WO2016023072A1 - Novel potassium channel blockers and use thereof in the treatment of autoimmune diseases - Google Patents

Novel potassium channel blockers and use thereof in the treatment of autoimmune diseases Download PDF

Info

Publication number
WO2016023072A1
WO2016023072A1 PCT/AU2015/000487 AU2015000487W WO2016023072A1 WO 2016023072 A1 WO2016023072 A1 WO 2016023072A1 AU 2015000487 W AU2015000487 W AU 2015000487W WO 2016023072 A1 WO2016023072 A1 WO 2016023072A1
Authority
WO
WIPO (PCT)
Prior art keywords
analogue
amino acid
shk
seq
autoimmune disease
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/AU2015/000487
Other languages
English (en)
French (fr)
Inventor
Raymond S NORTON
Shih Chieh CHANG
Michael W PENNINGTON
Christine Beeton
Brian J. Smith
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
La Trobe University
Monash University
PEPTIDES INTERNATIONAL Inc
Baylor College of Medicine
Original Assignee
La Trobe University
Monash University
PEPTIDES INTERNATIONAL Inc
Baylor College of Medicine
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority claimed from AU2014903189A external-priority patent/AU2014903189A0/en
Application filed by La Trobe University, Monash University, PEPTIDES INTERNATIONAL Inc, Baylor College of Medicine filed Critical La Trobe University
Priority to EP15832619.9A priority Critical patent/EP3180365B1/en
Priority to AU2015303825A priority patent/AU2015303825B2/en
Priority to US15/503,841 priority patent/US10246496B2/en
Priority to JP2017508102A priority patent/JP6847828B2/ja
Publication of WO2016023072A1 publication Critical patent/WO2016023072A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/43504Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from invertebrates
    • C07K14/43595Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from invertebrates from coelenteratae, e.g. medusae
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P29/00Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • A61P35/02Antineoplastic agents specific for leukemia
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • A61P37/06Immunosuppressants, e.g. drugs for graft rejection
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/43504Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from invertebrates
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K19/00Hybrid peptides, i.e. peptides covalently bound to nucleic acids, or non-covalently bound protein-protein complexes
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/20Fusion polypeptide containing a tag with affinity for a non-protein ligand
    • C07K2319/21Fusion polypeptide containing a tag with affinity for a non-protein ligand containing a His-tag
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K4/00Peptides having up to 20 amino acids in an undefined or only partially defined sequence; Derivatives thereof

