limited to, anion exchange resin, albumin affinity resin, CI inhibitor affinity resin, and protein A resin.
- a purification method that does not require a drop in pH is preferred.
- a purification method that does not require an acidic pH for elution is preferred.
- a stabilizer that prevents aggregation is utilized.
- the stabilizer that prevents aggregation is used in a method requiring a drop in pH.
- suitable stabilizers include EDTA.
- Suitable methods for purification of the Cl-INH fusion proteins of the invention include, but are not limited to, those described in, e.g., U.S. Patent Nos. 5,276,141; US7384754; 8,802,816; PCT Publication Nos. WO2012107572; and WO2013009526, the disclosures of which are incorporated herein by reference.
- the present invention further provides a pharmaceutical composition containing a recombinant Cl-INH fusion protein described herein and a physiologically acceptable carrier or excipient.
- the carrier and recombinant Cl-INH fusion protein can be sterile.
- formulation should suit the mode of administration.
- Suitable pharmaceutically acceptable carriers include but are not limited to water, salt solutions (e.g., NaCl), saline, buffered saline, alcohols, glycerol, ethanol, gum arabic, vegetable oils, benzyl alcohols, polyethylene glycols, gelatin, carbohydrates such as lactose, amylose or starch, sugars such as mannitol, sucrose, or others, dextrose, magnesium stearate, talc, silicic acid, viscous paraffin, perfume oil, fatty acid esters, hydroxymethylcellulose, polyvinyl pyrrolidone, etc., as well as combinations thereof.
- salt solutions e.g., NaCl
- saline e.g., buffered saline
- alcohols e.glycerol
- ethanol e.glycerol
- gum arabic e.glycerol
- vegetable oils e.glycerol
- benzyl alcohols polyethylene glycol
- the pharmaceutical preparations can, if desired, be mixed with auxiliary agents ⁇ e.g., lubricants, preservatives, stabilizers, wetting agents, emulsifiers, salts for influencing osmotic pressure, buffers, coloring, flavoring and/or aromatic substances and the like) which do not deleteriously react with the active compounds or interference with their activity.
- auxiliary agents e.g., lubricants, preservatives, stabilizers, wetting agents, emulsifiers, salts for influencing osmotic pressure, buffers, coloring, flavoring and/or aromatic substances and the like
- a water-soluble carrier suitable for intravenous administration is used.
- a suitable pharmaceutical composition or medicament can also contain minor amounts of wetting or emulsifying agents, or pH buffering agents.
- a composition can be a liquid solution, suspension, emulsion, tablet, pill, capsule, sustained release formulation, or powder.
- a composition can also be formulated as a suppository, with traditional binders and carriers such as triglycerides.
- Oral formulations can include standard carriers such as pharmaceutical grades of mannitol, lactose, starch, magnesium stearate, polyvinyl pyrrolidone, sodium saccharine, cellulose, magnesium carbonate, etc.
- a pharmaceutical composition or medicament can be formulated in accordance with the routine procedures as a pharmaceutical composition adapted for administration to human beings.
- compositions typically are a solution in sterile isotonic aqueous buffer.
- the composition may also include a solubilizing agent and a local anesthetic to ease pain at the site of the injection.
- the ingredients are supplied either separately or mixed together in unit dosage form, for example, as a dry lyophilized powder or water free concentrate in a hermetically sealed container such as an ampule or sachette indicating the quantity of active agent.
- the composition is to be administered by infusion, it can be dispensed with an infusion bottle containing sterile pharmaceutical grade water, saline or dextrose/water.
- an ampule of sterile water for injection or saline can be provided so that the ingredients may be mixed prior to administration.
- a recombinant Cl-INH fusion protein described herein can be formulated as neutral or salt forms.
- Pharmaceutically acceptable salts include those formed with free amino groups such as those derived from hydrochloric, phosphoric, acetic, oxalic, tartaric acids, etc., and those formed with free carboxyl groups such as those derived from sodium, potassium, ammonium, calcium, ferric hydroxides, isopropylamine, triethylamine, 2-ethylamino ethanol, histidine, procaine, etc.
- a preferred formulation comprises 50 mM NaP04 (pH 7.2), 50 mM Sorbitol, and
- the formulation may be liquid, or may be lyophilized and reconstituted prior to administration.
- a recombinant Cl-INH fusion protein described herein (or a composition or medicament containing a recombinant Cl-INH fusion protein described herein) is administered by any appropriate route.
- a recombinant Cl-INH fusion protein or a pharmaceutical composition containing the same is administered systemically.
- Systemic administration may be intravenous, intradermal, intracranial, intrathecal, inhalation, transdermal (topical), intraocular, intramuscular, subcutaneous, intramuscular, oral, and/or transmucosal administration.
- the term "subcutaneous tissue" is defined as a layer of loose, irregular connective tissue immediately beneath the skin.
- the subcutaneous administration may be performed by injecting a composition into areas including, but not limited to, the thigh region, abdominal region, gluteal region, or scapular region.
- a recombinant Cl-INH fusion protein or a pharmaceutical composition containing the same is administered intravenously.
- a recombinant Cl-INH fusion protein or a pharmaceutical composition containing the same is administered orally.
- a recombinant Cl-INH fusion protein or a pharmaceutical composition containing the same is administered intracranially.
- a recombinant Cl-INH fusion protein or a pharmaceutical composition containing the same is administered intrathecally. More than one route can be used concurrently, if desired.
- a recombinant Cl-INH fusion protein or a pharmaceutical composition containing the same is administered to a subject by intrathecal administration.
- the term "intrathecal administration” or “intrathecal injection” refers to an injection into the spinal canal (intrathecal space surrounding the spinal cord). Various techniques may be used including, without limitation, lateral cerebro ventricular injection through a burrhole or cisternal or lumbar puncture or the like.
- "intrathecal administration” or “intrathecal delivery” according to the present invention refers to IT administration or delivery via the lumbar area or region, i.e., lumbar IT administration or delivery.
- the term “lumbar region” or “lumbar area” refers to the area between the third and fourth lumbar (lower back) vertebrae and, more inclusively, the L2-S1 region of the spine.
- a recombinant Cl-INH fusion protein or a pharmaceutical composition containing the same is administered to the subject by subcutaneous (i.e., beneath the skin) administration.
- the formulation may be injected using a syringe.
- injection devices e.g., the Inject-ease TM and Genject TM devices
- injector pens such as the GenPen TM
- needleless devices e.g., MediJector and BioJector
- subcutaneous patch delivery systems e.g., the injection devices, the Inject-ease TM and Genject TM devices
- injector pens such as the GenPen TM
- needleless devices e.g., MediJector and BioJector
- intrathecal administration may be used in conjunction with other routes of administration (e.g., intravenous, subcutaneously, intramuscularly, parenterally, transdermally, or transmucosally (e.g., orally or nasally)).
- routes of administration e.g., intravenous, subcutaneously, intramuscularly, parenterally, transdermally, or transmucosally (e.g., orally or nasally)).
- the present invention contemplates single as well as multiple administrations of a therapeutically effective amount of a recombinant Cl-INH fusion protein or a pharmaceutical composition containing the same described herein.
- a recombinant Cl-INH fusion protein or a pharmaceutical composition containing the same can be administered at regular intervals, depending on the nature, severity and extent of the subject's condition (e.g., a lysosomal storage disease).
