WO2015178689A1 - 상피세포 성장인자 수용체의 세포외 도메인과 결합하는 신규 폴리펩타이드 - Google Patents

상피세포 성장인자 수용체의 세포외 도메인과 결합하는 신규 폴리펩타이드 Download PDF

Info

Publication number
WO2015178689A1
WO2015178689A1 PCT/KR2015/005079 KR2015005079W WO2015178689A1 WO 2015178689 A1 WO2015178689 A1 WO 2015178689A1 KR 2015005079 W KR2015005079 W KR 2015005079W WO 2015178689 A1 WO2015178689 A1 WO 2015178689A1
Authority
WO
WIPO (PCT)
Prior art keywords
polypeptide
protein
growth factor
extracellular domain
epidermal growth
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/KR2015/005079
Other languages
English (en)
French (fr)
Inventor
김학성
이중재
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Korea Advanced Institute of Science and Technology KAIST
Original Assignee
Korea Advanced Institute of Science and Technology KAIST
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Korea Advanced Institute of Science and Technology KAIST filed Critical Korea Advanced Institute of Science and Technology KAIST
Priority to US15/310,585 priority Critical patent/US10364293B2/en
Publication of WO2015178689A1 publication Critical patent/WO2015178689A1/ko
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Images

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/195Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/461Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from fish
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/71Receptors; Cell surface antigens; Cell surface determinants for growth factors; for growth regulators
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K19/00Hybrid peptides, i.e. peptides covalently bound to nucleic acids, or non-covalently bound protein-protein complexes
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/11DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • C12N15/62DNA sequences coding for fusion proteins
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12PFERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
    • C12P21/00Preparation of peptides or proteins
    • C12P21/02Preparation of peptides or proteins having a known sequence of two or more amino acids, e.g. glutathione
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2318/00Antibody mimetics or scaffolds
    • C07K2318/20Antigen-binding scaffold molecules wherein the scaffold is not an immunoglobulin variable region or antibody mimetics
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/35Fusion polypeptide containing a fusion for enhanced stability/folding during expression, e.g. fusions with chaperones or thioredoxin
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/70Fusion polypeptide containing domain for protein-protein interaction

Definitions

  • the present invention relates to a novel polypeptide that binds to the extracellular domain of the epidermal growth factor receptor, and more particularly, to a polypeptide capable of binding to the extracellular domain of the epidermal growth factor receptor and inhibiting its activity.
  • the present invention relates to a method for producing a polypeptide using a recombinant microorganism into which a polynucleotide encoding a peptide and an expression vector including the polynucleotide are introduced.
  • Antibody therapies have been shown to be effective in treating various diseases and lower side effects compared to chemicals, making them the target of research for global pharmaceutical and biotechnology companies. have.
  • antibody therapeutics have recently been developed due to problems such as low tissue penetration due to large molecular weight, high product cost due to complex production processes, and entry barriers due to existing patents. This is actively going on. Unlike the antibody therapeutics, these phosphorus-antibody skeletal proteins have been found to be greatly improved in the efficiency of penetration into cancer tissues, and as a result, many studies have shown that the therapeutic effect can be improved.
  • Lipibodies are one-fifth the size of antibodies and are mass produced in Escherichia coli and show little immunogenicity in animal experiments. It has been proved that the thermal and pH stability is very good, the binding force to the target can be easily increased to the pico-mole level, and the specificity to the target is very excellent (KR2013-0098089A).
  • EGFR Epidermal Growth Factor Receptor
  • the present inventors have successfully produced specific protein binders for various disease-related target proteins using the lipid body scaffold, and verified that there is a biological inhibitory effect by a cell-based method, but the application thereof Research is still in its infancy and needs further research. In addition, the discovery of leading substances that bind to various receptors overexpressed in cancer cells and the application thereof has not been reported so far.
  • the present invention was completed by selecting a novel protein having specific binding ability to the epidermal growth factor receptor based on a random mutation library, and confirming that binding ability can be improved through a repeat module-based affinity-enhancing method.
  • Another object of the present invention is to provide an expression vector comprising the polynucleotide and the polynucleotide encoding the polypeptide.
  • Still another object of the present invention is to provide a recombinant microorganism into which the expression vector is introduced and a method for producing a polypeptide using the recombinant microorganism.
  • the present invention provides a polypeptide comprising the amino acid sequence of any one of SEQ ID NO: 6 to 8, which can effectively bind to the epidermal growth factor receptor and inhibit its activity do.
  • the present invention also provides a polynucleotide encoding the polypeptide and a recombinant vector comprising the polynucleotide.
  • the present invention also provides a recombinant microorganism containing the polynucleotide or the recombinant vector.
  • the present invention also provides a method for producing a polypeptide comprising culturing the recombinant microorganism to produce the polypeptide and recovering the polypeptide from the cultured recombinant microorganism or culture.
  • FIG. 1 shows the results of biopanning phage display of an extracellular domain of EGFR using a phage library constructed in the prior patent (KR2013-0098089A).
  • the binding signal by ELISA to the extracellular domain of EGFR relative to BSA was normalized, whereby it was defined as a lipid body clone having a specific binding capacity to a clone with an increased signal of three or more times.
  • FIG. 2 groups the clones with the specific binding capacity obtained in FIG. 1 based on the changed amino acids.
  • the position of each amino acid is located in the concave portion of the Lipibody, which is the result of constructing and screening libraries for the third and fourth modules.
  • 3 is an ELISA result confirming the specific binding to the extracellular domain of EGFR.
  • the specific binding to the extracellular domain of EGFR is not bound to BSA.
  • Figure 4 is to determine whether the binding decrease in proportion to the concentration of the extracellular domain of the water-soluble EGFR to confirm the approximate binding affinity of the lipid body. At this time, the concentration of the extracellular domain of EGFR where the ELISA signal is reduced by 50% was defined as the dissociation constant.
  • the fifth module was used to build a binding force increase library.
  • the green module indicates the position where the existing library is built and the red module indicates the corresponding position of the newly built library.
  • Figure 6 is a result of confirming the relative binding force through the inhibition of the binding signal to EGFR while putting each Lipibody clone as a competitor to the binding ability inhibition of phage expressed on the surface rA11 ELISA. Inhibition of the binding to the extracellular domain of EGFR at lower concentrations was defined as a clone that binds to the extracellular domain of EGFR with a stronger binding force.
  • Figure 7 is a module selected to increase the third binding force in this case the sixth module was used to build a binding force increase library.
  • the second module was used to build a binding force increase library.
  • FIG. 9 is an ELISA experiment result confirming the relative binding force of rEgH9, which is the final lipid body clone, similar to FIG. 6.
  • the library may be in the form of a phagemid containing the polynucleotide.
  • phagemid refers to a circular polynucleotide molecule derived from phage, which is an E. coli-based virus, and includes sequences of proteins and surface proteins necessary for propagation and propagation.
  • Recombinant phagemids can be prepared using genetic recombination techniques well known in the art, and site-specific DNA cleavage and ligation can be performed using enzymes or the like generally known in the art.
  • the phagemid may include a signal sequence or leader sequence for secretion in addition to expression control elements such as a promoter, an operator, an initiation codon, a termination codon, an enhancer, and mainly fused a desired protein with the surface protein of the phage to label the phage surface. It can be used for the method.
  • the promoter of phagemid is mainly inducible and may include a selectable marker for selecting host cells.
  • the phagemid comprises a signal sequence or leader sequence MalEss, DsbAss or PelBss for expression and secretion of the polynucleotides constituting the library, and histidine- to confirm the expression of the recombinant protein on the phage surface.
  • It may be a polynucleotide of SEQ ID NO: 2 of the prior patent (KR2013-0098089A) including a tag and a polynucleotide encoding a gp3 domain, which is a kind of surface protein of M13 phage for phage surface expression, but is not particularly limited thereto. .
  • the present inventors screened a novel polypeptide (SEQ ID NOS: 1 to 5) in the form of a lipid body having excellent binding to the extracellular domain of EGFR using the phage display method using the library containing the phagemid (Figs. 1 to 2). ).
  • these selected polypeptides have a lower level of binding to the extracellular domain of EGFR than epidermal growth factor (EGF) in nature (FIG. 3), so that the selected polypeptides are mutated to add extracellular EGFR. It was intended to produce a variant polypeptide with improved binding to the domain.
  • a second library was constructed by mutating four amino acid residues located in the fifth module of the polypeptide of SEQ ID NO: 2 identified as binding to the third domain of the extracellular domain of EGFR among the selected polypeptides.
  • a second screen was used to select a novel polypeptide (SEQ ID NO: 6) having increased binding to the extracellular domain of EGFR using the phage display method using the second library (FIG. 5).
  • a third library was constructed by mutating the other module in the same manner based on the selected clone polypeptide of SEQ ID NO: 6 (FIG. 6), and the phage display method from the third library was used to obtain EGFR.
  • a new polypeptide (SEQ ID NO: 7) of the lipidi form with further increased binding to the extracellular domain was selected 3rd.
  • the third selected polypeptide was mutated in the same manner (FIG. 7) to construct a fourth library from which a new polypeptide in the form of a repeat body having a binding capacity of pM (SEQ ID NO: 8) was obtained. Finally screened.
  • the present invention relates to a polypeptide comprising an amino acid sequence of any one of SEQ ID NOs: 6-8.
  • the term "internal B protein” is a type of LRR family protein expressed in Listeria strains, and has an N-terminal structure different from other LRR family proteins in which other hydrophobic cores are uniformly distributed throughout the molecule. It is known to have a stable expression in microorganisms.
  • the N-terminus of these internalin proteins is stable in the microorganisms because the N-terminus, which is the most important for the folding of the repeat module, is not only derived from the microorganism but also has a stable shape in which its shape includes an alpha helix. Can be used effectively.
  • N-terminus of an internalin protein refers to the N-terminus of an internalin protein necessary for water-soluble expression and folding of the protein, and refers to an alpha helical capping motif and a repeat module of an internalin protein. it means.