Definitions

  • the present invention relates to novel analogues of the sea anemone peptide Stichodaclyla helianthiis toxin ShK, and their use as, for example, therapeutic agents for treating autoimmune diseases.
  • autoimmune diseases affecting millions of people worldwide. They involve various organs in the body, such as the joints (eg rheumatoid arthritis; RA), heart, lungs (eg asthma), central nervous system (CNS) (eg multiple sclerosis; MS), endocrine organs (eg type- 1 diabetes mellitus; TI DM) and skin (eg psoriasis). Typically, they are characterised by tissue destruction caused by, at least in part, self-reactive T lymphocytes (T cells).
  • T cells self-reactive T lymphocytes
  • T EM terminally-differentiated effector memory T
  • the disease-associated T cells in patients with RA are all T EM cells (Wulff H et al., 2003; Beeton C et al., 2006; Fasth A et al, 2004; Friedrich M et al., 2000; Koshy S et al, 2014; Lovett-Racke A et al et al, 2003; and Viglietta V et al, 2002).
  • B cells differentiate into class-switched B cells upon recurring antigen stimulation and are also implicated in MS (Corcione A et al., 2004) and other autoimmune diseases; these cells are a major source of IgG autoantibodies that result in direct tissue damage in RA, MS and TI DM (Berger T et al., 2003; O'Connor KC et ai, 2001 ; Atkinson MA et al, 2001 ; and Domer T et al., 2003).
  • class-switched B cells up-regulate the Kv l .3 potassium channel upon activation and their proliferation can be suppressed through the inhibition of Kvl .3 (Wulff H et a!., 2003; and Wulff H et al., 2004).
  • CCR7 + naive and central memory (T CM ) cells are less sensitive to the inhibition of Kv l .3 as they up-regulate KCa3.
  • Kv .3 For example, blocking Kv .3 with peptides such as ShK, scorpion toxin margatoxin (MgTX) and charybdotoxin (ChTX), prevents the proliferation of CD8 cytotoxic effector memory T cells and their secretion of granzyme B (GrB), which is toxic to the neuronal cells (Hu LN et al., 2013).
  • peptides such as ShK, scorpion toxin margatoxin (MgTX) and charybdotoxin (ChTX)
  • ShK is the sea anemone peptide, which blocks Kv l .3 with an 1C 50 of 1 1 pM (Kalman K et al., 1998).
  • ShK is a 35-residue polypeptide consisting of two short a-helices comprising amino acids 14- 19 and 21 -24 stabilised by three disulphide bridges (Tudor JE et al., 1996).
  • ShK interacts with all four subunits of the Kvi .3 channel tetramer, with Lys22 occluding the channel pore (Kalman K et al., 1998).
  • ShK has been shown to suppress proliferation of T E M cells and improve the condition of two animal models of MS (ie chronic relapse-remitting experimental autoimmune encephalomyelitis (CR-EAE) and adoptive transfer of experimental autoimmune encephalomyelitis (at-EAE) (Beeton C et al., 2006)), the pristane-induced arthritis (P1A) model of RA, and animal models of asthma and psoriasis (Koshy S et al., 2014; and Gilhar A et al., 201 1 ).
  • CR-EAE chronic relapse-remitting experimental autoimmune encephalomyelitis
  • at-EAE adoptive transfer of experimental autoimmune encephalomyelitis
  • P1A pristane-induced arthritis
  • asthma and psoriasis Karlin-induced arthritis
  • ShK has considerable therapeutic potential, unfortunately it also binds to the closely-related Kv i channel subtype, Kv i .
  • ShK- 186 One such analogue of ShK, known as ShK- 186, has recently entered clinical trials for the treatment of a range of autoimmune diseases.
  • This analogue contains an N- terminal phosphotyrosine (pTyr) and a C-terminal amide; the latter was introduced to avoid carboxypeptidase degradation and has no effect on binding affinity (Tarcha EJ et al., 2012).
  • ShK-186 is, however, not wholly satisfactory since it is rapidly dephosphorylated in vivo (Tarcha EJ et al, 2012) and, further, induces low titre anti-ShK-186 antibody production (Beeton C et al., 2003).
  • ShK-192 differs from ShK- 186 by the substitution of a methionine (Met21) with norleucine (Nle) to reduce the potential for oxidative metabolism, and the replacement of the phospho moiety with a non-hydrolysable phosphono group. It has been found that while ShK-192 has a slightly lower binding affinity for Kvl .3 channels, it shows a significantly improved level of selectivity over Kvl.1 ; it is predicted to bind to the extracellular face of the channel with the terminal negatively-charged phosphono group forming a salt bridge with the side-chain ammonium group of Lys41 1 in Kvl .3 (Pennington MW et al., 2009).
  • the applicants employed computational techniques to investigate potential modifications to the ShK toxin to improve selectivity for Kvl .3 channels over Kvl.1 channels.
  • the modifications that were investigated included an N-terminal extension of ShK with the tetrapeptide sequence ESSS (SEQ ID NO: 1 ) based upon a hypothesis that this extension could mimic the phosphono moiety of the ShK- 192 analogue.
  • the present invention provides an analogue of ' Stichodactyla helianthus toxin ShK comprising an ShK toxin polypeptide and an N-terminal extension comprising an amino acid sequence according to formula (I):
  • X "4 is D, E or other negatively-charged amino acid or derivative thereof
  • X "3 is E, I, L, S, V, W or a tryptophan derivative
  • X "2 is any amino acid
  • X "1 is any amino acid, a is absent or a first additional moiety, and
  • b is absent or a second additional moiety.
  • the ShK analogue may be according to formula (II):
  • X "4 is E
  • X "3 is W
  • X "2 and X "1 are independently selected from S and T.
  • the present invention provides a method of inhibiting T lymphocyte or class- switched B cell proliferation in a subject, said method comprising administering to the subject an effective amount of the analogue of the first aspect, optionally in combination with a pharmaceutically acceptable carrier.