- a therapeutically effective amount of a recombinant Cl-INH fusion protein or a pharmaceutical composition containing the same may be administered periodically at regular intervals (e.g., once every year, once every six months, once every five months, once every three months, bimonthly (once every two months), monthly (once every month), biweekly (once every two weeks), weekly, daily or continuously).
- administration results only in a localized effect in an individual, while in other embodiments, administration results in effects throughout multiple portions of an individual, for example, systemic effects.
- administration results in delivery of a recombinant Cl-INH fusion protein to one or more target tissues.
- the recombinant Cl-INH fusion protein is delivered to one or more target tissues including, but not limited to, heart, brain, skin, blood, spinal cord, striated muscle (e.g., skeletal muscle), smooth muscle, kidney, liver, lung, and/or spleen.
- the recombinant Cl-INH fusion protein is delivered to the heart.
- the recombinant Cl-INH fusion protein is delivered to the central nervous system, particularly the brain and/or spinal cord. In some embodiments, the recombinant Cl-INH fusion protein is delivered to triceps, tibialis anterior, soleus, gastrocnemius, biceps, trapezius, deltoids, quadriceps, and/or diaphragm.
- a composition is administered in a therapeutically effective amount and/or according to a dosing regimen that is correlated with a particular desired outcome (e.g., with prophylaxis of a complement-mediated chronic disease, such as HAE).
- a particular desired outcome e.g., with prophylaxis of a complement-mediated chronic disease, such as HAE.
- Particular doses or amounts to be administered in accordance with the present invention may vary, for example, depending on the nature and/or extent of the desired outcome, on particulars of route and/or timing of administration, and/or on one or more characteristics (e.g., weight, age, personal history, genetic characteristic, lifestyle parameter, severity of cardiac defect and/or level of risk of cardiac defect, etc., or combinations thereof). Such doses or amounts can be determined by those of ordinary skill. In some embodiments, an appropriate dose or amount is determined in accordance with standard clinical techniques. Alternatively or additionally, in some embodiments, an appropriate dose or amount is determined through use of one or more in vitro or in vivo assays to help identify desirable or optimal dosage ranges or amounts to be administered.
- a recombinant Cl-INH fusion protein is administered at a therapeutically effective amount.
- a therapeutically effective amount is sufficient to achieve a meaningful benefit to the subject (e.g., prophylaxis, treating, modulating, curing, preventing and/or ameliorating the underlying disease or condition).
- the amount of a therapeutic agent (e.g., a recombinant Cl-INH fusion protein) administered to a subject in need thereof will depend upon the characteristics of the subject. Such characteristics include the condition, disease severity, general health, age, sex and body weight of the subject.
- objective and subjective assays may optionally be employed to identify optimal dosage ranges.
- appropriate doses or amounts to be administered may be extrapolated from dose-response curves derived from in vitro or animal model test systems.
- composition is provided as a pharmaceutical
- a pharmaceutical formulation is or comprises a unit dose amount for administration in accordance with a dosing regimen correlated with achievement of the reduced incidence or risk of an HAE attack.
- a formulation comprising a recombinant Cl-INH fusion protein described herein administered as a single dose.
- a formulation comprising a recombinant Cl-INH fusion protein described herein is administered at regular intervals. Administration at an "interval,” as used herein, indicates that the therapeutically effective amount is administered periodically (as distinguished from a one-time dose). The interval can be determined by standard clinical techniques.
- a formulation comprising a recombinant Cl-INH fusion protein described herein is administered bimonthly, monthly, twice monthly, triweekly, biweekly, weekly, twice weekly, thrice weekly, daily, twice daily, or every six hours.
- the administration interval for a single individual need not be a fixed interval, but can be varied over time, depending on the needs of the individual.
- a therapeutically effective amount is commonly administered in a dosing regimen that may comprise multiple unit doses.
- a therapeutically effective amount (and/or an appropriate unit dose within an effective dosing regimen) may vary, for example, depending on route of administration, on combination with other pharmaceutical agents.
- the specific therapeutically effective amount (and/or unit dose) for any particular patient may depend upon a variety of factors including the disorder being treated and the severity of the disorder; the activity of the specific pharmaceutical agent employed; the specific composition employed; the age, body weight, general health, sex and diet of the patient; the time of administration, route of administration, and/or rate of excretion or metabolism of the specific fusion protein employed; the duration of the treatment; and like factors as is well known in the medical arts.
- the term “monthly” means administration once per month;
- the term “triweekly” means administration once per three weeks (i.e., once every three weeks);
- the term “biweekly” means administration once per two weeks (i.e., once every two weeks);
- the term “weekly” means administration once per week; and the term “daily” means administration once per day.
- a formulation comprising a recombinant Cl-INH fusion protein described herein is administered at regular intervals indefinitely. In some embodiments, a formulation comprising a recombinant Cl-INH fusion protein described herein is administered at regular intervals for a defined period.
- a recombinant Cl-INH fusion protein is administered in combination with one or more known therapeutic agents (e.g., corticosteroids) currently used for treatment of a complement-mediated disease.
- the known therapeutic agent(s) is/are administered according to its standard or approved dosing regimen and/or schedule.
- the known therapeutic agent(s) is/are administered according to a regimen that is altered as compared with its standard or approved dosing regimen and/or schedule.
- such an altered regimen differs from the standard or approved dosing regimen in that one or more unit doses is altered (e.g., reduced or increased) in amount, and/or in that dosing is altered in frequency (e.g., in that one or more intervals between unit doses is expanded, resulting in lower frequency, or is reduced, resulting in higher frequency).
- Preferred embodiment is treatment of chronic disorders
- the fusion proteins provided by the invention are suitable for acute attacks associated with complement-mediated disorders, e.g., NMOSD AMR, and HAE events. These attacks may be long or short.
- the disease or disorder is chronic.
- the compositions and methods of the invention are used prophylactically.
- Exemplary complement-mediated disease that may be treated using the compositions and methods disclosed herein include, but are not limited to, hereditary
- angioedema angioedema, antibody mediated rejection, neuromyelitis optica spectrum disorders, traumatic brain injury, spinal cord injury, ischemic brain injury, burn injury, toxic epidermal necrolysis, multiple sclerosis, amyotrophic lateral sclerosis (ALS), Parkinson's disease, stroke, chronic inflammatory demyelinating polyneuropathy (CIDP), myasthenia gravis, multifocal motor neuropathy.
- ALS amyotrophic lateral sclerosis
- Parkinson's disease stroke
- chronic inflammatory demyelinating polyneuropathy CIDP
- myasthenia gravis multifocal motor neuropathy.
- This example illustrates various exemplary fusion protein constructs and transient or scale-up expression of such fusion protein constructs in mammalian cells.
- wild-type or mutant Fc moieties are fused to full length (1-478 aa) or truncated (98-478 aa) human CI -inhibitor.