  • the N-terminus of the internalin protein includes, without limitation, the N-terminus of the internalin protein necessary for water soluble expression and folding of the protein, and may include, for example, the alpha helical capping motif "ETITVSTPIKQIFPDDAFAETIKANLKKKSVTDAVTQNE" and a repeat module.
  • the repeat module pattern may include "LxxLxxLxLxxN".
  • L in the repeating module pattern is alanine, glycine, phenylalanine, tyrosine, leucine, isoleucine, valine or tryptophan; N means asparagine, glutamine, serine, cysteine or threonine, x means any hydrophilic amino acid.
  • the N-terminus of the internalin protein can be selected as the N-terminus having high structural similarity according to the type of LRR family protein that can be fused, and the most stable amino acid can be selected through calculation of binding energy and the like. Variation is possible.
  • epidermal growth factor receptor of the present invention is a transmembrane protein of about 170 KDa present in the cell membranes of various cells and is known to play an essential role in the growth, proliferation, migration and survival of cells.
  • Cell proliferation signaling activated by the corresponding receptor excessively induces dimerization of EGFR due to overexpression of epidermal growth factor (EGF) in cancer cells, leading to abnormal cell proliferation, which is caused by lung cancer, pancreatic cancer, breast cancer and It is found in a variety of cancers, such as colorectal cancer.
  • the term "Repebody” of the present invention refers to a polypeptide optimized based on the consensus design by fusing on the similarity between the N-terminus and VLR structure of an internalin having an LRR structure.
  • Lipibody proteins can be divided into concave and convex regions in structure (FIG. 4). The concave regions are known for their high degree of sequence diversity and important sites for protein interaction. Convex regions, on the other hand, play a role in keeping the overall structure of the protein stable based on highly conserved sequences.
  • the lipid body protein may include all of the fusion LRR family proteins in which all proteins belonging to the LRR family having a repeat module are improved in water soluble expression and protein biophysical properties by the above method.
  • VLR Variable Lymphocyte Receptor
  • Polypeptides fused with the N-terminus and VLR protein of the internalin B protein have increased water solubility and expression than the VLR protein to which the internalin B protein is not fused, and thus can be used for the preparation of a novel protein therapeutic agent based thereon.
  • LRR protein means a protein composed of a combination of modules in which leucine is repeated at a predetermined position, and (i) has one or more LRR repeating modules, and (ii) the LRR.
  • the repeat module consists of 20 to 30 amino acids, and (iii) the LRR repeat module has "LxxLxxLxLxxN" in a conserved pattern, where L is alanine, glycine, phenylalanine, tyrosine, leucine, isoleucine, valine and tryptophan Hydrophobic amino acids, such as N, asparagine, glutamine, serine, cysteine or threonine, x means any amino acid, (iv) LRR family protein means a protein having a three-dimensional structure, such as horseshoe.
  • the LRR family protein of the present invention is a repeat module having a sequence known in nature or having a sequence unknown in nature through the design of a consensus design, etc., as well as found using a newly induced mRNA or cDNA in vivo. It may include all variants having a skeletal structure of.
  • the present invention is a polynucleotide encoding the polypeptide; It relates to a recombinant vector and a recombinant microorganism comprising the polynucleotide.
  • the term "vector” refers to a DNA preparation containing a polynucleotide sequence encoding the target protein operably linked to a suitable regulatory sequence to enable expression of the target protein in a suitable host.
  • the regulatory sequence includes a promoter capable of initiating transcription, any operator sequence for regulating such transcription, a sequence encoding a suitable mRNA ribosomal binding site, and sequences that control the termination of transcription and translation.
  • the vector used in the present invention is not particularly limited as long as it can be replicated in a host cell, and any vector known in the art may be used.
  • Examples of commonly used vectors include natural or recombinant plasmids, phagemids, cosmids, viruses and bacteriophages.
  • pWE15, M13, MBL3, MBL4, IXII, ASHII, APII, t10, t11, Charon4A, Charon21A, etc. can be used as a phage vector or cosmid vector, and pBR-based, pUC-based, pBluescriptII-based, etc.
  • pGEM-based, pTZ-based, pCL-based and pET-based and the like can be used.
  • the vector usable in the present invention is not particularly limited and known expression vectors can be used.
  • pACYC177, pACYC184, pCL, pECCG117, pUC19, pBR322, pMW118, pCC1BAC, pET-21a, pET-32a vector and the like can be used.
  • pET-21a and pET-32a vectors can be used.
  • the term "recombinant microorganism” refers to a cell in which a vector having a gene encoding at least one target protein is transfected into a host cell to express the target protein, and all cells such as eukaryotic cells and prokaryotic cells. It may be, but is not particularly limited to bacterial cells such as E. coli, Streptomyces, Salmonella typhimurium; Yeast cells; Fungal cells such as Peach Apastoris; Insect cells such as Drozophila and Spodoptera Sf9 cells; Animal cells such as CHO, COS, NSO, 293, bow melanoma cells; Or plant cells.
  • the host cell usable in the present invention is not particularly limited, and Escherichia coli may be preferably used as the host cell. Most preferably, E. coli BL21 (DE3), OrigamiB (DE3) can be used as a host cell.
  • the term “transformation” means introducing a vector containing a polynucleotide encoding a target protein into a host cell so that the protein encoded by the polynucleotide can be expressed in the host cell.
  • Transformed polynucleotides include all of them, whether they can be expressed in a host cell, whether they are inserted into or located outside the chromosome of the host cell.
  • the polynucleotide also includes DNA and RNA encoding the target protein.
  • the polynucleotide may be introduced in any form as long as it can be expressed by being introduced into a host cell.
  • the polynucleotide may be introduced into a host cell in the form of an expression cassette, which is a gene construct containing all elements necessary for self expression.
  • the expression cassette typically includes a promoter, transcription termination signal, ribosomal binding site and translation termination signal operably linked to the polynucleotide.
  • the expression cassette may be in the form of an expression vector capable of self replication.
  • the polynucleotide may be introduced into the host cell in its own form and operably linked to a sequence required for expression.
  • the present invention comprises the steps of (i) culturing the recombinant microorganism to obtain a culture; And (ii) recovering said polypeptide from said cultured recombinant microorganism or culture.
  • the step of culturing the recombinant microorganism is not particularly limited thereto, but is preferably performed by a known batch culture method, continuous culture method, fed-batch culture method, and the like, and the culture conditions are not particularly limited thereto.
  • a basic compound e.g. sodium hydroxide, potassium hydroxide or ammonia
  • an acidic compound e.g. phosphoric acid or sulfuric acid
  • the appropriate pH pH 5-9, preferably pH 6-8, most preferably pH 6.8
  • introducing an oxygen or oxygen-containing gas mixture into the culture to maintain aerobic conditions incubation temperature 20 to 45, preferably 25 to 40, incubated for about 10 to 160 hours desirable.
  • the polypeptide produced by the culture may be secreted into the medium or remain in the cell.
  • the culture medium used may include sugars and carbohydrates (e.g. glucose, sucrose, lactose, fructose, maltose, molasses, starch and cellulose), fats and fats (e.g. soybean oil, sunflower seeds) as carbon sources.
  • sugars and carbohydrates e.g. glucose, sucrose, lactose, fructose, maltose, molasses, starch and cellulose
  • fats and fats e.g. soybean oil, sunflower seeds
  • Oils, peanut oils and coconut oils fatty acids (e.g. palmitic acid, stearic acid and linoleic acid), alcohols (e.g. glycerol and ethanol) and organic acids (e.g. acetic acid), etc.
  • Nitrogen sources include nitrogen-containing organic compounds such as peptone, yeast extract, gravy, malt extract, corn steep liquor, soybean meal and urea, or inorganic compounds such as ammonium sulfate, ammonium chloride, ammonium phosphate, ammonium carbonate and Ammonium nitrate) and the like can be used individually or in combination;
  • As a source of phosphorus, potassium dihydrogen phosphate, dipotassium hydrogen phosphate, a corresponding sodium-containing salt, and the like can be used individually or in combination;
  • Other metal salts such as magnesium sulfate or iron sulfate, and essential growth-promoting substances such as amino acids and vitamins.
  • Polypeptide recovery method produced in the culture step of the present invention can collect the desired polypeptide from the culture medium using a suitable method known in the art according to the culture method, for example, batch, continuous or fed-batch culture method. have.
  • the present invention relates to a composition for preventing or treating cancer comprising the polypeptide.
  • cancer refers to a lump grown abnormally by autonomous overgrowth of body tissue.
  • Epithelial growth factor receptor is a growth factor that induces the growth of tumors.
  • the cancer or tumor in the present invention is colon cancer, non-small cell lung cancer, ovarian cancer, multiple myeloma, in which the epidermal growth factor receptor is excessively secreted, This means including Castleman's disease and liver cancer.
  • treatment in the present invention means not only inhibiting or alleviating cancer or one or more symptoms caused by administration of the composition, but also preventing the treatment of cancer or the progression of the cancer to reverse the symptoms of the disease.
  • prevention refers to any action that inhibits or delays the onset of cancer by administration of the composition.
  • the prevention or treatment of cancer is made by binding the polypeptide obtained in the present invention to the epidermal growth factor receptor, binds to the extracellular domain of the epidermal growth factor receptor and significantly inhibits its activity to prevent cancer. Prevent or cure.
  • Cancer preventive or therapeutic composition comprising the polypeptide of the present invention may further comprise a pharmaceutically acceptable carrier, it may be formulated with a carrier.
  • the term "pharmaceutically acceptable carrier” refers to a carrier or diluent that does not irritate an organism and does not inhibit the biological activity and properties of the administered compound.
  • Acceptable pharmaceutical carriers in compositions formulated as liquid solutions are sterile and physiologically compatible, including saline, sterile water, Ringer's solution, buffered saline, albumin injectable solutions, dextrose solution, maltodextrin solution, glycerol, ethanol and One or more of these components may be mixed and used, and other conventional additives such as antioxidants, buffers and bacteriostatic agents may be added as necessary.