  • the present invention provides a method of treating an autoimmune disease in a subject, said method comprising administering to the subject an effective amount of the analogue of the first aspect, optionally in combination with a pharmaceutically acceptable carrier.
  • the present invention provides the use of the analogue of the first aspect in the treatment of an autoimmune disease, preferably an autoimmune disease mediated by T HM cells such RA and MS.
  • the present invention provides the use of the analogue of the first aspect in the preparation of a medicament for treating an autoimmune disease, preferably an autoimmune disease mediated by T EM cells such as RA and MS.
  • Figure 1 depicts homology modelling of ShK analogues in complex with Kv 1.3 :
  • A Shows ShK-192 in complex with Kvl .3 as viewed perpendicularly to the membrane plane with the channel represented as a ribbon and the ShK analogue as a transparent surface.
  • the side chain atoms of the amino acids on the surface of the channel that differ between Kv 1.1 and KvT .3 are illustrated as spheres;
  • B Shows a comparison of MODELLER energies and separation between the N-terminal Glu of the ShK analogue and Lys41 1 of the channel.
  • EW first two residues of the 4-amino acid residue extension
  • FIG. 3 provides graphical results showing the selectivity of N-terminally extended ShK analogues according to the present invention:
  • A Effect of [ESSSJShK (top), [EES S] ShK (middle) and [EWSSJShK (bottom) on Kvl .3 and Kvl . l channel currents;
  • B Effects of [ESSSJShK (o dotted line), [EESS]ShK ( ⁇ solid line), [EWSS] ShK ( ⁇ solid line) and ShK ( ⁇ dotted line) on Kvl .3 or Kv l .
  • the structure of the ShK polypeptide consists of two short a-helices comprising amino acids 14- 19 and 21 -24 stabilised by three disulphide bridges between Cys3-Cys35, Cys l 2-Cys28 and Cys l 7- Cys32 (Tudor JE et al., 1996).
  • ShK blocks Kvl .3 potassium channels by binding to all four subunits through its interaction with a shallow "vestibule" at the outer entrance of the ion conduction pathway (Lanigan MD et al., 2002). It is believed that at this position, the Lys22 residue of the ShK polypeptide occludes the channel pore like a "cork in a bottle" (Kalman K et al., 1998; Lanigan MD et al., 2002).
  • ShK analogues with novel N-terminal tetrapeptide extensions were designed and produced either recombinantly or by chemical synthesis. It was found that these analogues retain ShK activity (ie in being capable of blocking Kvl .3), but can also possess a markedly higher level of selectivity for Kvl.3 channels (ie over Kvl .1 channels). As such, the ShK analogues offer significant potential as therapeutic agents for the treatment of autoimmune diseases while avoiding generalised immunosuppression and possible cardiac- and neuro-toxicity through inhibition of off-target channels, particularly Kvl .1.
  • the present invention provides an analogue of Stichodaciyla helianthus toxin ShK comprising an ShK toxin polypeptide and an N-terminal extension comprising an amino acid sequence according to formula (I):
  • X "4 is D, E or other negatively-charged amino acid or derivative thereof
  • X- is E, 1, L, S, V, W or a tryptophan derivative
  • X "2 is any amino acid
  • X "1 is any amino acid
  • a is absent or a first additional moiety
  • b is absent or a second additional moiety.
  • the ShK analogue may be according to formula (II):
  • the ShK toxin polypeptide may comprise an amino acid sequence corresponding to that shown above as SEQ ID NO: 4. However, it will be understood by those skilled in the art that the ShK toxin polypeptide may also be a polypeptide that comprises a variant amino acid sequence of SEQ ID NO: 4 that may include one or more minor sequence variations which, preferably, do not substantially alter the function of the peptide (eg despite the variation(s), the peptide maintains the ability of binding to and blocking the activation the potassium channel Kv l .3).
  • Such variation(s) may include one or more conservative amino acid substitutions such as: G, A, V, I, L, M; D, E; N, Q; S, T; K, R, H; F, Y, W, H; and P, Na-alkylamino acids.
  • Other substitutions may include the substitution of one or more L-amino acid(s) with a D-amino acid(s).
  • any amino acid substitution comprises a substitution with an amino acid selected from the twenty (20) standard amino acids encoded by the genetic code (ie the canonical amino acids).
  • amino acid substitutions with non-canonical amino acids such as, for example, certain ⁇ -alkylamino acids (eg N-methyl glycine (sarcosine) and N-methyl alanine), and other amino acids such as 2-aminobutyric acid (Abu), naphthylalanine (Nal), amino isobutyric acid, 3- aminoadipic acid (Aad), ornithine, citruline, amino-oxyserine, homo-arginine, norleucine (Nle), aminosuberic acid and ⁇ -2- and ⁇ -3-napthylalanine, ring-substituted phenylalanine (Phe) derivatives (eg 2,3,4,5, 6-pentafluoro-phenylalanine, 4-chloro-phenylalanine, methyl-phenylalanine and phosphono- phenylalanine), phospho-tyrosine (pTyr), selenocysteine and sele
  • sequence variations that may be present include one or more amino acid deletion or addition (eg insertion).
  • Other additions that may be made to, for example, the C-tenninal sequence may comprise the addition of a single amino acid (eg Ala), short amino acid sequences (eg 2 to 10 amino acids in length) or long amino acid sequences (eg 1 1 or more amino acids) which may confer various additional functionalities or properties, such as improved bioavailability, protein recovery or expression (eg a fusion partner); although, typically, a polypeptide provided with an additional amino acid sequence will have a total length of not more than about 75 amino acids, more preferably not more than about 50 amino acids.