- a fusion protein of full Length CI -inhibitor with an N-terminal IgGl Fc was made according to the methods described above, having the amino acid sequence (the Fc moiety is underlined):
- a fusion protein of truncated CI -inhibitor with an N-terminal IgGl Fc was made according to the methods described above, having the amino acid sequence (the Fc moiety is underlined):
- Truncated CI -inhibitor with an N-terminal IgGl Fc eliminates a large amount of the carbohydrate sites due to the removal of the serine and threonine residues on the truncated portion of the Cl-INH polypeptide. These amino acids have OH moieties that become glycosylated in post-translational processing. Without wishing to be bound by any theory, the elimination of this carbohydrate reduces potential clearance of the molecule via the
- asialoglycoprotein receptor which may extend half-life of the Fc-Cl -inhibitor fusion protein.
- asialoglycoprotein is not the only clearance mechanism. There are also active clearance pathways based on presence of other glycans. The Fc domain does not bind the FcRN receptor until the complex has been internalized in an endosome. The drop in pH within the endosome allows for the binding to occur. In some embodiments, the active clearance processes are reduced, slowed, and/or eliminated by manipulation of the glycosylation profile of the Cl-INH fusion construct. This allows for the passive Fc recycling process to be effective in increasing half- life. In some embodiments, a truncated Cl-INH polypeptide is preferred. The truncation may remove glycosylation moieties associated with active clearance. Further, the truncated form is smaller in size which may increase absorption, particularly when administered subcutaneously.
- IgGl LALA mutation eliminates the complement activation and ADCC that can happen from wild type IgGl Fc sequence. Both full length and truncated Cl-INH IgGl Fc effector dead constructs were made. [0240] Full-length CI -inhibitor with an N-terminal IgGl LALA Fc was made according to the methods described above having the amino acid sequence (the Fc moiety is underlined, LALA mutation bolded):
- Truncated CI -inhibitor with an N-terminal IgGl LALA Fc was made according to the methods described above having the amino acid sequence (the Fc moiety is underlined, LALA mutation bolded):
- a fusion protein of truncated CI -inhibitor with an N-terminal IgG4 Fc is made according to the methods described above, having the amino acid sequence (the Fc moiety is underlined):
- a fusion protein of truncated CI -inhibitor with an N-terminal IgG4 Fc is made according to the methods described above, having the amino acid sequence (the Fc moiety is underlined):
- Truncated CI -inhibitor with an N-terminal IgG4 S241P Fc was made according to the methods described above having the amino acid sequence (the Fc moiety is underlined, S241P mutation bolded): ES YGPPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWY
- FreeStyleTM 293-F Cells (suspension human embryonal kidney cells, Invitrogen,
- FreeStyleTM CHO-S Cells (suspension Chinese Hamster Ovary cells, Invitrogen, Cat. No. R800-07), and HT1080 cells were transfected with various Cl-inhibitor fusion plasmids (N-hFc, N-hFcLALA and N-hFcIgG4m), and with no DNA as a control.
- HT1080 cells were transfected using a standard transfection protocol
- CM Conditioned Medium
- the HT1080 transiently transfected cells were seeded at lxlO 6 cells/mL at 37°C. After two days of recovery, cells wereselected for 2 weeks in a suitable chemically defined (CD) medium _with 250 ⁇ g/mL zeocin until cells exhibited 95% viability. Fusion protein expression was evaluated by SDS- PAGE and visualized with Coomassie blue. Expression of the Cl-INH Fc fusion constructs was found to be greater than that of the Cl-INH albumin constructs.
- CD chemically defined
- FreeStyleTM 293-F Cells were transfected with LALA-C 1 -inhibitor fusion plasmids (both full-length and truncated CI) as well as IgG4m-Cl -inhibitor fusion plasmids (full-length and truncated CI). Transfections were carried out using 293 -FreeStyleTM MAX Reagent as described above.
- Cells were transfected in 1 L shake flasks with 320 mL working volume. DNA and FreeStyleTM MAX Reagent quantities were scaled-up proportionally from the 30 mL transfection volume of the transfections described above. CM from transfected cells was harvested 4 days post transfection and expression was evaluated with SDS-PAGE, as described above. Cells were re-fed for a second harvest (7 days post transfection, 3 day batch collection).
- Fc fusions with full length CI -inhibitor consistently express at higher levels than native recombinant CI .
- Fc fusions with truncated CI -inhibitor express similarly to native recombinant CI -inhibitor. No severe clipping of the proteins was observed in any of the host cell culture samples for any of the tested constructs.
- HEK293 transient cell expression was particularly increased compared to the other tested cell types. Placement of the Fc sequence at the N-terminus resulted in particularly increased expression than if on the C-terminus
- Samples were injected at volume of 40 ⁇ .
- the samples run were LALA Cl- inhibitor full length(FL) Rl; LALA CI -inhibitor truncated (TR) Rl; IgG4 CI -inhibitor full length (FL) Rl; IgG4 CI -inhibitor truncated (TR) Rl ; and a 20 BSA control injection, results
- Binding to the Fc neonatal receptor allows for recycling of the molecules and leads to an extended in vivo serum half-life of the Fc fusion proteins. Recycling occurs as the molecules are passively taken into the cells and the pH of the endosomes is lower. That leads to binding of the Fc portion of the molecule to the FcRN. When the FcRN recycles back to the surface of the cell, the pH is then neutral and the protein is released back into the serum.
- Binding to the extracellular domain of the FcRN was measured by surface plasmon resonance (SPR) using a Biacore system.
- FcRn (Sino Biological Inc or in-house BD1) is diluted in Acetate buffer pH 5.0 (Cat#BR- 1003-51) to 10 ⁇ g/mL.
- Running buffer PBS-P+, pHed to 6.0
- Wild Type Fc molecules have varying amounts of effector function, e.g., the ability to activate the complement cascade, ADCC activity, and/or to bind to specific Fc receptors that are not desired for the purposes of the present invention.
- Patients in need of the Cl-INH fusion proteins of the invention suffer from complement-mediated disease, thus it is an object of the invention to reduce or eliminate effector functions associated with Fc domains.
- the Cl-INH Fc fusion constructs disclosed herein preferably reduce or eliminate effector functions.
- the Cl-INH Fc fusion constructs preferably reduce or eliminate complement activation, ADCC, and/or Fey Receptors. Effector function can be measured by binding to Clq, also by binding to Fey Receptors.
- FIG. 6 Exemplary C 1 q binding ELISA results for the hFc, hFcLALA and IgG4m fusions with Cl-INH and rhCl (plasma-derived commercial product) Inhibitor are depicted in FIG. 6 which plots the OD450 against the concentration of protein in each sample.
- the samples were hFc IgGl -Cl-INH, hFc LALA IgGl -Cl-INH, and hFc IgG4m-Cl-INH fusions, recombinant human Cl-INH (rhCl-INH) (expressed in 1080 cells), and IgGl Fc-human follistatin(hFc IgGl-hFst-XTEN) fusion as a positive control and human follistatin-Xten (hFst- XTEN) fusion as a negative control.
- Binding to the extracellular domain of the FcyRI was measured by surface plasmon resonance (SPR) using a Biacore system.
- SPR surface plasmon resonance
- FIG. 7 The assay setup was as follows:
- N-hFc-Cl-INH is diluted in HBS-P+ buffer to 12.5, 6.25, 3.175, 1.59 and 0.79 nM
- CI -inhibitor is capable of inhibiting many enzymes from the coagulation, contact and complement pathways, and thus useful in the treatment of diseases such as HAE, AMR, NMOSD, and PNH.