  • Diluents, dispersants, surfactants, binders and lubricants may also be added in addition to formulate into injectable formulations, pills, capsules, granules or tablets such as aqueous solutions, suspensions, emulsions and the like.
  • Cancer preventive or therapeutic composition comprising the polypeptide of the present invention and a pharmaceutically acceptable carrier is applicable to any formulation comprising it as an active ingredient, it can be prepared in oral or parenteral formulations.
  • Pharmaceutical formulations of the invention may be oral, rectal, nasal, topical (including the cheek and sublingual), subcutaneous, vaginal or parenteral (intramuscular, subcutaneous). And forms suitable for administration by inhalation or insufflation.
  • Oral dosage forms containing the composition of the present invention as an active ingredient include, for example, tablets, troches, lozenges, water-soluble or oily suspensions, preparation powders or granules, emulsions, hard or soft capsules, syrups or elixirs. can do.
  • lactose For formulation into tablets and capsules, lactose, saccharose, sorbitol, mannitol, starch, amylopectin, binders such as cellulose or gelatin, excipients such as dicalcium phosphate, disintegrants such as corn starch or sweet potato starch, stearic acid masne It may include a lubricating oil such as calcium, calcium stearate, sodium stearyl fumarate or polyethylene glycol wax, and in the case of a capsule, it may further contain a liquid carrier such as fatty oil in addition to the above-mentioned materials.
  • a lubricating oil such as calcium, calcium stearate, sodium stearyl fumarate or polyethylene glycol wax
  • a liquid carrier such as fatty oil in addition to the above-mentioned materials.
  • Formulations for parenteral administration comprising the composition of the present invention as an active ingredient, for injection, such as subcutaneous injection, intravenous injection or intramuscular injection, a suppository injection method or aerosol for spraying by inhalation through the respiratory system It can be formulated as.
  • the compositions of the present invention may be mixed in water with stabilizers or buffers to prepare solutions or suspensions, which may be formulated for unit administration of ampoules or vials.
  • solutions or suspensions which may be formulated for unit administration of ampoules or vials.
  • a rectal composition such as suppositories or enemas, including conventional suppository bases such as cocoa butter or other glycerides.
  • a propellant or the like may be combined with the additives to disperse the dispersed dispersion or wet powder.
  • the present invention relates to a method for preventing or treating cancer, comprising administering a composition for preventing or treating cancer comprising the polypeptide.
  • the term "administration" means introducing a pharmaceutical composition of the present invention to a patient in any suitable manner.
  • the route of administration of the composition of the present invention may be administered via various routes orally or parenterally as long as it can reach the target tissue, and specifically, oral, rectal, topical, intravenous, intraperitoneal, intramuscular, intraarterial, It may be administered in a conventional manner via transdermal, nasal, inhaled, intraocular or intradermal routes.
  • the treatment method of the present invention includes administering a composition for preventing or treating cancer of the present invention in a pharmaceutically effective amount.
  • a suitable total daily dose may be determined by the practitioner within the correct medical judgment.
  • the specific therapeutically effective amount for a particular patient may be based on the specific composition, including the type and severity of the reaction to be achieved, whether or not other agents are used in some cases, the age, weight, general health, sex and diet of the patient, time of administration, It is desirable to apply differently depending on the route of administration and the rate of release of the composition, the duration of treatment, and the various factors and similar factors well known in the medical arts, including drugs used with or concurrent with the specific composition. Therefore, the effective amount of the composition for preventing or treating cancer suitable for the purpose of the present invention is preferably determined in consideration of the above-mentioned matters.
  • the treatment method of the present invention is applicable to any animal that can cause diseases such as tumor development and angiogenesis due to excessive secretion of epidermal growth factor receptor, the animal is not only humans and primates, but also cattle, pigs And domestic animals such as sheep, horses, dogs, and cats.
  • the Lipibodi library phage already constructed in Example 2 of the prior patent was used.
  • the phage library has been mutated a total of six amino acid positions, and has a mutation sequence at the same position as FIG. 5 in the prior patent (KR2013-0098089A).
  • Example 1-1 Polypeptide Selection Binding to the Extracellular Domain of EGFR Through the Panning Process of Lipibody Libraries
  • the polypeptide that can bind to the extracellular domain of EGFR was selected and purified.
  • the extracellular domain of EGFR was added to the immunotube (Immuno-tube) at a concentration of 100 / and coated for 4 to 12 hours.
  • the coated immunotubes were washed three times with PBS and blocked at 4 to 2 hours with PBS solution (TPBSA) containing 1% BSA and 0.1% Tween 20.
  • the purified phage was then added to the coated immunotubes at a concentration of 1012 cfu / ml and allowed to react at room temperature for 2 hours.
  • the phage selected through the method of Example 1-1 was subjected to ELISA using an extracellular domain of EGFR and a 96-well plate coated with BSA, so that the absorbance (OD450) of the extracellular domain of EGFR compared to BSA was tripled.
  • Seventeen high-ripebody candidates were selected above (Fig. 1), their respective amino acid sequences were identified, and clones with the same amino acid sequence were grouped. As a result, a total of five polypeptide group sequences were identified in A to E consisting of the same sequence among protein amino acid sequences specifically binding to the extracellular domain of EGFR expressed in the selected phage.
  • amino acid 126 isoleucine is substituted with metaonine, asparagine, proline and asparagine acid
  • threonine amino acid 128 is replaced with histidine
  • leucine, arginine or cysteine and amino acid 129 glycine is tyrosine, serine, or Is substituted with tryptophan
  • amino acid 150 is substituted with tyrosine, serine, metaonine or cysteine
  • amino acid 152 is substituted with serine, histiin, arginine, asparazine or phenylalanine
  • amino acid 153 It was confirmed that glutamic acid was substituted with glutamine, arginine, proline or serine (FIG. 2).
  • EGFR is overexpressed in many cancers, it has been widely reported that mutations in EGFR itself also occur.
  • a monoclonal antibody that targets the extracellular domain of EGFR externally and uses a strategy to treat cancer is a cell of EGFR in which the first and second domains have been removed by mutation for universal use. It should be possible to join other domains. Therefore, many inventors develop and select a polypeptide capable of binding to a third domain mainly to obtain an effective target ability on the extracellular domain of EGFR.
  • the module-based affinity increasing method described in Embodiment 4 of the preceding patent was performed.
  • the method is a universally available technique for proteins with repeat modules, which has been successfully reproduced in this patent to enable the design of proteins with high levels of affinity.
  • Example 2-1 Verifying Additional Library Construction and Increasing Cohesion Using Modules
  • the monoclonal antibodies used for treatment are used in effective targeted therapeutics with a binding force of several nM or hundreds of pM. Therefore, it is expected that the lipid body candidate of the present invention cannot sufficiently inhibit the activity of EGFR.
  • Example 4-2 of the prior patent KR2013-0098089A
  • the first module-based affinity library mutated the fifth module to obtain rAC1 (SEQ ID NO: 6) with increased binding ability through 4 panning cycles, and achieved a relatively low protein concentration compared to rA11 by ELISA. It was confirmed that the binding to the extracellular domain of EGFR of rA11 was inhibited (FIG. 6).
  • the dissociation constant of the lipido rEgH9 clone to the extracellular domain of epithelial cell EGFR was measured. Specifically, using an extracellular domain of lipibodi dissolved in PBS at 0.3 mM (6 mg / ml) and 0.02 mM (1.4 mg / ml) in PBS, an isothermal Titration Calorimetry (ITC) ), The dissociation constant of rEgH9 for the extracellular domain of EGFR at 37 was measured (FIG. 10). 10 is a diagram showing the results of experiments confirming the binding capacity of the polypeptide of the present invention to the extracellular domain of EGFR by an isothermal calorimetry. As shown in Figure 10, it was confirmed that the dissociation constant for the extracellular domain of the EGFR of the final clone rEgH9 can bind very strongly at 301 pM and secured as the final clone.
  • the present inventors have successfully obtained a high level of binding of the lipid body of the various types of monoclonal antibodies used as effective target therapeutics, which is a polypeptide having a specific binding capacity to the extracellular domain of EGFR Secured.
  • the polypeptide of the present invention can bind to the extracellular domain of EGFR and inhibit its activity with high affinity comparable to the monoclonal antibody widely used as a target therapeutic agent, which is useful for the development of an agent for the prevention or treatment of EGFR related diseases. .

Landscapes

  • Chemical & Material Sciences (AREA)
  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • Genetics & Genomics (AREA)
  • Biochemistry (AREA)
  • Molecular Biology (AREA)
  • General Health & Medical Sciences (AREA)
  • Biophysics (AREA)
  • Zoology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Medicinal Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Wood Science & Technology (AREA)
  • Toxicology (AREA)
  • Biomedical Technology (AREA)
  • Immunology (AREA)
  • General Engineering & Computer Science (AREA)
  • Biotechnology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Cell Biology (AREA)
  • Microbiology (AREA)
  • Physics & Mathematics (AREA)
  • Plant Pathology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Peptides Or Proteins (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)

Abstract

본 발명은 상피세포 성장인자의 세포외 도메인과 특이적으로 결합 가능한 폴리펩타이드, 상기 폴리펩타이드를 코딩하는 폴리뉴클레오티드, 상기 폴리뉴클레오티드를 포함하는 발현벡터, 상기 발현벡터가 도입된 재조합 미생물 및 재조합 미생물을 사용하여 상기 폴리펩타이드를 생산하는 방법에 관한 것이다. 본 발명에 따른 폴리펩타이드는 기존에 치료용으로 널리 사용되고 있는 단일클론항체에 버금가는 높은 친화력으로 상피세포 성장인자 수용체에 결합하여 그의 활성을 억제할 수 있고, 상피세포 성장인자 수용체의 과발현과 연관된 다양한 질환의 예방 또는 치료용 제제개발에 유용하다.