  • CPP cell-penetrating peptide
  • CPPs are short peptides that can facilitate cellular uptake of a molecular cargo such as a peptide or polypeptide. Accordingly, use of a CPP with a ShK analogue of the present invention can enable delivery of the ShK analogue to the cytoplasm of a cell where it may act to block Kvl .3 channels of the mitochondria (mitoKv l .3).
  • Mitochondrial Kvl.3 channels have been shown to be directly involved in cell death by serving as a target of pro-apoptotic Bax and Bak proteins (which inhibit mitoKvl .3 by directly binding into the pore of the channel to inhibit the channel in a "toxin-like mechanism"; Leanza L el al., 2015).
  • compounds that inhibit mitochondrial Kvl.3 channels eg clofazimine; Leanza L el al., 2013
  • the ShK analogues of the present invention may be suitable for use as therapeutic agents for treating cancers and other proliferative diseases and disorders.
  • CPPs suitable for use with the ShK analogues of the present invention are well known to those skilled in the art, including for example, the HIV-1 Tat-derived CPP (amino acids 48-60; Wagstaff KM and DA Jans, 2006) and the 9 amino acid transduction domain fragment thereof (Ruben S et al., 1989; and Fawell S et al., 1994), the HIV-1 Rev protein-derived CPP (amino acids 34-50), and the Drosophila Antennapedia- derived CPP (amino acids 43-58).
  • a specific ShK variant polypeptide that may be used in the analogue of the present invention is one that includes a substitution of the Met21 residue with Nle. This substitution is found in the ShK analogue, ShK- 192.
  • Met21 may be substituted with, for example, any one of Ala, Val, He and Leu. Such substitutions may confer a stabilising effect to oxidation at this position of the ShK polypeptide.
  • ShK variant polypeptides that may be used in the analogue of the present invention are described in International patent specification no WO 2010/108154, the entire content of which is hereby incorporated herein by reference.
  • ShK polypeptides that include: a substitution of Ser2 with Glu; a substitution of Ile4 with Lys, Glu or Ala; a substitution of Serl O with Arg or Glu; a substitution of Phel5 with Ala; a substitution of Lys30 with Arg or Glu; a substitution of Thr31 with Nal; and a substitution of Thr34 with Nal.
  • ShK polypeptide inhibition of Kv l .3 ie relative to the WT ShK polypeptide.
  • Other ShK polypeptides including the following amino acid substitutions were found to show improved selectivity to Kv .3 without substantial change to Kvl .3 inhibitory activity (ie relative to the WT ShK polypeptide):
  • ShK variant polypeptides that may be used in the analogue of the present invention may be selected from, for example, polypeptides consisting of one of the following amino acid sequences:
  • RSCIDTKPKSRCTAFQCKHSMKYRLSFCRKTCGTC SEQ ID NO: 1 1
  • X “4 is D, E or other negatively-charged amino acid or derivative thereof (eg a glutamic acid derivative such as ⁇ -carboxyglutamate, and 2-aminohexanedioic acid (also known as 2-aminoadipic acid)) capable of forming a salt bridge with the side-chain ammonium group of Lys41 1 of the Kv l .3 channel.
  • a glutamic acid derivative such as ⁇ -carboxyglutamate
  • 2-aminohexanedioic acid also known as 2-aminoadipic acid
  • X "4 is E.
  • X "3 is E, I, L, S, V, W or a tryptophan derivative (eg a fluorescent azatryptophan), but more preferably is selected from E, S, W or a tryptophan derivative.
  • a tryptophan derivative eg a fluorescent azatryptophan
  • X " is W.
  • X "2 and X "1 may be any amino acid, and may be the same or different.
  • each is independently selected from the twenty (20) canonical amino acids and, more preferably, from S and T.
  • one or both of X - and X 1 may be a non-canonical amino acid such as those mentioned above at paragraph [0023].
  • Preferred non-canonical amino acids that may be present at positions -2 and - 1 include derivatives of the twenty (20) canonical amino acids such as, for example, derivatives or analogues of serine (eg amino-oxyserine) and threonine (eg ⁇ -hydroxynorvaline (Hnv)).
  • X "2 is S.
  • X "1 is S.
  • a and b are both absent.
  • a may be selected from moieties such as an amino acid (eg any canonical or non-canonical amino acid), short amino acid sequences (eg 2 to 30, preferably 2 to 15, amino acids in length) or other chemical group.
  • an amino acid eg any canonical or non-canonical amino acid
  • short amino acid sequences eg 2 to 30, preferably 2 to 15, amino acids in length
  • the additional moiety a may therefore be a functional moiety such as a biochemical tag or chelator such as Fluorescein isothiocyanate (5-FITC), 5-carboxyfluorecein (5-Fam), 5- (and-6)-Carboxytetramethylrhodamine] (5,6-TAMRA), an Alexa Fluor® dye (Life Technologies Corporation, Carlsbad, CA, United States of America), a cyanine dye, near-IR dye, 1 ,4,7, 10- tetraazacyclododecane-l ,4,7,l()-tetraacetic acid (DOTA), 2-(4,7-bis(2-(tert-butoxy)-2-oxoethyl)-l,4,7- triazonan-l -yl)acetic acid (NOT A), diethylene triamine pentaacetic acid (DPTA) etc, or a spacer/linker moiety to the N-terminal such as ⁇ -alanine, 8-amino-3
  • a is an amino acid (in which case, a can be considered as X "5 , wherein X° is any amino acid), and preferably selected from the group consisting of Ala, Gly, Ser and Thr. In some particularly preferred embodiments where a is present, a is Ser. Also, in some embodiments, a may comprise a cell -penetrating peptide (CPP) such as those mentioned above in paragraph [0023 ].
  • CPP cell -penetrating peptide
  • b may be selected from moieties such as an amino acid (eg any canonical or non-canonical amino acid), short amino acid sequences (eg of 2 to 5 amino acids in length) or other chemical group.