- Cl-INH is a suicide inhibitor, meaning it is inactivated during the process of inhibition. It forms a 1 : 1 stoichiometric complex with the target protease, followed by clearance of the entire complex. The Cl-INH is then no longer available to inhibit other enzymes.
- the following experiments examined the ability of the Fc-Cl -inhibitor fusion proteins to inhibit Cls by two exemplary methods.
- FIG. 8. The ELISA protocol was as follows:
- Plasma-derived C 1 -INH molecular weight (MW) was estimated by gel to be about 93,000 Da. This value was used to calculate the concentration of protein used in the SPR analysis. The concentration of the constructs was calculated by the weight of each construct as determined using mass spectrometry.
- FL Cl-INH hFc IgGl LALA and FL Cl-INH hFc IgG4m have MW of approximately 200,000 Da.
- the Tr C l-INH hFc IgGl LALA and Tr C l-INH hFc IgG4m have MW of approximately 160,000 Da.
- the fusion proteins demonstrated a higher affinity to Cls over native CI -inhibitor.
- the truncated Cl-INH fusion protein similarly demonstrated a higher affinity to Cls over native CI -inhibitor.
- Titration curves for each of the effector dead constructs tested in the assay were calculated using mass spec or gel estimates for molecular weights as shown in FIGs. 9 A and 9B.
- the full length fusion protein demonstrated a higher affinity to Cls over native CI -inhibitor.
- the truncated Cl-INH fusion protein similarly demonstrated a higher affinity to Cls over native CI -inhibitor.
- FIGs. 10A and 10B depict a schematic overview of hemolysis assays of the alternative and classical complement pathways. Seelen et al., J. of Immun. Methods, 296: 187- 198 (2005).
- Fc-Cl -inhibitor fusion proteins are able to inhibit Cls activity.
- the Fc fusion proteins in particular, full length CI -inhibitor fusion proteins consistently inhibit the Cls with a higher affinity than the plasma-derived CI -inhibitor.
- Both full length and truncated Cl- inhibitor fusion proteins are able to inhibit lysis of red blood cells in vitro.
- FIG. 12 shows exemplary results of a Rabbit PK study of the effector dead fusion constructs compared with plasma-derived C 1 -inhibitor and recombinant C 1 -INH.
- Plasma- derived Cl-INH administered by IV exhibits a monophasic serum concentration-time profile.
- rhCl-INH-IgG constructs administered by IV exhibit bi-phasic serum concentration-time profiles.
- the initial rapid clearance phase (approximately 2 hrs) was indicative of receptor- mediated cellular uptake.
- the constructs exhibited a secondary slower clearance phase.
- Example 3 Albumin Fusion Proteins
- albumin protein constructs were generated. Schematics of these constructs are depicted in FIGs. 13A-F. Fusion construct expression vectors comprising albumin or the D3 domain of albumin joined directly to the N-terminus of full length and truncated Cl- INH joined directly to the N-terminus of full length Cl-INH were made. Fusion construct expression vectors comprising albumin or the D3 domain of albumin joined using linkers to the N-terminus of full length and truncated Cl-INH joined directly to the N-terminus of full length Cl-INH were also made. The amino acid sequences of the fusion proteins expressed by these constructs comprised the following sequences:
- FreeStyleTM CHO-S Cells were transfected with these fusion construct expression vectors as described above CHO-GS stable pools were prepared and used to generate CM for collection and analysis. Cells were seeded at 2xl0 6 cells/mL and incubated for 4 days at 33°C. Glutamine was supplemented on day 3.
- CM Conditioned Medium
- CM Conditioned Medium
- the 4 day batch harvests were concentrated using a 50 kDa Vivaspin ® 20 centrifugal concentrator (Vivaproducts, Inc., Cat. No. VS2031) and purified using Invitrogen's CaptureSelect Albumin Affinity Matrix (Invitrogen, Cat. No. 19129701L).
- the elution buffer was 20mM Tris pH 7.4 + 2M MgCl 2 ). Samples were run on Coomassie gel against BSA to evaluate expression.
- HSA-C1-INH The yield based on this purification for HSA-C1-INH was approximately 3.6 mg/L and for D3-C1-INH was approximately 1.6 mg/L.
- Proteins were concentrated to ⁇ 2 mg/mL using Vivaspin ® 50 kDa and stored at -20°C. Purified proteins were dialyzed overnight into Cl-Inh formulation buffer (50 mM Tris pH7.2, 50 mM sorbitol, 150 mM glycine) and concentrated.
- FIG. 14 presents the results of an assay to measure the ability of some exemplary albumin CI -INH fusion constructs to inhibit Cls cleavage of a colorimetric peptide, including a plasma-derived Cl-INH and HT1080 expressed recombinant Cl-INH for comparison.
- Proteins were run on SEC-MALS to check for aggregation and to determine size.
- CaptureSelect Human Albumin Affinity Matrix from CHO-GS CM worked well. Purified proteins had Cls activity comparable to plasma-derived Cl-INH. SEC-MALS showed only a single peak with no HMW species at the expected size.
- CHO-GS GNE cells were transfected via electroporation following manufacturer's protocol. Stable pools were selected and a 7 day batch harvest production was performed at 33°C. Batch harvests were evaluated by Coomassie Gel for expression. Coomassie results show Full-length HSA-C 1 -INH fusion proteins show less expression than HSA D3 fusions. No significant differences were seen with the addition of a linker sequence.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Gastroenterology & Hepatology (AREA)
- Immunology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Genetics & Genomics (AREA)
- Biochemistry (AREA)
- Molecular Biology (AREA)
- Biophysics (AREA)
- Zoology (AREA)
- Epidemiology (AREA)
- Toxicology (AREA)
- Neurology (AREA)
- Biomedical Technology (AREA)
- Neurosurgery (AREA)
- Cell Biology (AREA)
- Physical Education & Sports Medicine (AREA)
- Cardiology (AREA)