Description

상피세포 성장인자 수용체의 세포외 도메인과 결합하는 신규 폴리펩타이드
본 발명은 상피세포 성장인자 수용체의 세포외 도메인과 결합하는 신규 폴리펩타이드에 관한 것으로, 더욱 상세하게는 상피세포 성장인자 수용체의 세포외 도메인과 결합하여 그의 활성을 저해할 수 있는 폴리펩타이드, 상기 폴리펩타이드를 코딩하는 폴리뉴클레오티드, 상기 폴리뉴클레오티드를 포함하는 발현벡터가 도입되어 있는 재조합 미생물를 이용한 상기 폴리펩타이드의 제조방법에 관한 것이다.
항체 치료제는 화학제재와 비교해서 다양한 질병 치료에 높은 효능과 더불어 낮은 부작용을 보여줌으로써 글로벌 제약기업과 생명공학 기업들의 연구목표가 되고 있고 현재 다수의 항체 치료제가 임상에 사용되고 있으며 많은 치료제 후보가 임상실험 중에 있다.
그러나 항체 치료제는 이런 장점에도 불구하고 큰 분자량으로 인한 낮은 조직 침투력, 복잡한 생산 공정으로 인한 높은 제품단가, 그리고 기존의 특허에 의한 진입장벽 등의 문제점으로 인해 최근 항체 치료제를 대체하기 위한 인공항체의 개발이 활발하게 진행되고 있다. 이러한 인공항체 골격 단백질은 항체 치료제와 달리 암 조직 내로 침투되는 효율이 크게 향상되어 결과적으로 치료 효과를 향상 시킬 수 있다는 장점이 많은 연구를 통해 밝혀지고 있다.
이러한 배경 하에, 본 발명자들은 기존의 항체를 대체할 수 있는 비항체 단백질 골격(non-antibody protein scaffold)인 리피바디(repebody)를 성공적으로 개발하였다. 리피바디는 크기가 항체의 1/5 수준이고 대장균에서 대량생산 되며 동물 실험결과 면역원성이 거의 없음을 보여주었다. 열 및 pH 안정성이 매우 우수하고 타겟에 대한 결합력을 pico-mole 수준까지 매우 용이하게 증대시킬 수 있으며 타겟에 대한 특이성이 매우 탁월함을 입증한 바가 있다(KR2013-0098089A).
상피세포 성장인자 수용체(Epidermal Growth Factor Receptor; EGFR)는 대장암 및 다양한 암과 관련하여 검증된 질환유발인자로 전체 대장암환자의 90%이상이 상피 세포기원의 암종으로 알려져 있다. 이러한 암에서 EGFR의 과발현 및 돌연변이가 50~90%이상 발견되며, EGFR에 의한 신호 전달계의 이상이 대다수 암에서 공통적으로 발견되기 때문에 EGFR이 항암제 개발의 주요 표적으로 인식되고 있다. 또한, EGFR을 통한 신호 전달 체계가 현재까지는 다른 신호 전달 체계에 비해 가장 명확하게 알려져 있어서, EGFR을 표적으로 하는 치료제 개발 연구가 가장 활발하게 진행되고 있는 실정이다.
현재 EGFR의 세포외 도메인을 표적하는 약물로는 키메릭 단일 항체 약물인 Cetuximab이 있으나, 다른 단일 항체 신약에 비해 결합력과 치료효과가 낮은 것으로 보고되었고, 지속적으로 투여할 경우 약물 저항성이 나타나며 약물 독성에 의한 부작용 및 키메릭 항체로 인한 부작용 발생이 보고되었다. 이를 극복하고자 약물혼용치료(multi-drug therapy)등 새로운 치료법의 개발 및 신약 개발(Nimotuzumab)이 시도되고 있다. 따라서, 기존 약물이 가진 한계를 극복한 새로운 개념의 EGFR 표적 치료제의 개발이 필요한 시점이다.
본 발명자들은 상기 리피바디 골격을 이용하여 다양한 질환 관련 표적 단백질들에 대한 특이적인 결합 단백질(specific protein binder)을 성공적으로 제조하고, 세포 기반의 방법으로 생물학적 저해효과가 있음을 검증하였으나, 이에 대한 응용연구는 아직 시작 단계에 불과하여, 추가적인 연구를 필요로 하고 있다. 또한, 아직까지는 암세포에서 과발현되는 다양한 수용체에 결합하는 선도 물질 발굴과 이에 대한 응용이 보고되지 않고 있는 실정이다.
이러한 배경 하에서, 본 발명자들은 상기 리피바디 골격을 이용하여 다양한 암에서 과발현되는 EGFR의 세포외 도메인에 특이적으로 결합하는 단백질을 동정하기 위해 리피바디의 구조적 특징인 모듈성과 전체구조분석을 통해 구축한 무작위한 돌연변이 라이브러리를 바탕으로 상피세포 성장인자 수용체에 특이적 결합력을 갖는 신규 단백질을 선별하고, 반복 모듈 기반의 친화력 증대방식을 통해 결합력을 향상시킬 수 있음을 확인함으로써 본 발명을 완성하였다.
발명의 요약
본 발명의 목적은 상피세포 성장인자 수용체와 특이적으로 강하게 결합하여 그의 활성을 저해할 수 있는 폴리펩타이드를 제공하는데 있다.
본 발명의 다른 목적은 상기 폴리펩타이드를 코딩하는 폴리뉴클레오티드 및 폴리뉴클레오티드를 포함하는 발현벡터를 제공하는데 있다.
본 발명의 또 다른 목적은 상기 발현벡터가 도입되어 있는 재조합 미생물 및 상기 재조합 미생물을 이용한 폴리펩타이드의 제조방법을 제공하는데 있다.
상기 목적을 달성하기 위한 하나의 실시양태로서, 본 발명은 서열번호 6 내지 8 중 어느 하나의 아미노산 서열을 포함하고, 상피세포 성장인자 수용체와 효과적으로 결합하여 그의 활성을 저해할 수 있는 폴리펩타이드를 제공한다.
본 발명은 또한, 상기 폴리펩타이드를 코딩하는 폴리뉴클레오타이드 및 상기 폴리뉴클레오티드를 포함하는 재조합벡터를 제공한다.
본 발명은 또한, 상기 폴리뉴클레오타이드 또는 상기 재조합벡터가 포함되어 있는 재조합 미생물을 제공한다.
본 발명은 또한, 상기 재조합 미생물을 배양하여 상기 폴리펩타이드를 생성시키는 단계 및 상기 배양된 재조합 미생물 또는 배양물로부터 상기 폴리펩타이드를 회수하는 단계를 포함하는 폴리펩타이드의 제조방법을 제공한다.
도 1은 선행특허(KR2013-0098089A)에서 구축된 파지 라이브러리를 이용하여, EGFR의 세포외 도메인에 대한 파지 디스플레이의 바이오 패닝을 수행한 결과이다. BSA 대비 EGFR의 세포외 도메인에 대한 효소면역측정법(ELISA)에 의한 결합 신호를 평균화(normalization) 하였으며, 이때 3배 이상의 신호가 증가한 클론에 대해 특이적 결합력을 갖는 리피바디 클론으로 정의하였다.
도 2는 도 1에서 얻어진 특이적인 결합능을 가진 클론을 변화된 아미노산을 기준으로 그룹화 하였다. 각 아미노산의 위치는 리피바디의 오목한 부분에 위치하며, 3번째와 4번째 모듈에 대해 라이브러리를 구축하여 선별한 결과이다.
도 3은 EGFR의 세포외 도메인에 대한 특이적 결합여부를 확인한 ELISA 결과이다. 3개의 그룹에 대해 실시한 결과이며, BSA에는 결합하지 않고 EGFR의 세포외 도메인에 대해서만 특이적인 결합함을 확인할 수 있다. 이때, 경쟁자로 넣어준 Cetuximab으로 인해 EGFR의 세포외 도메인의 ELISA 신호가 감소한 클론을 EGFR의 세포외 도메인 중 3번째 도메인에 결합되어 있다고 추정할 수 있다.
도 4는 리피바디의 대략적인 결합력(apparent binding affinity)을 확인하고자 수용성의 EGFR의 세포외 도메인을 처리하여 농도에 비례하게 결합 감소 여부를 확인하였다. 이때, ELISA 신호가 50%가 감소하는 EGFR의 세포외 도메인의 농도를 해리상수로 정의하였다.
도 5는 2번째 결합력을 증가하고자 선택한 모듈로 이 경우 5번째 모듈을 결합력 증대 라이브러리 구축에 사용하였다. 이때, 녹색 모듈은 기존의 라이브러리가 구축된 위치를 적색 모듈은 새롭게 구축되는 라이브러리의 해당 위치를 나타낸다.
도 6은 ELISA를 rA11이 표면에 발현된 파지의 결합력 저해능을 각 리피바디 클론을 경쟁자로 넣어주면서 EGFR에 대한 결합신호의 저해를 통해 상대적인 결합력을 확인한 결과이다. 보다 낮은 농도에서 EGFR의 세포외 도메인에 대한 결합을 저해할수록 더 강한 결합력으로 EGFR의 세포외 도메인에 결합하는 클론으로 정의하였다.
도 7은 3번째 결합력을 증가하고자 선택한 모듈로 이 경우 6번째 모듈을 결합력 증대 라이브러리 구축에 이용하였다.
도 8은 4번째 결합력을 증가하고자 선택한 모듈로 이 경우 2번째 모듈을 결합력 증대 라이브러리 구축에 이용하였다.
도 9는 도 6과 동일하게 최종 리피바디 클론인 rEgH9의 상대적 결합력을 확인하는 ELISA 실험 결과이다.
도 10은 본 발명에서 확보한 가장 강한 결합력을 보이는 rEgH9에 대한 등온열량측정기(Isothermal Titration Calorimetry; ITC)를 이용하여 해리상수를 측정한 결과로, EGFR의 세포외 도메인에 대해 200 pM의 높은 결합력을 가지고 있음을 확인하였다.