  • the additional moiety b may therefore be a functional moiety such as a spacer/linker group to link the N-terminal extension (of formula (I)) to a ShK toxin polypeptide.
  • b is an amino acid selected from Ala and Gly.
  • N-terminal extension suitable for inclusion in the ShK analogue examples include ESSS (SEQ ID NO: 1), EWSS (SEQ ID NO: 2), EESS (SEQ ID NO: 5), EWST (SEQ ID NO: 6), EWTT (SEQ ID NO: 7), EWTS (SEQ ID NO: 8) and SEWSS (SEQ ID NO: 9).
  • the ShK analogue of the present invention may additionally or alternatively, comprise amino acid sequences that have been modified either by natural processes, such as post-translational processing, or by chemical modification techniques such as those well known to those skilled in the art (eg Pegylation). Such modifications can occur anywhere in the analogue, including for example, within the peptide backbone, the amino acid side-chains and/or the C-terminal. It will also be appreciated that the same types of modifications may be present in the same or at varying degrees at several sites in the analogue.
  • One preferred example of chemical modification is C-terminal amidation. Accordingly, the analogue of the present invention may preferably have an amide group at the C-terminal.
  • the analogue is a polypeptide that shows the same pattern of disulphide bridging as the WT ShK polypeptide (ie Cys3-Cys35, Cys l2-Cys28 and Cys l7-Cys32) or otherwise has three disulphide bridges between cysteine residues at positions corresponding to 3/35, 12/28 and 17/32 of the amino acid sequence shown as SEQ ID NO: 4.
  • the analogue is a polypeptide comprising a variant amino acid sequence of SEQ ID NO: 4 (ie an amino acid sequence that includes one or more minor variation(s) as described above)
  • the analogue shows the same pattern of di sulphide bridging as the WT ShK polypeptide (or otherwise has three di sulphide bridges between cysteine residues at positions corresponding to 3/35, 12/28 and 17/32 of the amino acid sequence shown as SEQ ID NO: 4 notwithstanding the presence of variation(s) within the amino acid sequence).
  • such an analogue also preferably shows two short a-helices in substantially the same configuration as that of the WT ShK polypeptide.
  • the analogue is a polypeptide consisting of the amino acid sequence:
  • EWSSRSCIDTIPKSRCTAFQCKHSM YRLSFCRKTCGTC SEQ ID NO: 10
  • Analogues comprising the N-terminal extension EWSS (SEQ ID NO: 2), including a Trp residue at position -3, provides some advantages as compared to the WT ShK polypeptide which lacks Trp. That is, the Trp residue can be substituted with a tryptophan derivative such as a fluorescent azatryptophan (for example, (4-Aza)Trp or (5-Aza)Trp (Lepthien S et ai, 2008) or the recently developed (2,7-Aza)Trp (Shen JY et al., 2013)), which can be incorporated into the polypeptide using recombinant techniques.
  • An ShK analogue comprising an azatryptophan may be used, for example, as an optical probe for bioassays of polypeptide delivery or to investigate Kvl.3 channel distribution in neuronal or cancer tissues.
  • the analogue of the present invention may be produced using synthetic or recombinant techniques well known to those skilled in the art.
  • the analogue is provided in an isolated form.
  • KvT .3 channel blockers are potent inhibitors of the proliferation of T lymphocytes. It is also known that Kvl .3 channel blockers offer considerable promise for the treatment of autoimmune diseases mediated by T EM cells, such as rheumatoid arthritis (RA) and multiple sclerosis (MS), while avoiding possible cardiac- and neuro-toxicity. Moreover, it is recognised by those skilled in the art that an analogue showing Kvl.3 selectivity enables the targeting of disease- associated T cells and class-switched B cells without compromising other immune cells subsets; thereby avoiding generalised immunosuppression (which can lead to severe infections or malignancies).
  • RA rheumatoid arthritis
  • MS multiple sclerosis
  • the analogue of the present invention may be suitable for the development of a therapeutic method for the treatment of autoimmune diseases and/or inhibiting T lymphocyte or class-switched B cell proliferation.
  • the present invention provides a method of inhibiting T lymphocyte or class-switched B cell proliferation in a subject, said method comprising administering to the subject an effective amount of the analogue of the first aspect, optionally in combination with a pharmaceutically acceptable carrier.
  • the present invention provides a method of treating an autoimmune disease in a subject, said method comprising administering to the subject an effective amount of the analogue of the first aspect, optionally in combination with a pharmaceutically acceptable carrier.
  • the autoimmune disease to be treated in accordance with the method of the third aspect is preferably an autoimmune disease mediated by T E cells.
  • diseases include RA, asthma, MS, TIDM and psoriasis.
  • Other autoimmune diseases that may be treated in accordance with the method of the third aspect include ulcerative colitis (Koch Hansen L et ai, 2014).
  • the subject to be treated will typically be a human.
  • the invention is also applicable to non-human subjects such as, for example, livestock (eg cattle, sheep and horses), exotic animals (eg tigers, lions, elephants and the like) and companion animals (such as dogs and cats).
  • the analogue is preferably administered, adapted and/or formulated in a manner or medicament ensuring that, upon administration to the subject, an effective amount of said analogue is delivered to the subject.
  • the analogue may be, for example, formulated into any suitable medicament; such as a pharmaceutical composition for oral, buccal, nasal, subcutaneous, intramuscular, inhalative and intravenous administration.