- Ophthalmology & Optometry (AREA)
- Heart & Thoracic Surgery (AREA)
- Orthopedic Medicine & Surgery (AREA)
- Hematology (AREA)
- Dermatology (AREA)
- Psychology (AREA)
- Transplantation (AREA)
- Diabetes (AREA)
- Peptides Or Proteins (AREA)
Priority Applications (12)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP15795274.8A EP3212663B1 (en) | 2014-10-31 | 2015-10-31 | C1 esterase inhibitor fusion proteins and uses thereof |
| BR112017008962-9A BR112017008962A2 (pt) | 2014-10-31 | 2015-10-31 | proteínas de fusão inibidoras de c1 esterase e usos das mesmas |
| CN202110936129.3A CN113698495B (zh) | 2014-10-31 | 2015-10-31 | C1酯酶抑制剂融合蛋白及其用途 |
| JP2017523423A JP6740225B2 (ja) | 2014-10-31 | 2015-10-31 | C1エステラーゼ阻害因子融合タンパク質及びその使用 |
| CA2964132A CA2964132A1 (en) | 2014-10-31 | 2015-10-31 | C1 esterase inhibitor fusion proteins and uses thereof |
| AU2015338913A AU2015338913B2 (en) | 2014-10-31 | 2015-10-31 | C1 esterase inhibitor fusion proteins and uses thereof |
| KR1020177014659A KR102753264B1 (ko) | 2014-10-31 | 2015-10-31 | C1 에스테라제 억제제 융합 단백질 및 이의 용도 |
| HK18103036.0A HK1243443B (en) | 2014-10-31 | 2015-10-31 | C1 esterase inhibitor fusion proteins and uses thereof |
| EP20176552.6A EP3769780A1 (en) | 2014-10-31 | 2015-10-31 | C1 esterase inhibitor fusion proteins and uses thereof |
| CN201580067942.4A CN107108753A (zh) | 2014-10-31 | 2015-10-31 | C1酯酶抑制剂融合蛋白及其用途 |
| KR1020247007656A KR20240035643A (ko) | 2014-10-31 | 2015-10-31 | C1 에스테라제 억제제 융합 단백질 및 이의 용도 |
| AU2021200977A AU2021200977A1 (en) | 2014-10-31 | 2021-02-15 | C1 esterase inhibitor fusion proteins and uses thereof |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201462073657P | 2014-10-31 | 2014-10-31 | |
| US62/073,657 | 2014-10-31 |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2016070156A2 true WO2016070156A2 (en) | 2016-05-06 |
| WO2016070156A3 WO2016070156A3 (en) | 2016-06-23 |
Family
ID=54548264
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2015/058521 Ceased WO2016070156A2 (en) | 2014-10-31 | 2015-10-31 | C1 esterase inhibitor fusion proteins and uses thereof |
Country Status (10)
| Country | Link |
|---|---|
| US (1) | US20160130324A1 (cg-RX-API-DMAC7.html) |
| EP (2) | EP3769780A1 (cg-RX-API-DMAC7.html) |
| JP (3) | JP6740225B2 (cg-RX-API-DMAC7.html) |
| KR (2) | KR20240035643A (cg-RX-API-DMAC7.html) |
| CN (2) | CN107108753A (cg-RX-API-DMAC7.html) |
| AU (2) | AU2015338913B2 (cg-RX-API-DMAC7.html) |
| BR (1) | BR112017008962A2 (cg-RX-API-DMAC7.html) |
| CA (1) | CA2964132A1 (cg-RX-API-DMAC7.html) |
| MA (1) | MA53991A (cg-RX-API-DMAC7.html) |
| WO (1) | WO2016070156A2 (cg-RX-API-DMAC7.html) |
Cited By (8)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2017087882A1 (en) * | 2015-11-19 | 2017-05-26 | Shire Human Genetic Therapies, Inc. | Recombinant human c1 esterase inhibitor and uses thereof |
| WO2018037046A1 (en) | 2016-08-23 | 2018-03-01 | Csl Behring Gmbh | Method of preventing acute attacks of hereditary angioedema associated with c1 esterase inhibitor deficiency |
| WO2020252136A1 (en) * | 2019-06-11 | 2020-12-17 | Shire Human Genetic Therapies, Inc. | Adeno associated viral vector delivery of antibodies for the treatment of disease mediated dysregulated plasma kallikrein |
| EP3634466A4 (en) * | 2017-06-06 | 2021-03-24 | Relinia, Inc. | MONOCATENARY TNF RECEPTOR 2 AGONIST FUSION PROTEINS |
| CN113493519A (zh) * | 2020-03-19 | 2021-10-12 | 浙江道尔生物科技有限公司 | 一种半衰期显著延长的治疗眼部血管新生疾病的融合蛋白 |
| EP3770170A4 (en) * | 2017-06-20 | 2021-12-22 | Sichuan Baili Pharm Co. Ltd | SCREENING OF FIXED POINT COUPLING POINTS OF CYSTEIN-MODIFIED ANTIBODY TOXIN CONJUGATE (TDC) |
| WO2022109124A1 (en) | 2020-11-20 | 2022-05-27 | Csl Behring Gmbh | Method for treating antibody-mediated rejection |
| US12410223B2 (en) | 2023-09-29 | 2025-09-09 | Trex Bio, Inc. | TNF-alpha variant fusion molecules |
Families Citing this family (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US12559526B2 (en) * | 2018-10-15 | 2026-02-24 | The Regents Of The University Of California | Complement component 1s (C1s) deficient cells for production of vaccines and biopharmaceutical proteins |
| CN111087475B (zh) * | 2019-12-25 | 2022-07-08 | 东莞市东阳光生物药研发有限公司 | Fgf21融合蛋白及抑制其降解的方法 |
Citations (11)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4399216A (en) | 1980-02-25 | 1983-08-16 | The Trustees Of Columbia University | Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials |
| US4634665A (en) | 1980-02-25 | 1987-01-06 | The Trustees Of Columbia University In The City Of New York | Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials |
| US4656134A (en) | 1982-01-11 | 1987-04-07 | Board Of Trustees Of Leland Stanford Jr. University | Gene amplification in eukaryotic cells |
| US4956288A (en) | 1988-04-22 | 1990-09-11 | Biogen, Inc. | Method for producing cells containing stably integrated foreign DNA at a high copy number, the cells produced by this method, and the use of these cells to produce the polypeptides coded for by the foreign DNA |
| US5122464A (en) | 1986-01-23 | 1992-06-16 | Celltech Limited, A British Company | Method for dominant selection in eucaryotic cells |
| US5149636A (en) | 1982-03-15 | 1992-09-22 | Trustees Of Columbia University In The City Of New York | Method for introducing cloned, amplifiable genes into eucaryotic cells and for producing proteinaceous products |
| US5179017A (en) | 1980-02-25 | 1993-01-12 | The Trustees Of Columbia University In The City Of New York | Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials |
| WO2011063348A1 (en) | 2009-11-23 | 2011-05-26 | Amgen Inc. | Monomeric antibody fc |
| WO2012020096A1 (en) | 2010-08-13 | 2012-02-16 | Medimmune Limited | Monomeric polypeptides comprising variant fc regions and methods of use |
| WO2013138643A1 (en) | 2012-03-16 | 2013-09-19 | The United States Of America, As Represented By The Secretary, Department Of Health & Human Services | Soluble engineered monomeric fc |