발명의 상세한 설명 및 바람직한 구현예
다른 식으로 정의되지 않는 한, 본 명세서에서 사용된 모든 기술적 및 과학적 용어들은 본 발명이 속하는 기술 분야에서 숙련된 전문가에 의해서 통상적으로 이해되는 것과 동일한 의미를 갖는다. 일반적으로, 본 명세서에서 사용된 명명법은 본 기술 분야에서 잘 알려져 있고 통상적으로 사용되는 것이다.
본 발명자들은 EGFR의 세포 외 도메인과 특이적으로 결합할 수 있는 신규 폴리펩타이드를 개발하기 위하여, 인터날린 B (Internalin B) 단백질의 -말단, 가변 림프구 수용체(Variable Lymphocyte Receptor, VLR)의 LRR(Leucine-rich repeat) 단백질 부분이 융합된, 폴리펩타이드의 반복 모듈을 무작위적으로 포함하는 라이브러리를 구축하였다. 상기 라이브러리에 포함된 폴리펩타이드는 본 발명자의 선행특허(KR2013-0098089A)에 기술된 서열번호 1의 폴리뉴클레오티드 서열에 의하여 코딩되거나 또는 해당 폴리뉴클레오티드 서열과 75%, 바람직하게는 85%, 보다 바람직하게는 90%, 더욱 바람직하게는 95% 이상의 상동성을 갖는 폴리뉴클레오티드 서열에 의하여 코딩될 수 있다.
또한, 상기 라이브러리는 상기 폴리뉴클레오티드를 포함하는 파지미드의 형태가 될 수 있다. 본 발명의 용어 "파지미드"란, 대장균을 숙주로 하는 바이러스인 파지로 부터 유래된 원형의 폴리뉴클레오티드 분자를 의미하는데, 번식과 증식에 필요한 단백질 및 표면 단백질들 서열이 포함되어 있다. 재조합 파지미드는 당해 기술 분야에서 잘 알려진 유전자 재조합 기술을 이용하여 제조할 수 있으며, 부위-특이적 DNA 절단 및 연결은 당해 기술 분야에서 일반적으로 알려진 효소 등을 사용하여 수행될 수 있다. 상기 파지미드는 프로모터, 오퍼레이터, 개시코돈, 종결코돈, 인핸서 같은 발현 조절 요소 외에도 분비를 위한 신호 서열 또는 리더 서열을 포함할 수 있고, 주로 원하는 단백질을 파지의 표면 단백질과 융합하여 파지 표면에 표지하기 위한 방법에 사용될 수 있다. 파지미드의 프로모터는 주로 유도성이며, 숙주세포를 선택하기 위한 선택성 마커를 포함할 수 있다. 본 발명의 목적상 상기 파지미드는 상기 라이브러리를 구성하는 폴리뉴클레오티드의 발현 및 분비를 위한 신호 서열 또는 리더 서열인 MalEss, DsbAss 또는 PelBss를 포함하고, 파지 표면에 재조합 단백질의 발현을 확인하기 위한 히스티딘-태그와 파지 표면 발현을 위한 M13 파지의 표면 단백질의 일종인 gp3 도메인을 인코딩하는 폴리뉴클레오티드를 포함하는 선행특허(KR2013-0098089A)의 서열번호 2의 폴리뉴클레오티드가 될 수 있으나, 특별히 이에 제한되지는 않는다.
본 발명자들은 상기 파지미드를 포함하는 라이브러리를 이용한 파지 디스플레이 방법을 사용하여 EGFR의 세포외 도메인에 대한 결합력이 우수한 리피바디 형태의 신규 폴리펩타이드(서열번호 1 내지 5)를 선별하였다 (도 1 내지 2). 그러나, 이들 선별된 폴리펩타이드는 자연계에 존재하는 상피세포 성장인자(EGF) 보다 EGFR의 세포외 도메인에 대한 결합력이 낮은 수준이어서 (도 3), 상기 선별된 폴리펩타이드에 돌연변이를 가하여 EGFR의 세포외 도메인에 대한 결합력이 향상된 변이 폴리펩타이드를 제작하고자 하였다. 이를 위하여, 상기 선별된 폴리펩타이드 중에서 EGFR의 세포외 도메인 중 3번째 도메인과 결합하는 것으로 확인된 서열번호 2의 폴리펩타이드를 대상으로 5번째 모듈에 위치한 4개의 아미노산 잔기를 돌연변이 시킨 두 번째 라이브러리를 구축하였고 (도 4), 상기 두 번째 라이브러리를 이용한 파지 디스플레이 방법을 사용하여 EGFR의 세포외 도메인에 대한 결합력이 증대된 신규 폴리펩타이드(서열번호 6)을 2차 선별하였다 (도 5).
다음으로, 선별된 클론인 서열번호 6의 폴리펩타이드를 바탕으로 동일한 방식으로 다른 모듈에 돌연변이를 수행하여 세 번째 라이브러리를 구축하였고 (도 6), 상기 세 번째 라이브러리로부터 파지 디스플레이 방법을 사용하여 EGFR의 세포외 도메인에 대한 결합력이 더욱 증대된 리피바디 형태의 신규 폴리펩타이드(서열번호 7)을 3차 선별하였다. 최종적으로 상기 3차 선별된 폴리펩타이드를 대상으로 동일한 방법으로 돌연변이를 가하여 (도 7), 네 번째 라이브러리를 구축하였고 이로부터 pM 수준의 결합력을 갖는 리피바디 형태의 신규 폴리펩타이드(서열번호 8)를 최종적으로 선별하였다.
따라서, 본 발명은 일 관점에서, 서열번호 6 내지 8 중 어느 하나의 아미노산 서열로 구성된 것을 특징으로 하는 폴리펩타이드에 관한 것이다.
본 발명에서 용어 "인터날린 B 단백질"이란, 리스테리아(Listeria) 균주에서 발현되는 LRR 패밀리 단백질의 일종으로, 다른 소수성 코어가 전 분자에 걸쳐서 일정하게 분포되어 있는 다른 LRR 패밀리 단백질들과는 상이한 N-말단 구조를 가지고 있어 미생물에서도 안정적으로 발현되는 것으로 알려져 있다. 이러한 인터날린 단백질의 N-말단은 반복 모듈의 접힘(folding)에 가장 중요한 N-말단 부위가 미생물 유래일 뿐만 아니라 그 형태가 알파 나선을 포함하는 안정적인 모양을 가졌기에 미생물에서 LRR 패밀리 단백질들의 안정적인 발현을 위하여 효과적으로 사용될 수 있다.
본 발명에서 용어, "인터날린 단백질의 N-말단"은 단백질의 수용성 발현 및 접힘에 있어서 필요한 인터날린 단백질의 N-말단을 의미하며 알파 나선형 캡핑 모티프(capping motif) 및 인터날린 단백질의 반복 모듈을 의미한다. 인터날린 단백질의 N-말단은 단백질의 수용성 발현 및 접힘에 있어서 필요한 인터날린 단백질의 N-말단을 제한 없이 포함하며, 그 예로 알파 나선형 캡핑 모티프인 "ETITVSTPIKQIFPDDAFAETIKANLKKKSVTDAVTQNE" 및 반복 모듈을 포함할 수 있다. 또한 반복 모듈 패턴은 "LxxLxxLxLxxN"을 포함할 수 있다. 반복 모듈 패턴 중 L은 알라닌, 글리신, 페닐알라닌, 티로신, 루이신, 이소루이신, 발린 또는 트립토판; N은 아스파라진, 글루타민, 세린, 시스테인 또는 트레오닌, x는 임의의 친수성 아미노산을 의미한다. 인터날린 단백질의 N-말단은 융합될 수 있는 LRR 패밀리 단백질의 종류에 따라 높은 구조 유사도를 갖는 N-말단이 선택될 수 있으며 결합 에너지 등의 계산을 통해 가장 안정적인 아미노산을 선택하여 해당 모듈의 아미노산의 변이가 가능하다.
본 발명의 용어 "상피세포 성장인자 수용체(EGFR)"는 다양한 세포의 세포막에 존재하는 약 170 KDa 크기의 막투과성 단백질로, 세포의 성장, 증식, 이동, 생존에 필수적인 역할을 하는 것으로 알려져 있다. 해당 수용체로 인해 활성화되는 세포 증식 신호 전달은 암세포 내에서의 상피세포 성장인자(EGF)의 과발현으로 인한 EGFR의 이합체를 과도하게 유도하여 비정상적인 세포 증식을 유발하며, 이러한 현상은 폐암, 췌장암, 유방암 그리고 대장암과 같은 다양한 암에서 발견되고 있다.
본 발명의 용어 "리피바디(Repebody)"란, LRR 구조를 갖는 인터날린의 N-말단과 VLR 구조의 유사성을 바탕으로 융합하여 컨센서스 디자인으로 최적화시킨 폴리펩타이드이다. 리피바디 단백질은 구조상 오목한 지역(concave)과 볼록한 지역(convex)으로 나누어 질 수 있다 (도 4). 여기서 오목한 지역은 서열의 다양성이 높으며 단백질 상호작용에 중요한 부위로 알려져 있다. 이와 반대로 볼록한 지역은 보존성이 높은 서열을 바탕으로 단백질의 전체구조를 안정하게 유지하는 역할을 수행한다. 리피바디 단백질은 반복 모듈을 갖는 LRR 패밀리에 속하는 모든 단백질을 상기 방법으로 수용성 발현 및 단백질의 생물리화학적 성질을 향상 시킨 융합 LRR 패밀리 단백질을 모두 포함할 수 있다.