  • a pharmaceutical composition will be administered to the subject in an amount which is effective to achieve a therapeutic effect, and may therefore provide between about 0.01 and about 100 ⁇ g/kg body weight per day of the analogue, and more preferably, provide from 0.05 and 25 ⁇ g/kg body weight per day of the analogue.
  • a suitable pharmaceutical composition may be intended for single daily administration, multiple daily administration, or controlled or sustained release, as needed to achieve the most effective result.
  • the administered amount of the analogue, and the frequency of administration for any particular subject may vary and depend upon a variety of factors including the activity of the analogue, the metabolic stability and length of action of the analogue, the age, body weight, sex, mode and time of administration, rate of excretion of the analogue, and the severity of the autoimmune disease to be treated.
  • a suitable pharmaceutical composition may be formulated for inhalative administration (such as in the form of an aerosol), oral administration (such as in the form of a tablet, capsule, granules or powders), nasal administration (eg such as in the form of a spray or inhalable powder) or parenteral administration (such as by subcutaneous, intravenous or intramuscular injection or infusion).
  • inhalative administration such as in the form of an aerosol
  • oral administration such as in the form of a tablet, capsule, granules or powders
  • nasal administration eg such as in the form of a spray or inhalable powder
  • parenteral administration such as by subcutaneous, intravenous or intramuscular injection or infusion.
  • the present invention provides the use of the analogue of the first aspect in the preparation of a medicament for treating an autoimmune disease, preferably an autoimmune disease mediated by T FM cells such as RA and MS.
  • the analogue of the present invention may be produced using recombinant techniques well known to those skilled in the art. Accordingly, in a further aspect of the present invention, the invention provides a polynucleotide molecule (preferably, in an isolated form) comprising a nucleotide sequence encoding the analogue of the first aspect and, preferably, one comprising or consisting of the amino acid sequence shown as SEQ ID NO: 10. In a still further aspect, the present invention provides a cloning or expression vector comprising such a polynucleotide molecule.
  • the present invention provides a host cell (eg a prokaryotic or eukaryotic cell) including the polynucleotide molecule or cloning or expression vector, wherein said host cell is capable, for example, of expressing the analogue in culture.
  • a host cell eg a prokaryotic or eukaryotic cell
  • said host cell is capable, for example, of expressing the analogue in culture.
  • the analogue of the present invention may be suitable for the development of a therapeutic method for the treatment of diseases other than autoimmune diseases and other conditions, for example obesity (Tucker K et al., 2008; and Xu J et al., 2003), type-2 diabetes mellitus (T2DM) (Xu J et al., 2004), bone resorption in periodontal disease (Valverde P et al., 2005) and cancers (eg solid tumours, leukaemia and lymphomas) (Leanza L et al., 2015). It is to be understood that such uses of the Sh analogues are included within the scope of the present invention.
  • diseases other than autoimmune diseases and other conditions for example obesity (Tucker K et al., 2008; and Xu J et al., 2003), type-2 diabetes mellitus (T2DM) (Xu J et al., 2004), bone resorption in periodontal disease (Valverde P et al., 2005) and cancers
  • an ShK analogue of the present invention may be adapted for delivery to the cytoplasm of a cell where it may act to block KvT .3 channels of the mitochondria (mitoKvT .3). This may be achieved by adding a cell-penetrating peptide (CPP) to the amino acid sequence of the ShK analogue (preferably at the C- terminal) or to the N-terminal extension (ie a of formula I may comprise a CPP).
  • CPP cell-penetrating peptide
  • SMoCs small molecule earners; Okuyama M et al., 2007
  • attachment of a CPP to the ShK analogue using "click chemistry” eg using any of the methods described by Sharpless KB and R Manetsch, 2006, Kolb HC et al., 2001 , and Tornoe CW et al., 2002
  • non-covalent attachment of a CPP to the ShK analogue eg using the method described in Morris MC et al., 2001 involving the CPP known as Pep-1 ).
  • the ShK analogue may be formulated for delivery to the cytoplasm of a cell; for example, the ShK analogue may be formulated as a liposomal preparation (especially a preparation comprising pH-sensitive liposomes for "endosomal escape”; Torchilin VP et al, 1993).
  • the present invention is hereinafter further described by way of the following non-limiting example and accompanying figures.
  • the complex was embedded into a membrane consisting only of phosphtidyl-ethanolamine extending ⁇ 15 A beyond the solute in the membrane plane, and with water extending ⁇ 1()A beyond the solute perpendicular to the membrane. Boundary conditions were set to periodic. Residues were ionised according to their expected state at pH 7.4. Sodium and chloride ions replaced water molecules to effect a final ionic concentration of 0.9 %. Further MD simulations were performed with [GEWSSJShK and [SEWSSJShK.
  • Standard AMBER03 force field parameters (Duan Y et al., 2003) were applied using a cut-off of 7.86A for all non-bonded interactions, while long-range Coulomb interactions were calculated using the Particle-Mesh-Ewald algorithm. No restraints were applied, which required the use of a short time-step of 1.25 fs for intramolecular forces and 2.5 fs for intermolecular forces. All simulations were performed at a temperature of 298 K and maintained at a total pressure of 1 bar. An initial restrained equilibration simulation lasting 250 ps was applied to permit lipid to pack around the solute without solvent interference. This was followed by 1.0 ns of unrestrained MD simulation.