| WO2014087299A1 (en) | 2012-12-07 | 2014-06-12 | Pfizer Inc. | Engineered monomeric antibody fragments |
Family Cites Families (40)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5047335A (en) | 1988-12-21 | 1991-09-10 | The Regents Of The University Of Calif. | Process for controlling intracellular glycosylation of proteins |
| US5096816A (en) | 1990-06-05 | 1992-03-17 | Cetus Corporation | In vitro management of ammonia's effect on glycosylation of cell products through pH control |
| FR2672895B1 (fr) | 1991-02-15 | 1995-05-12 | Transgene Sa | Procede de purification d'une proteine fortement glycosylee. |
| WO1992022320A1 (en) * | 1991-06-14 | 1992-12-23 | Genentech, Inc. | C1 inhibitor variants and treating inflammatory response with c1 inhibitor |
| US5705364A (en) | 1995-06-06 | 1998-01-06 | Genentech, Inc. | Mammalian cell culture process |
| US6277375B1 (en) | 1997-03-03 | 2001-08-21 | Board Of Regents, The University Of Texas System | Immunoglobulin-like domains with increased half-lives |
| US6528286B1 (en) | 1998-05-29 | 2003-03-04 | Genentech, Inc. | Mammalian cell culture process for producing glycoproteins |
| HUP0204475A2 (en) * | 2000-02-11 | 2003-04-28 | Merck Patent Gmbh | Enhancing the circulating half-life of antibody-based fusion proteins |
| EP2213743A1 (en) * | 2000-04-12 | 2010-08-04 | Human Genome Sciences, Inc. | Albumin fusion proteins |
| US7083784B2 (en) | 2000-12-12 | 2006-08-01 | Medimmune, Inc. | Molecules with extended half-lives, compositions and uses thereof |
| EP1543106B1 (en) | 2002-07-15 | 2007-04-11 | Immunex Corporation | Methods and media for controlling sialylation of proteins produced by mammalian cells |
| US8524477B2 (en) | 2002-10-29 | 2013-09-03 | Crucell Holland B.V. | Methods to obtain recombinant proteins with increased sialylation from cells that express adenovirus E1A protein, and proteins obtained thereby |
| US7384754B2 (en) | 2003-10-31 | 2008-06-10 | Agilent Technologies, Inc. | Enrichment and tagging of glycosylated proteins |
| KR20070085224A (ko) * | 2004-08-03 | 2007-08-27 | 바이오렉시스 파마슈티칼 코포레이션 | Glp-1을 포함하는 트랜스페린 융합 단백질을 사용하는혼합 요법 |
| GB0507123D0 (en) | 2005-04-08 | 2005-05-11 | Isis Innovation | Method |
| WO2006130834A2 (en) | 2005-05-31 | 2006-12-07 | Board Of Regents, The University Of Texas System | IGGl ANTIBODIES WITH MUTATED FC PORTION FOR INCREASED BINDING TO FCRN RECEPTOR AND USES THEREOF |
| EP2495308A1 (en) | 2005-12-08 | 2012-09-05 | Amgen Inc. | Improved production of glycoproteins using manganese |
| DK3438131T3 (da) | 2006-02-10 | 2022-04-11 | Life Technologies Corp | Oligosaccharidmodifikation og mærkning af proteiner |
| WO2008025856A2 (en) | 2006-09-01 | 2008-03-06 | Novo Nordisk Health Care Ag | Modified glycoproteins |
| IL182956A0 (en) | 2007-05-03 | 2008-01-20 | Yeda Res & Dev | Glycan modified soluble receptors and binding proteins and their use |
| EP2930245B1 (en) | 2007-10-12 | 2017-11-22 | Sigma-Aldrich Co. LLC | Cell line and methods for improved glycoprotein sialylation |
| RU2495131C2 (ru) | 2008-02-19 | 2013-10-10 | Байокон Лимитид | Способ получения рекомбинантного инсулина гларгина |
| EP2166085A1 (en) | 2008-07-16 | 2010-03-24 | Suomen Punainen Risti Veripalvelu | Divalent modified cells |
| CN102317309A (zh) | 2009-02-26 | 2012-01-11 | 巴特勒能源同盟有限公司 | 通过不同的翻译后修饰改变和调节蛋白质活性 |
| WO2011108714A1 (ja) * | 2010-03-04 | 2011-09-09 | 中外製薬株式会社 | 抗体定常領域改変体 |
| US20130085111A1 (en) * | 2010-03-18 | 2013-04-04 | Thrombolytic Science, Llc | Production of human c1 inhibitor in human cells |
| US20120010013A1 (en) * | 2010-06-19 | 2012-01-12 | Fellows Edwin E | Swing assistant device |
| US9505826B2 (en) * | 2010-12-22 | 2016-11-29 | Teva Pharmaceuticals Australia Pty Ltd | Modified antibody with improved half-life |
| JP5907540B2 (ja) | 2011-02-10 | 2016-04-26 | エフ・ホフマン−ラ・ロシュ・アクチェンゲゼルシャフト | 綿を含む固定相を用いるクロマトグラフィーによりグリカン及び/又は複合糖質を精製するための方法 |
| US8580922B2 (en) | 2011-03-04 | 2013-11-12 | Shire Human Genetic Therapies, Inc. | Peptide linkers for polypeptide compositions and methods for using same |
| ES2692268T5 (en) * | 2011-03-29 | 2025-02-26 | Roche Glycart Ag | Antibody fc variants |
| KR102231139B1 (ko) * | 2011-06-28 | 2021-03-24 | 인히브릭스, 인크. | 세르핀 융합 폴리펩타이드 및 이의 이용 방법 |
| DK2729482T3 (en) | 2011-07-08 | 2018-05-07 | Merck Sharp & Dohme | PROCEDURE FOR CLEANING FC-FUSION PROTEIN |
| CN102890790B (zh) * | 2011-07-22 | 2014-04-30 | 鸿富锦精密工业(深圳)有限公司 | 扩展卡 |
| WO2013093760A2 (en) | 2011-12-19 | 2013-06-27 | Grifols, S.A. | Compositions, methods, and kits for preparing sialylated recombinant proteins |
| JP6127063B2 (ja) * | 2011-12-22 | 2017-05-10 | ツェー・エス・エル・ベーリング・ゲー・エム・ベー・ハー | 中枢神経系の続発性浮腫の治療のためのc1インヒビターの使用 |
| EP2623110A1 (en) * | 2012-01-31 | 2013-08-07 | CSL Behring GmbH | Factor XII inhibitors for the treatment of neurological inflammatory disorders |
| CN105188750A (zh) * | 2013-03-08 | 2015-12-23 | 德国杰特贝林生物制品有限公司 | 治疗和预防远端缺血-再灌注损伤 |
| EP2970940B1 (en) * | 2013-03-14 | 2018-07-25 | Translate Bio, Inc. | Mrna therapeutic compositions and use to treat diseases and disorders |
| EP2796145B1 (en) * | 2013-04-22 | 2017-11-01 | CSL Ltd. | A covalent complex of von willebrand factor and faktor viii linked by a disulphide bridge |
-
2015
- 2015-10-30 US US14/929,251 patent/US20160130324A1/en not_active Abandoned
- 2015-10-31 KR KR1020247007656A patent/KR20240035643A/ko active Pending
- 2015-10-31 MA MA053991A patent/MA53991A/fr unknown
- 2015-10-31 EP EP20176552.6A patent/EP3769780A1/en not_active Withdrawn
- 2015-10-31 WO PCT/US2015/058521 patent/WO2016070156A2/en not_active Ceased
- 2015-10-31 JP JP2017523423A patent/JP6740225B2/ja active Active
- 2015-10-31 EP EP15795274.8A patent/EP3212663B1/en active Active
- 2015-10-31 CN CN201580067942.4A patent/CN107108753A/zh active Pending