본 발명의 용어 "가변 림프구 수용체(Variable Lymphocyte Receptor, VLR)"란, 먹장어와 칠성장어에서 발현되는 LRR 패밀리 단백질의 일종을 의미하는데, 먹장어와 칠성장어에서 발현되는 면역 기능 단백질로 다양한 항원 물질에 결합할 수 있는 골격으로 유용하게 사용될 수 있다. 상기 인터날린 B 단백질의 N-말단 및 VLR 단백질이 융합된 폴리펩타이드는 인터날린 B 단백질이 융합되지 않은 VLR 단백질보다 수용성 및 발현양이 증가하므로, 이를 기반으로 한 신규 단백질 치료제 제조에 사용될 수 있다.
본 발명에서 용어 "LRR(Leucine Rich Repeat) 단백질"이란, 루이신이 일정한 위치에 반복되는 모듈의 조합으로 이루어진 단백질을 의미하는 것으로, (i) 하나 이상의 LRR 반복 모듈을 갖고 있고, (ii) 상기 LRR 반복 모듈은 20 내지 30개의 아미노산으로 이루어져 있고, (iii) LRR 반복 모듈은 보존 패턴으로 "LxxLxxLxLxxN"을 갖고 있으며, 여기서 L은 알라닌, 글리신, 페닐알라닌, 티로신, 루이신, 이소루이신, 발린 및 트립토판과 같은 소수성 아미노산을, N은 아스파라진, 글루타민, 세린, 시스테인 또는 트레오닌을, x는 임의의 아미노산을 의미하며, (iv) LRR 패밀리 단백질은 말발굽과 같은 삼차원 구조를 갖고 있는 단백질을 의미한다. 본 발명의 LRR 패밀리 단백질은 이미 그 서열이 알려져 있거나, 생체 내에서 새로 유도된 mRNA나 cDNA를 이용하여 찾아낸 것과 더불어 컨센서스 디자인(consensus design) 등의 설계를 통하여 자연계에 알려지지 않은 서열을 가지면서 반복모듈의 골격 구조가 있는 변이체를 모두 포함할 수 있다.
본 발명은 다른 관점에서, 상기 폴리펩티드를 코딩하는 폴리뉴클레오타이드; 상기 폴리뉴클레오타이드를 포함하는 재조합 벡터 및 재조합 미생물에 관한 것이다.
본 발명의 용어 "벡터"란 적합한 숙주 내에서 목적 단백질을 발현시킬 수 있도록 적합한 조절 서열에 작동 가능하게 연결된 상기 목적 단백질을 암호화하는 폴리뉴클레오티드 염기서열을 함유하는 DNA 제조물을 의미한다. 상기 조절 서열은 전사를 개시할 수 있는 프로모터, 그러한 전사를 조절하기 위한 임의의 오퍼레이터 서열, 적합한 mRNA 리보좀 결합 부위를 코딩하는 서열, 전사 및 해독의 종결을 조절하는 서열을 포함한다. 벡터는 적당한 숙주 내로 형질 전환된 후, 숙주 게놈과 무관하게 복제되거나 기능할 수 있으며, 게놈 그 자체에 통합될 수 있다.
본 발명에서 사용되는 벡터는 숙주세포 중에서 복제 가능한 것이면 특별히 한정되지 않으며 당 업계에 알려진 임의의 벡터를 이용할 수 있다. 통상 사용되는 벡터의 예로는 천연 상태이거나 재조합된 상태의 플라스미드, 파지미드, 코스미드, 바이러스 및 박테리오파지를 들 수 있다. 예를 들어, 파지 벡터 또는 코스미드 벡터로서 pWE15, M13, MBL3, MBL4, IXII, ASHII, APII, t10, t11, Charon4A, 및 Charon21A 등을 사용할 수 있으며, 플라스미드 벡터로서 pBR계, pUC계, pBluescriptII계, pGEM계, pTZ계, pCL계 및 pET계 등을 사용할 수 있다. 본 발명에서 사용 가능한 벡터는 특별히 제한되는 것이 아니며 공지된 발현 벡터를 사용할 수 있다. 바람직하게는 pACYC177, pACYC184, pCL, pECCG117, pUC19, pBR322, pMW118, pCC1BAC, pET-21a, pET-32a 벡터 등을 사용할 수 있다. 가장 바람직하게는 pET-21a, pET-32a 벡터를 사용할 수 있다.
본 발명의 용어 "재조합 미생물"이란, 하나 이상의 목적 단백질을 암호화하는 유전자를 갖는 벡터가 숙주세포에 도입되어 목적 단백질을 발현시키도록 형질이 감염된 세포를 의미하며, 진핵세포, 원핵세포 등의 모든 세포가 될 수 있는데, 특별히 이에 제한되지 않으나, 대장균, 스트렙토미세스, 살모넬라티피뮤리움 등의 박테리아 세포; 효모 세포; 피치아파스토리스 등의 균류 세포; 드로조필라, 스포도프테라 Sf9 세포 등의 곤충 세포; CHO, COS, NSO, 293, 보우 멜라노마 세포 등의 동물 세포; 또는 식물세포가 될 수 있다. 본 발명에서 사용 가능한 숙주세포는 특별히 제한되는 것이 아니며, 바람직하게는 대장균을 숙주세포로 사용할 수 있다. 가장 바람직하게는 대장균 BL21(DE3), OrigamiB(DE3)를 숙주세포로 사용할 수 있다.
본 발명에서 용어 "형질전환"이란, 표적 단백질을 암호화하는 폴리뉴클레오티드를 포함하는 벡터를 숙주세포 내에 도입하여 숙주세포 내에서 상기 폴리뉴클레오티드가 암호화하는 단백질이 발현할 수 있도록 하는 것을 의미한다. 형질전환된 폴리뉴클레오티드는 숙주세포 내에 발현될 수 있는 것이면, 숙주세포의 염색체 내에 삽입되어 위치하거나 염색체 외에 위치하든지 상관없이 이들 모두를 포함한다. 또한, 상기 폴리뉴클레오티드는 표적 단백질을 암호화하는 DNA 및 RNA를 포함한다. 상기 폴리뉴클레오티드는 숙주세포 내로 도입되어 발현될 수 있는 것이면, 어떠한 형태로 도입되는 것이든 상관없다. 예를 들면, 상기 폴리뉴클레오티드는 자체적으로 발현되는데 필요한 모든 요소를 포함하는 유전자 구조체인 발현 카세트 (expression cassette)의 형태로 숙주세포에 도입될 수 있다. 상기 발현 카세트는 통상 상기 폴리뉴클레오티드에 작동 가능하게 연결되어 있는 프로모터(promoter), 전사 종결 신호, 리보좀 결합부위 및 번역 종결신호를 포함한다. 상기 발현 카세트는 자체 복제가 가능한 발현 벡터 형태일 수 있다. 또한, 상기 폴리뉴클레오티드는 그 자체의 형태로 숙주세포에 도입되어, 발현에 필요한 서열과 작동 가능하게 연결되는 것일 수도 있다.
본 발명은 다른 관점에서, (i) 상기 재조합 미생물을 배양하여 배양물을 수득하는 단계; 및 (ii) 상기 배양된 재조합 미생물 또는 배양물로부터 상기 폴리펩타이드를 회수하는 단계를 포함하는 폴리펩타이드의 제조방법에 관한 것이다.
상기 방법에 있어서, 상기 재조합 미생물을 배양하는 단계는 특별히 이에 제한되지 않으나, 공지된 회분식 배양방법, 연속식 배양방법, 유가식 배양방법 등에 의해 수행됨이 바람직하고, 배양조건은 특별히 이에 제한되지 않으나, 염기성 화합물(예: 수산화나트륨, 수산화칼륨 또는 암모니아) 또는 산성 화합물(예: 인산 또는 황산)을 사용하여 적정 pH(pH 5 내지 9, 바람직하게는 pH 6 내지 8, 가장 바람직하게는 pH 6.8)를 조절할 수 있고, 산소 또는 산소-함유 가스 혼합물을 배양물에 도입시켜 호기성 조건을 유지할 수 있으며, 배양온도는 20 내지 45, 바람직하게는 25 내지 40를 유지할 수 있고, 약 10 내지 160 시간 배양함이 바람직하다. 상기 배양에 의하여 생산된 상기 폴리펩타이드는 배지 중으로 분비되거나 세포 내에 잔류할 수 있다.
아울러, 사용되는 배양용 배지는 탄소 공급원으로는 당 및 탄수화물(예: 글루코오스, 슈크로오스, 락토오스, 프럭토오스, 말토오스, 몰라세, 전분 및 셀룰로오스), 유지 및 지방(예: 대두유, 해바라기씨유, 땅콩유 및 코코넛유), 지방산(예: 팔미트산, 스테아르산 및 리놀레산), 알콜(예: 글리세롤 및 에탄올) 및 유기산(예: 아세트산) 등을 개별적으로 사용하거나 또는 혼합하여 사용할 수 있고; 질소 공급원으로는 질소-함유 유기 화합물(예: 펩톤, 효모 추출액, 육즙, 맥아 추출액, 옥수수 침지액, 대두 박분 및 우레아), 또는 무기 화합물(예: 황산암모늄, 염화암모늄, 인산암모늄, 탄산암모늄 및 질산암모늄) 등을 개별적으로 사용하거나 또는 혼합하여 사용할 수 있으며; 인 공급원으로서 인산 이수소칼륨, 인산수소이칼륨, 이에 상응하는 나트륨 함유 염 등을 개별적으로 사용하거나 또는 혼합하여 사용할 수 있고; 기타 금속염(예: 황산마그네슘 또는 황산철), 아미노산 및 비타민과 같은 필수성장-촉진 물질을 포함할 수 있다.
본 발명의 상기 배양 단계에서 생산된 폴리펩타이드 회수 방법은 배양 방법, 예를 들어 회분식, 연속식 또는 유가식 배양 방법 등에 따라 당해 분야에 공지된 적합한 방법을 이용하여 배양액으로부터 목적 폴리펩타이드를 수집할 수 있다.
또 하나의 양태로서, 본 발명은 상기 폴리펩타이드를 포함하는 암 예방 또는 치료용 조성물에 관한 것이다.