  • the resin was divided into equal portions and the N-terminal extensions of ESSS (SEQ ID NO: 1 ) or EESS (SEQ ID NO: 5) were added to two separate aliquots.
  • ESSS SEQ ID NO: 1
  • EESS EESS
  • the polypeptide was cleaved from the solid support and simultaneously deprotected using Reagent for 2 hours at room temperature (RT).
  • the crude polypeptide was precipitated into ice-cold diethyl ether and washed thoroughly to remove cationic scavengers from the cleavage cocktail, dissolved in 50% aqueous acetic acid, diluted in water and then pH adjusted to 8.0 with NH 4 OH.
  • Disulphide bond formation was facilitated with reduced and oxidised glutathione according to previously used protocols for ShK (Rauer H et al., 1999).
  • the progress of folding was followed by RP- HPLC using a Phenomenex Luna C I 8 column (Phenomenex Inc., Torrance, CA, United States of America) using a gradient of acetonitrile versus H 2 0 containing 0.05 % TFA from 10-70% over 35 min. Folding of the three disulphide bonds was also confirmed by the loss of 6 mass units from the crude material as determined by ESI-MS.
  • [EWSSJShK - [EWSSJShK was expressed and purified as described previously (Chang SC et al., 2012). Briefly, [EWSSJShK was expressed as a thioredoxin fusion protein that forms inclusion bodies in BL21 (DE3) E. coli cells. These were solubilised and refolded in vitro, cleaved with enterokinase and purified to homogeneity by RP-HPLC followed by lyophilisation.
  • Electrophysiological analysis - Cells were studied using the whole-cell configuration of a standard patch-clamp technique at RT.
  • the bath solution contained (in mM): 160 NaCl, 4.5 KC1, 2 CaCl 2 , 1 MgCl 2 , 10 HEPES, pH 7.2, 300 mOsm.
  • Patch pipettes were filled with a solution containing (in mM): 145 KF, 10 HEPES, 10 EGTA, and 2 MgCl 2 , pH 7.2, 290 mOsm, and had a resistance of 2-4 ⁇ .
  • Kv currents were elicited by repeated 200 ms depolarising pulses from a holding potential of -80 mV to 40 mV, applied every 30 seconds.
  • the Port-a-Patch patch clamp system (Nanion Technologies GmbH, Kunststoff, Germany) and NPC-1 chips with 2-3.5 ⁇ resistance were also utilised in conjunction.
  • IC 50 values of Kv blockers were calculated by fitting the Hill equation to the reduction of peak current measured at 40 mV.
  • Trp substituted at position -3 was, however, predicted to bind more tightly with the side chain of Pro than Ala independent of its environment. Importantly, Trp was predicted to best discriminate between Pro and Ala (ie exhibits the largest binding energy difference of all of the 20 canonical protein amino acids), and should thus best discriminate between Kvl .3 and Kvl . 1.
  • EWSSJShK High-resolution electrospray ionisation time-of- flight mass spectrometry (ESI-TOF) analysis of
  • EWSSJShK produced an average mass of 4544 Da; this value was identical to the theoretical mass of 4544 Da for the [EWSSJShK analogue with all six cysteines engaged in the three native disulphide bonds (Pohl J et ai, 1995).
  • the yield of [EWSS ]ShK was ⁇ 2 mg/L.
  • Well established whole-cell patch clamp electrophysiology assays were conducted to determine the potency and selectivity of the [ESSSJShK, [EESS]ShK and [EWSSJShK analogues on Kvl .3 an Kv 1. 1 channels ( Figure 3 A).
  • [ESSSJShK inhibited Kvl .3 with an IC 50 of 657 ⁇ 79 pM, and showed lower affinity towards KvT .1 with an IC 50 of 1327 ⁇ 386 pM, making it two-fold selective for KvT .3 over Kvl . l .
  • ShK was found to have 1.6-fold higher affinity for Kv .3 than Kvl .1 as compared to [ESSS
  • both analogues have reduced affinity to K channels and show a relatively low level of selectivity for Kvl .3 over Kv . 1.
  • Novel ShK analogues with N-terminal extensions consisting only of canonical amino acids were investigated. A number of these analogues showed selectivity for Kvl .3 channels over Kv l . 1 channels, most notably an analogue with an EWSS (SEQ ID NO:2) tetrapeptide extension of the N-terminal. This [EWSSJShK analogue showed only weak inhibition of Kvl.1 but maintained high potency against Kvl.3 channels (IC 50 33 ⁇ 7 pM).
  • the EWSS (SEQ ID NO: 2) tetrapeptide extension can mimic the interactions with Kvl .3 channels predicted for the phosphono moiety and hydrophilic linker in the analogue ShK-192.
  • the tetrapeptide extension is also not susceptible to hydrolysis by phosphatases.
  • the ShK analogues according to the present invention can be produced either using synthetic or recombinant techniques well known to those skilled in the art. They offer significant potential as the basis of therapeutic agents for the treatment of autoimmune diseases while avoiding generalised immunosuppression and possible cardiac- and neuro-toxicity through inhibition of off-target channels, particularly Kvl .1 channels.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Genetics & Genomics (AREA)
  • Zoology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Immunology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Molecular Biology (AREA)
  • Toxicology (AREA)
  • Tropical Medicine & Parasitology (AREA)
  • Biomedical Technology (AREA)
  • Biotechnology (AREA)
  • Wood Science & Technology (AREA)
  • General Engineering & Computer Science (AREA)
  • Epidemiology (AREA)
  • Physics & Mathematics (AREA)
  • Microbiology (AREA)
  • Plant Pathology (AREA)
  • Hematology (AREA)
  • Neurosurgery (AREA)
  • Transplantation (AREA)
  • Neurology (AREA)
  • Oncology (AREA)
  • Rheumatology (AREA)
  • Pain & Pain Management (AREA)
PCT/AU2015/000487 2014-08-15 2015-08-14 Novel potassium channel blockers and use thereof in the treatment of autoimmune diseases Ceased WO2016023072A1 (en)