- 2015-10-31 AU AU2015338913A patent/AU2015338913B2/en active Active
- 2015-10-31 KR KR1020177014659A patent/KR102753264B1/ko active Active
- 2015-10-31 CN CN202110936129.3A patent/CN113698495B/zh active Active
- 2015-10-31 CA CA2964132A patent/CA2964132A1/en active Pending
- 2015-10-31 BR BR112017008962-9A patent/BR112017008962A2/pt not_active Application Discontinuation
-
2020
- 2020-07-22 JP JP2020125041A patent/JP2020202841A/ja not_active Withdrawn
-
2021
- 2021-02-15 AU AU2021200977A patent/AU2021200977A1/en not_active Abandoned
-
2022
- 2022-12-15 JP JP2022200230A patent/JP2023027290A/ja not_active Withdrawn
Patent Citations (13)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4634665A (en) | 1980-02-25 | 1987-01-06 | The Trustees Of Columbia University In The City Of New York | Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials |
| US4399216A (en) | 1980-02-25 | 1983-08-16 | The Trustees Of Columbia University | Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials |
| US5179017A (en) | 1980-02-25 | 1993-01-12 | The Trustees Of Columbia University In The City Of New York | Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials |
| US4656134A (en) | 1982-01-11 | 1987-04-07 | Board Of Trustees Of Leland Stanford Jr. University | Gene amplification in eukaryotic cells |
| US5149636A (en) | 1982-03-15 | 1992-09-22 | Trustees Of Columbia University In The City Of New York | Method for introducing cloned, amplifiable genes into eucaryotic cells and for producing proteinaceous products |
| US5827739A (en) | 1986-01-23 | 1998-10-27 | Celltech Therapeutics Limited | Recombinant DNA sequences, vectors containing them and method for the use thereof |
| US5122464A (en) | 1986-01-23 | 1992-06-16 | Celltech Limited, A British Company | Method for dominant selection in eucaryotic cells |
| US5770359A (en) | 1986-01-23 | 1998-06-23 | Celltech Therapeutics Limited | Recombinant DNA sequences, vectors containing them and method for the use thereof |
| US4956288A (en) | 1988-04-22 | 1990-09-11 | Biogen, Inc. | Method for producing cells containing stably integrated foreign DNA at a high copy number, the cells produced by this method, and the use of these cells to produce the polypeptides coded for by the foreign DNA |
| WO2011063348A1 (en) | 2009-11-23 | 2011-05-26 | Amgen Inc. | Monomeric antibody fc |
| WO2012020096A1 (en) | 2010-08-13 | 2012-02-16 | Medimmune Limited | Monomeric polypeptides comprising variant fc regions and methods of use |
| WO2013138643A1 (en) | 2012-03-16 | 2013-09-19 | The United States Of America, As Represented By The Secretary, Department Of Health & Human Services | Soluble engineered monomeric fc |
| WO2014087299A1 (en) | 2012-12-07 | 2014-06-12 | Pfizer Inc. | Engineered monomeric antibody fragments |
Non-Patent Citations (41)
| Title |
|---|
| "Bioinformatics Methods and Protocols (Methods in Molecular Biology", vol. 132, 1999, HUMANA PRESS |
| ALTSCHUL ET AL., METHODS IN ENZYMOLOGY |
| ALTSCHUL ET AL., METHODS IN ENZYMOLOGY, vol. 266, 1996, pages 460 - 480 |
| ALTSCHUL ET AL., NUCLEIC ACIDS RES., vol. 25, 1997, pages 3389 - 3402 |
| ALTSCHUL ET AL.: "Basic local alignment search tool", J. MOL. BIOL., vol. 215, no. 3, 1990, pages 403 - 410, XP002949123, DOI: doi:10.1006/jmbi.1990.9999 |
| ALTSCHUL ET AL.: "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", NUCLEIC ACIDS RES., vol. 25, 1997, pages 3389 - 3402, XP002905950, DOI: doi:10.1093/nar/25.17.3389 |
| BAXEVANIS ET AL.: "Bioinformatics : A Practical Guide to the Analysis of Genes and Proteins", 1998, WILEY |
| BENOIST, NATURE, vol. 290, 1981, pages 304 - 310 |
| BOSHART ET AL., CELL, vol. 41, 1985, pages 521 |
| BOSHART ET AL., CELL, vol. 41, 1985, pages 521 - 530 |
| BRINSTER ET AL., NATURE, vol. 296, 1982, pages 39 - 42 |
| CAI, S.; DAVIS, A. E.: "Complement Regulatory Protein C1 Inhibitor Binds to Selectins and Interferes with Endothelial-Leukocyte Adhesion", J IMMUNOL, vol. 171, 2003, pages 4786 - 4791, XP002987245 |
| DAVIS, B.; BERNSTEIN, J. A.: "Conestat alfa for the treatment of angioedema attacks", THER CLIN RISK MANAG., vol. 7, 2011, pages 265 - 273 |
| DEBOER ET AL., PROC. NATL. ACAD. SCI. USA, vol. 80, 1983, pages 21 - 25 |
| DEUTSCHER, M. P., SIMON, M. I., ABELSON, J. N.: "Guide to Protein Purification: Methods in Enzymology (Methods in Enzymology Series", vol. 182, 1997, ACADEMIC PRESS |
| DIJKEMA ET AL., EMBO J., vol. 4, 1985, pages 761 |
| DUMONT, J. ET AL.: "Monomeric Fc Fusions: Impact on Pharmacokinetic and Biological Activity of Protein Therapeutics", BIODRUGS, vol. 20, no. 3, 2006, pages 151 - 160, XP009082835, DOI: doi:10.2165/00063030-200620030-00002 |
| FOECKING ET AL., GENE, vol. 45, 1986, pages 101 - 105 |
| GORMAN ET AL., PROC. NATL. ACAD. SCI. USA, vol. 79, 1982, pages 6777 |
| GRAHAM ET AL., J. GEN VIROL., vol. 36, 1977, pages 59 |
| GRAHAM; VAN DER ERB, VIROLOGY, vol. 52, 1978, pages 456 - 457 |
| HAWLEY-NELSON, FOCUS, vol. 15, November 1993 (1993-11-01), pages 73 |
| HIGGINS, S. J. AND HAMES, B. D.: "Protein Expression: A Practical Approach", 1999, OXFORD UNIV PRESS |
| ISHINO, T ET AL.: "Protein Structure and Folding: Half-life Extension of Biotherapeutics Modality by N-Glycosylation for the Engineering a Monomeric Fc Domain", J. BIOL. CHEM., vol. 288, 2013, pages 16529 - 16537 |
| KABAT ET AL.: "Sequences of proteins of immunological interest", 1987, UNITED STATES DEPARTMENT OF HEALTH AND HUMAN SERVICES |
| KARNAUKHOVA, E.: "CI-Esterase Inhibitor: Biological Activities and Therapeutic Applications", J HEMATOL THROMB DIS, vol. 1, 2013, pages 113 |
| KEOWN ET AL., METHODS IN ENZYMOLOGY, 1989 |
| KEOWN ET AL., METHODS IN ENZYMOLOGY, vol. 185, 1990, pages 527 - 537 |
| KOLES, K. ET AL.: "Influence of lactation parameters on the N-glycosylation of recombinant human C1 inhibitor isolated from the milk of transgenic rabbits", GLYCOBIOLOGY, vol. 14, no. 11, 2004, pages 979 - 986, XP055163482, DOI: doi:10.1093/glycob/cwh127 |