본 발명에서 용어 "암" 또는 "종양"은 신체 조직의 자율적인 과잉 성장에 의해 비정상적으로 자라난 덩어리를 의미하는 것이다. 상피세포 성장인자 수용체(EGFR)은 종양의 증식을 유도하는 성장 인자인바, 본 발명에서의 암 또는 종양은, 상피세포 성장인자 수용체가 과량 분비되는 대장암, 비소세포폐암, 난소암, 다발성 골수종, 캐슬만씨 병, 간암 등을 모두 포함하는 것을 의미한다.
본 발명에서 용어 "치료"란 조성물의 투여로 암이나 그로부터 야기된 하나 또는 그 이상의 증상을 억제하거나 완화하는 것뿐만 아니라 질환의 증상을 반전시키는 암의 치료 또는 암의 진행을 방지하는 것을 의미한다. 본 발명에서 용어 "예방"이란 조성물의 투여로 암을 억제시키거나 발병을 지연시키는 모든 행위를 의미한다.
본 발명에서는, 암의 예방 또는 치료는 본 발명에서 확보한 폴리펩타이드가 상피세포 성장인자 수용체와 결합하여 이루어지는 것으로, 상피세포 성장인자 수용체의 세포외 도메인에 결합하여 그의 활성을 유의하게 억제하여 암을 예방 또는 치료하는 것이다.
본 발명의 선행 특허(KR10-1356075)에서는 인터루킨-6와 결합할 수 있는 신규한 리피바디가 비소세포폐암에 대하여 유의미한 항암 작용을 한다는 것을 확인하였다. 따라서, 본 발명에 따른 상피세포 성장인자 수용체와 특이적으로 결합하는 리피바디 역시, 상피세포 성장인자 수용체의 과발현에 의해 발생하는 질환의 예방 또는 치료에도 사용될 수 있음은 명백하다.
본 발명의 상기 폴리펩타이드를 포함하는 암 예방 또는 치료용 조성물은 약학적으로 허용 가능한 담체를 추가로 포함할 수 있으며, 담체와 함께 제제화될 수 있다.
본 발명에서 용어, "약학적으로 허용 가능한 담체"란 생물체를 자극하지 않고 투여 화합물의 생물학적 활성 및 특성을 저해하지 않는 담체 또는 희석제를 말한다. 액상 용액으로 제제화되는 조성물에 있어서 허용되는 약제학적 담체로는, 멸균 및 생체에 적합한 것으로서, 식염수, 멸균수, 링거액, 완충 식염수, 알부민 주사용액, 덱스트로즈 용액, 말토 덱스트린 용액, 글리세롤, 에탄올 및 이들 성분 중 1 성분 이상을 혼합하여 사용할 수 있으며, 필요에 따라 항산화제, 완충액, 정균제 등 다른 통상의 첨가제를 첨가할 수 있다. 또한 희석제, 분산제, 계면활성제, 결합제 및 윤활제를 부가적으로 첨가하여 수용액, 현탁액, 유탁액 등과 같은 주사용 제형, 환약, 캡슐, 과립 또는 정제로 제제화할 수 있다.
본 발명의 상기 폴리펩타이드 및 약학적으로 허용 가능한 담체를 포함하는 암 예방 또는 치료용 조성물은 이를 유효성분으로 포함하는 어떠한 제형으로도 적용가능하며, 경구용 또는 비경구용 제형으로 제조할 수 있다. 본 발명의 약학적 제형은 구강(oral), 직장(rectal), 비강(nasal), 국소(topical; 볼 및 혀 밑을 포함), 피하, 질(vaginal) 또는 비경구(parenteral; 근육내, 피하 및 정맥내를 포함) 투여에 적당한 것 또는 흡입 (inhalation) 또는 주입(insufflation)에 의한 투여에 적당한 형태를 포함한다.
본 발명의 조성물을 유효성분으로 포함하는 경구 투여용 제형으로는, 예를 들어 정제, 트로키제, 로렌지, 수용성 또는 유성현탁액, 조제분말 또는 과립, 에멀젼, 하드 또는 소프트 캡슐, 시럽 또는 엘릭시르제로 제제화할 수 있다. 정제 및 캡슐 등의 제형으로 제제화하기 위해, 락토오스, 사카로오스, 솔비톨, 만니톨, 전분, 아밀로펙틴, 셀룰로오스 또는 젤라틴과 같은 결합제, 디칼슘 포스페이트와 같은 부형제, 옥수수 전분 또는 고구마 전분과 같은 붕괴제, 스테아르산 마스네슘, 스테아르산 칼슘, 스테아릴푸마르산 나트륨 또는 폴리에틸렌글리콜 왁스와 같은 윤활유를 포함할 수 있으며, 캡슐제형의 경우 상기 언급한 물질 외에도 지방유와 같은 액체 담체를 더 함유할 수 있다.
본 발명의 조성물을 유효성분으로 포함하는 비경구 투여용 제형으로는, 피하주사, 정맥주사 또는 근육내 주사 등의 주사용 형태, 좌제 주입방식 또는 호흡기를 통하여 흡입이 가능하도록 하는 에어로졸제 등 스프레이용으로 제제화할 수 있다. 주사용 제형으로 제제화하기 위해서는 본 발명의 조성물을 안정제 또는 완충제와 함께 물에서 혼합하여 용액 또는 현탁액으로 제조하고, 이를 앰플 또는 바이알의 단위 투여용으로 제제화할 수 있다. 좌제로 주입하기 위해서는, 코코아버터 또는 다른 글리세라이드 등 통상의 좌약 베이스를 포함하는 좌약 또는 관장제와 같은 직장투여용 조성물로 제제화할 수 있다. 에어로졸제 등의 스프레이용으로 제형화하는 경우, 수분산된 농축물 또는 습윤 분말이 분산되도록 추진제 등이 첨가제와 함께 배합될 수 있다.
또 하나의 양태로서, 본 발명은 상기 폴리펩타이드를 포함하는 암 예방 또는 치료용 조성물을 투여하는 것을 포함하는, 암을 예방 또는 치료하는 방법에 관한 것이다.
본 발명에서 용어, "투여"는 어떠한 적절한 방법으로 환자에게 본 발명의 약제학적 조성물을 도입하는 것을 의미한다. 본 발명의 조성물의 투여 경로는 목적 조직에 도달할 수 있는 한 경구 또는 비경구의 다양한 경로를 통하여 투여될 수 있으며, 구체적으로, 구강, 직장, 국소, 정맥내, 복강내, 근육내, 동맥내, 경피, 비측내, 흡입, 안구 내 또는 피내경로를 통해 통상적인 방식으로 투여될 수 있다.
본 발명의 치료방법은 본 발명의 암 예방 또는 치료용 조성물을 약학적 유효량으로 투여하는 것을 포함한다. 적합한 총 1일 사용량은 올바른 의학적 판단범위 내에서 처치의에 의해 결정될 수 있다는 것은 당업자에게 자명한 일이다. 특정 환자에 대한 구체적인 치료적 유효량은 달성하고자 하는 반응의 종류와 정도, 경우에 따라 다른 제제가 사용되는지의 여부를 비롯한 구체적 조성물, 환자의 연령, 체중, 일반 건강 상태, 성별 및 식이, 투여 시간, 투여 경로 및 조성물의 분비율, 치료기간, 구체적 조성물과 함께 사용되거나 동시 사용되는 약물을 비롯한 다양한 인자와 의약 분야에 잘 알려진 유사 인자에 따라 다르게 적용하는 것이 바람직하다. 따라서 본 발명의 목적에 적합한 암의 예방 또는 치료용 조성물의 유효량은 전술한 사항을 고려하여 결정하는 것이 바람직하다.
또한, 본 발명의 치료 방법은 상피세포 성장인자 수용체의 과도한 분비로 인하여 종양 발달과 신생혈관생성 등의 질병이 발생할 수 있는 임의의 동물에 적용가능하며, 동물은 인간 및 영장류뿐만 아니라, 소, 돼지, 양, 말, 개 및 고양이 등의 가축을 포함한다.
이하 첨부된 실시예를 들어 본 발명을 보다 상세히 설명한다. 그러나 이러한 실시예는 본 발명의 기술적 사상의 내용과 범위를 쉽게 설명하기 위한 예시일 뿐, 이에 의해 본 발명의 기술적 범위가 한정되거나 변경되는 것은 아니다. 또한, 이러한 예시에 기초하여 본 발명의 기술적 사상의 범위 안에서 다양한 변형과 변경이 가능함은 당업자에게는 당연할 것이다.
실시예 1: 무작위적인 파지 라이브러리를 통한 EGFR의 세포외 도메인과 특이적으로 결합하는 폴리펩타이드 선별
발명의 구성요소로 선행특허(KR2013-0098089A)의 실시예 2에서 이미 구축된 리피바디 라이브러리 파지를 사용하였다. 파지 라이브러리는 총 6개의 아미노산 위치가 돌연변이 되었으며, 선행특허(KR2013-0098089A)에서의 도 5와 동일한 위치에 돌연변이 서열을 갖는다.