Priority Applications (4)

Application Number Priority Date Filing Date Title
EP15832619.9A EP3180365B1 (en) 2014-08-15 2015-08-14 Novel potassium channel blockers and use thereof in the treatment of autoimmune diseases
AU2015303825A AU2015303825B2 (en) 2014-08-15 2015-08-14 Novel potassium channel blockers and use thereof in the treatment of autoimmune diseases
US15/503,841 US10246496B2 (en) 2014-08-15 2015-08-14 Potassium channel blockers and use thereof in the treatment of autoimmune diseases
JP2017508102A JP6847828B2 (ja) 2014-08-15 2015-08-14 新規なカリウムチャネルブロッカー及び自己免疫疾患の治療におけるそれらの使用

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
AU2014903189 2014-08-15
AU2014903189A AU2014903189A0 (en) 2014-08-15 Novel potassium channel blockers

Publications (1)

Publication Number Publication Date
WO2016023072A1 true WO2016023072A1 (en) 2016-02-18

Family

ID=55303691

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/AU2015/000487 Ceased WO2016023072A1 (en) 2014-08-15 2015-08-14 Novel potassium channel blockers and use thereof in the treatment of autoimmune diseases

Country Status (5)

Country Link
US (1) US10246496B2 (enExample)
EP (1) EP3180365B1 (enExample)
JP (2) JP6847828B2 (enExample)
AU (1) AU2015303825B2 (enExample)
WO (1) WO2016023072A1 (enExample)

Families Citing this family (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP3180365B1 (en) * 2014-08-15 2021-08-18 Monash University Novel potassium channel blockers and use thereof in the treatment of autoimmune diseases
KR102533290B1 (ko) * 2022-04-14 2023-05-16 한국해양과학기술원 전압개폐 칼륨이온채널 억제 활성능을 갖는 펩타이드
KR102553070B1 (ko) * 2022-06-16 2023-07-07 한국해양과학기술원 전압개폐 칼륨이온채널 억제 활성능을 갖는 작은상자해파리 기원 펩타이드

Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2006042151A2 (en) * 2004-10-07 2006-04-20 The Regents Of The University Of California Analogs of shk toxin and their uses in selective inhibition of kv1.3 potassium channels
WO2010108154A2 (en) * 2009-03-20 2010-09-23 Amgen Inc. Selective and potent peptide inhibitors of kv1.3
US7820623B2 (en) * 2006-10-25 2010-10-26 Amgen Inc. Conjugated toxin peptide therapeutic agents

Family Cites Families (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
ATE537185T1 (de) * 2007-05-14 2011-12-15 Univ Mexico Nacional Autonoma Vm23 und vm24, zwei skorpionpeptide, die humane t-lymphozyten-kaliumkanäle (untertyp kv1.3) mit hoher selektivität blockieren
CA2838474A1 (en) * 2011-06-06 2012-12-13 Kineta One, Llc Shk-based pharmaceutical compositions and methods of manufacturing and using the same
CN104937105A (zh) * 2013-01-25 2015-09-23 詹森生物科技公司 Kv1.3拮抗剂及其使用方法
EP3180365B1 (en) * 2014-08-15 2021-08-18 Monash University Novel potassium channel blockers and use thereof in the treatment of autoimmune diseases

Patent Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2006042151A2 (en) * 2004-10-07 2006-04-20 The Regents Of The University Of California Analogs of shk toxin and their uses in selective inhibition of kv1.3 potassium channels
US7820623B2 (en) * 2006-10-25 2010-10-26 Amgen Inc. Conjugated toxin peptide therapeutic agents
WO2010108154A2 (en) * 2009-03-20 2010-09-23 Amgen Inc. Selective and potent peptide inhibitors of kv1.3

Non-Patent Citations (3)

* Cited by examiner, † Cited by third party
Title
PENNINGTON ET AL.: "A C-terminally amidated analogue of ShK is a potent and selective blocker of the voltage-gated potassium channel Kvl.3", FEBS LETTERS, vol. 586, no. 22, 2012, pages 3996 - 4001, XP055406323 *
RASHID ET AL.: "A potent and selective peptide blocker of the Kvl. 3 channel: prediction from free-energy simulations and experimental confirmation", PLOS ONE, vol. 8, no. Issue 11, 2013, pages 1 - 10, XP055406324 *
See also references of EP3180365A4 *

Also Published As

Publication number Publication date
US10246496B2 (en) 2019-04-02
JP6847828B2 (ja) 2021-03-24
JP2017525357A (ja) 2017-09-07
US20170362286A1 (en) 2017-12-21
AU2015303825B2 (en) 2021-01-14
JP6953579B2 (ja) 2021-10-27
EP3180365B1 (en) 2021-08-18
JP2020127419A (ja) 2020-08-27
EP3180365A4 (en) 2018-01-17
AU2015303825A1 (en) 2017-03-23
EP3180365A1 (en) 2017-06-21

Similar Documents

Publication Publication Date Title
DK2320927T3 (en) Modified peptides as potent inhibitors of the PSD-95 / NMDA receptor interaction
EP3215172B1 (en) Modifications and uses of conotoxin peptides
EP3395358A1 (en) Insulin analog dimers
NO334230B1 (no) Peptid eller peptidmimetukum og anvendelse derav
JP6953579B2 (ja) 新規なカリウムチャネルブロッカー及び自己免疫疾患の治療におけるそれらの使用
US20230414702A1 (en) Compounds and pharmaceutical use thereof in the treatment of cancer
US20220106367A1 (en) Preparation and use of ginsentides and ginsentide-like peptides
JP2022545916A (ja) コンプスタチン類似体及びその医学的使用
CN107849109A (zh) Il‑37变体
WO2009021289A1 (en) Potassium channel inhibitors
US20230090247A1 (en) Molecules targeting ras protein
AU2016295423B2 (en) Neuroprotective agents derived from spider venom peptides
Pathak et al. Review on peptidomimetics: a drug designing tool
US20230391838A1 (en) Conformationally-Constrained Alpha-RGIA Analogues
US20200071357A1 (en) Antimicrobial peptides
EP2352525A1 (en) Somatostatin analogues

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 15832619

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2017508102

Country of ref document: JP

Kind code of ref document: A

REEP Request for entry into the european phase

Ref document number: 2015832619

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 2015832619

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 15503841

Country of ref document: US

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2015303825

Country of ref document: AU

Date of ref document: 20150814

Kind code of ref document: A