| KOLES, K. ET AL.: "N- and O-glycans of recombinant human C1 inhibitor expressed in the milk of transgenic rabbits", GLYCOBIOLOGY, vol. 14, no. 1, 2004, pages 51 - 64, XP055099168, DOI: doi:10.1093/glycob/cwh010 |
| MANSOUR ET AL., NATURE, vol. 336, 1988, pages 348 - 352 |
| MATHER ET AL., ANNALS N.Y. ACAD. SCI., vol. 383, 1982, pages 44 - 68 |
| MATHER, BIOL. REPROD., vol. 23, 1980, pages 243 - 251 |
| MISENER, ET AL: "Bioinformatics Methods and Protocols", vol. 132, 1999, HUMANA PRESS |
| SAMBROOK; FRITSCH; MANIATIS: "Molecular Cloning: A Laboratory Manual, 2nd ed.", 1989, COLD SPRING HARBOR LABORATORY PRESS |
| SCOPES: "Protein Purification Principles and Practice, 2nd ed.", 1987, SPRINGER-VERLAG |
| SEELEN ET AL., J. OF IMMUN. METHODS, vol. 296, 2005, pages 187 - 198 |
| TAKEBE ET AL., MOLEC. AND CELL. BIO., vol. 8, 1988, pages 466 - 472 |
| URLAUB; CHASIN, PROC. NATL. ACAD. SCI. USA, vol. 77, 1980, pages 4216 |
| VILLA-KOMAROFF ET AL., PROC. NATL. ACAD. SCI. USA, vol. 75, 1978, pages 3727 - 3731 |
| WAGNER ET AL, PROC. NATL. ACAD. SCI. USA, vol. 78, 1981, pages 1441 - 1445 |
Cited By (12)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2017087882A1 (en) * | 2015-11-19 | 2017-05-26 | Shire Human Genetic Therapies, Inc. | Recombinant human c1 esterase inhibitor and uses thereof |
| US12209116B2 (en) | 2015-11-19 | 2025-01-28 | Takeda Pharmaceutical Company Limited | Recombinant human C1 esterase inhibitor and uses thereof |
| WO2018037046A1 (en) | 2016-08-23 | 2018-03-01 | Csl Behring Gmbh | Method of preventing acute attacks of hereditary angioedema associated with c1 esterase inhibitor deficiency |
| EP3634466A4 (en) * | 2017-06-06 | 2021-03-24 | Relinia, Inc. | MONOCATENARY TNF RECEPTOR 2 AGONIST FUSION PROTEINS |
| US11530247B2 (en) | 2017-06-06 | 2022-12-20 | Relinia, Inc. | Single-chain TNF receptor 2 agonist fusion proteins |
| US12365712B2 (en) | 2017-06-06 | 2025-07-22 | Relinia, Inc. | Single-chain TNF Receptor 2 agonist fusion proteins |
| EP3770170A4 (en) * | 2017-06-20 | 2021-12-22 | Sichuan Baili Pharm Co. Ltd | SCREENING OF FIXED POINT COUPLING POINTS OF CYSTEIN-MODIFIED ANTIBODY TOXIN CONJUGATE (TDC) |
| WO2020252136A1 (en) * | 2019-06-11 | 2020-12-17 | Shire Human Genetic Therapies, Inc. | Adeno associated viral vector delivery of antibodies for the treatment of disease mediated dysregulated plasma kallikrein |
| CN113493519A (zh) * | 2020-03-19 | 2021-10-12 | 浙江道尔生物科技有限公司 | 一种半衰期显著延长的治疗眼部血管新生疾病的融合蛋白 |
| CN113493519B (zh) * | 2020-03-19 | 2022-12-27 | 浙江道尔生物科技有限公司 | 一种半衰期显著延长的治疗眼部血管新生疾病的融合蛋白 |
| WO2022109124A1 (en) | 2020-11-20 | 2022-05-27 | Csl Behring Gmbh | Method for treating antibody-mediated rejection |
| US12410223B2 (en) | 2023-09-29 | 2025-09-09 | Trex Bio, Inc. | TNF-alpha variant fusion molecules |
Also Published As
| Publication number | Publication date |
|---|---|
| JP2023027290A (ja) | 2023-03-01 |
| JP2018503355A (ja) | 2018-02-08 |
| CN113698495B (zh) | 2025-06-06 |
| MA53991A (fr) | 2021-09-15 |
| CA2964132A1 (en) | 2016-05-06 |
| AU2015338913B2 (en) | 2020-11-19 |
| KR20170074244A (ko) | 2017-06-29 |
| WO2016070156A3 (en) | 2016-06-23 |
| JP6740225B2 (ja) | 2020-08-12 |
| AU2015338913A1 (en) | 2017-05-04 |
| CN107108753A (zh) | 2017-08-29 |
| KR20240035643A (ko) | 2024-03-15 |
| BR112017008962A2 (pt) | 2018-01-16 |
| AU2021200977A1 (en) | 2021-03-11 |
| EP3769780A1 (en) | 2021-01-27 |
| EP3212663B1 (en) | 2020-05-27 |
| KR102753264B1 (ko) | 2025-01-10 |
| EP3212663A2 (en) | 2017-09-06 |
| US20160130324A1 (en) | 2016-05-12 |
| CN113698495A (zh) | 2021-11-26 |
| JP2020202841A (ja) | 2020-12-24 |
| HK1243443A1 (en) | 2018-07-13 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| EP3212663B1 (en) | C1 esterase inhibitor fusion proteins and uses thereof | |
| JP7562747B2 (ja) | 組換えヒトc1エステラーゼインヒビター及びその使用 | |
| CN102655877B (zh) | Fgf21突变体及其用途 | |
| JP2022000053A (ja) | Xtenを有するトロンビン切断可能リンカー及びその使用 | |
| WO2017024060A1 (en) | Factor ix fusion proteins and methods of making and using same | |
| MXPA01006922A (es) | Expresion y exportacion de proteinas de anti-obesidad como proteinas de fusion en fc. | |
| PH12014502868B1 (en) | Cells for producing recombinant iduronate-2-sulfatase | |
| JP2022118184A (ja) | コンジュゲートされたc1エステラーゼインヒビター及びその使用 | |
| CA3181983A1 (en) | Soluble enpp1 or enpp3 proteins and uses thereof | |
| HK40045832A (en) | C1 esterase inhibitor fusion proteins and uses thereof | |
| HK1243443B (en) | C1 esterase inhibitor fusion proteins and uses thereof | |
| CN115073607A (zh) | Tnfr2与baff受体的融合蛋白 | |
| TW202542190A (zh) | 包含酸性α—葡萄糖苷酶之融合蛋白及其方法 | |
| HK1261383B (en) | Recombinant human c1 esterase inhibitor and uses thereof | |
| HK1261383A1 (en) | Recombinant human c1 esterase inhibitor and uses thereof | |
| HK1045160A (en) | Expression and export of anti-obesity proteins as fc fusion proteins |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 15795274 Country of ref document: EP Kind code of ref document: A2 |
|
| ENP | Entry into the national phase |
Ref document number: 2964132 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 122021000134 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 2017523423 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2015338913 Country of ref document: AU Date of ref document: 20151031 Kind code of ref document: A |
|
| REEP | Request for entry into the european phase |
Ref document number: 2015795274 Country of ref document: EP |
|
| ENP | Entry into the national phase |
Ref document number: 20177014659 Country of ref document: KR Kind code of ref document: A |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112017008962 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 112017008962 Country of ref document: BR Kind code of ref document: A2 Effective date: 20170427 |