실시예 1-1: 리피바디 라이브러리의 패닝 과정을 통한 EGFR의 세포외 도메인과 결합하는 폴리펩타이드 선별
선행특허(KR2013-0098089A)에서 구축된 라이브러리를 사용하여 EGFR의 세포외 도메인에 결합할 수 있는 폴리펩타이드를 선별 정제하였다. EGFR의 세포외 도메인과 결합할 수 있는 후보를 선별하기 위하여, EGFR의 세포외 도메인을 면역튜브(Immuno-tube)에 100 /의 농도로 가하고, 4에서 12시간 코팅하였다. 상기 코팅된 면역튜브를 PBS으로 3회 세척하고, 1% BSA와 0.1% Tween 20을 포함하는 PBS 용액(TPBSA)으로 4에서 2시간 블로킹(Blocking)하였다. 그런 다음, 상기 정제된 파지를 1012 cfu/ml의 농도로 상기 코팅된 면역튜브에 가하고, 상온에서 2시간 반응시켰다. 반응이 종료된 후, 0.1% Tween 20을 포함하는 PBS 용액 (TPBS)으로 총 2분간 5번씩 및 PBS으로 2번 세척하였다. 마지막으로, 1 ml 0.2 M Gly-HCl(pH 2.2)를 상기 면역튜브에 가하고, 상온에서 10분간 반응시킴으로써, EGFR의 세포외 도메인과 결합할 수 있는 리피바디 후보를 표면에 발현시킨 파지를 용출시켰다. 용출액에 60의 1.0M Tris-HCl(pH 9.1)를 가하여 중화시키고, 숙주세포인 10ml 대장균 XL1-Blue 용액(OD600 = 0.5)에 가한 다음, 2x YT플레이트에 도말하는 바이오패닝(Bio-panning) 과정을 동일하게 4회 반복 수행하였다. 그 결과, 각 패닝 과정을 통해 EGFR의 세포외 도메인과 특이적으로 결합하는 파지가 농축됨을 확인하였다. 이러한 결과는 EGFR의 세포외 도메인에 결합하는 라이브러리 파지가 특이적으로 증가함을 의미하는 것으로 분석되었다.
실시예 1-2: 선별된 리피바디의 EGFR에 대한 특이적인 결합여부 확인 및 서열 분석
실시예 1-1의 방법을 통하여 선별된 파지를 EGFR의 세포외 도메인과 BSA가 코팅된 96-웰 플레이트를 이용하여 ELISA를 수행함으로써, BSA 대비 EGFR의 세포외 도메인의 흡광도(OD450)가 3배 이상 높은 17개의 리피바디 후보들을 선별하고 (도 1), 이들 각각의 아미노산 서열을 확인한 후, 동일한 아미노산 서열을 갖는 클론을 그룹화 하였다. 그 결과, 선별된 파지에서 발현되는 EGFR의 세포외 도메인과 특이적으로 결합하는 단백질 아미노산 서열 중에서 동일한 서열로 이루어진 A 내지 E에서 총 5개의 폴리펩타이드 그룹서열을 확인하였다. 즉, 126번 아미노산인 이소류신이 메타오닌, 아스파라진, 프롤린, 아스파라긴산으로 치환되고, 128번 아미노산인 트레오닌이 히스티딘, 류이신, 아르기닌 또는 시스테인으로 치환되며, 129번 아미노산인 글리신이 타이로신, 세린, 또는 트립토판으로 치환되고, 150번 아미노산인 발린이 타이로신, 세린, 메타오닌 또는 시스테인으로 치환되며, 152번 아미노산인 발린이 세린, 히스티인, 아르지닌, 아스파리진 또는 페닐알라닌으로 치환되고, 153번 아미노산인 글루탐산이 글루타민, 아르지닌, 프롤린 또는 세린으로 치환되었음을 확인하였다 (도 2).
이러한 결과는 EGFR의 세포외 도메인과 결합하는데 중요한 역할을 수행하는 잔기가 존재함을 의미하는 것으로 분석되었다.
실시예 1-3: 선별된 리피바디의 EGFR의 3번째 세포외 도메인과의 결합 여부 확인
실시예 1-1에서 확보한 EGFR의 세포외 도메인에 결합하는 리피바디 중에서 3번째 도메인에 결합하는 리피바디를 선별하는 것은 매우 중요하다. 많은 암에서 EGFR은 과발현되지만, EGFR 자체의 돌연변이 또한 많이 발생하고 있음이 널리 보고되었다. 그 중, 단일 클론항체로 외부에서 EGFR의 세포외 도메인을 표적으로 하여 암을 치료하는 전략을 사용하는 경우에 범용적 사용을 위해서는 돌연변이로 인해 첫 번째와 두 번째 도메인이 제거된 형태의 EGFR의 세포외 도메인에 대해서도 결합이 가능해야 한다. 따라서 많은 발명자들은 EGFR의 세포외 도메인에 효과적인 표적능을 얻고자 주로 3번째 도메인에 결합할 수 있는 폴리펩타이드를 개발하여 선발하고 있는 실정이다.
이러한 배경아래, 실시예 1-2를 통해 얻어진 총 5개의 개별적인 폴리펩타이드 중에서, A, B 그리고 D에 해당하는 대표 클론인 rA11(서열번호 1), rC1(서열번호 2) 그리고 rC3(서열번호 4)을 이용하여 ELISA를 수행하였다. 그 결과, 세 클론 모두 BSA에는 결합하지 않으나 EGFR의 세포외 도메인에는 결합하는 특이적인 결합력을 확인하였다 (도 3). 또한 EGFR의 세포외 도메인을 코팅한 플레이트에서 수용성 EGFR의 세포외 도메인(Soluble EGFR)을 첨가한 결과, ELISA 신호가 감소됨을 통해서 다시 한 번 수용액 상에서도 선발된 리피바디가 EGFR의 세포외 도메인에 효과적으로 결합함을 확인하였다. 마지막으로 EGFR의 3번째 세포외 도메인에 결합하는 것으로 알려진 단일클론항체인 Cetuximab과 경쟁적 ELISA를 수행한 결과, D의 대표 클론을 제외한 A 와 B 클론 모두에서 Cetuximab에 의해 결합신호가 감소하는 것으로 확인됨에 따라 해당 클론은 EGFR의 3번째 세포외 도메인에 특이적으로 결합함을 입증할 수 있었다 (도 3).
실시예 2: 모듈 기반 방법을 이용한 리피바디의 EGFR의 세포외 도메인에 대한 결합력 증대 수행
발명의 구성요소로 상기 선행특허의 실시예 4에서 기술된 모듈 기반 친화력 증대 방식을 수행하였다. 해당 방법은 반복 모듈을 갖는 단백질에 대해 보편적으로 사용할 수 있는 기술로서, 본 특허에서 성공적으로 재현되어 높은 수준의 친화력을 갖는 단백질 설계를 가능하게 하였다.
실시예 2-1: 모듈을 이용한 추가적인 라이브러리 구축 및 결합력 증가 확인
실시예 1-3의 결과에서 가장 효과적으로 EGFR의 3번째 세포외 도메인에 결합할 수 있는 것으로 확인된 클론인 rA11의 EGFR의 세포외 도메인에 대한 해리상수는 92 nM 이지만 (도 4), 대부분의 항암치료에 사용되는 단일클론항체는 수 nM 혹은 수백 pM 수준의 결합력으로 효과적인 표적 치료제에 이용된다. 따라서 본 발명의 리피바디 후보로는 EGFR의 활성을 충분히 억제할 수 없을 것으로 예상되었다.
이러한 문제점을 해결하고자, 선행특허(KR2013-0098089A)의 실시예 4에서 사용한 모듈을 이용한 추가적인 라이브러리 구축방법을 이용하여 결합력이 향상된 돌연변이체를 개발하고자 하였다.
구체적으로, 선행특허(KR2013-0098089A)의 실시예 4-2와 동일한 방식으로 오목한 지역의 네 개의 잔기를 돌연변이 시켰다 (도 5). 첫 번째 모듈 기반 친화력 증대를 위한 라이브러리는 5번째 모듈을 돌연변이 시켜, 총 4번의 패닝과정을 거쳐서 결합력이 증대된 rAC1(서열번호 6)을 확보하였으며, ELISA를 통해서 rA11에 비해 상대적으로 낮은 단백질 농도에서 rA11의 EGFR의 세포외 도메인에 대해 결합을 저해하는 것을 확인하였다 (도 6).
한편, 더욱 향상된 결합력을 갖는 돌연변이체를 개발하기 위해서 rAC1을 기본 폴리펩타이드로 하여 주변 모듈인 6번째 모듈의 네 개의 잔기를 돌연변이 시킨 후 (도 7), 동일한 패닝과정을 거쳐, rEgA(서열번호 7)을 선별하여 rAC1에 비해 높은 결합력을 갖고 있음을 ELISA를 통해 확인하였다 (도 6). 세 번째 친화력 증대 과정에서는 rEgA를 기반으로 2번째 모듈의 네 개의 잔기에 라이브러리를 구축한 결과, rEgA에 비해 결합력이 향상된 rEgH9(서열번호 8)라는 클론을 성공적으로 확보할 수 있었다 (도 8 내지 9).
한편, 상피세포 EGFR의 세포외 도메인에 대한 상기 리피바디 rEgH9 클론의 해리상수(dissociation constant)를 측정하였다. 구체적으로, PBS에 0.3 mM (6 mg/ml)로 용해된 리피바디와 PBS에 0.02 mM(1.4 mg/ml)로 용해된 EGFR의 세포외 도메인을 사용하고, 등온열량측정기(Isothermal Titration Calorimetry; ITC)를 이용하여, 37 에서 EGFR의 세포외 도메인에 대한 rEgH9의 해리상수를 측정하였다 (도 10). 도 10은 본 발명의 폴리펩타이드의 EGFR의 세포 외 도메인에 대한 결합력을 등온열량측정기로 확인한 실험결과를 나타내는 도면이다. 도 10에서 나타난 바와 같이, 최종 클론인 rEgH9의 EGFR의 세포외 도메인에 대한 해리상수가 301 pM로 매우 강하게 결합할 수 있음을 확인하고 최종적인 클론으로서 확보하였다.
이러한 결과를 통해 본 발명자는 효과적인 표적 치료제로 사용되는 다양한 종류의 단일클론항체가 갖는 높은 수준의 결합력을 갖는 리피바디를 성공적으로 확보하였으며, 이는 EGFR의 세포외 도메인에 특이적 결합력을 갖는 폴리펩타이드임을 확보하였다.
이상으로 본 발명 내용의 특정한 부분을 상세히 기술하였는바, 당업계의 통상의 지식을 가진 자에게 있어서 이러한 구체적 기술은 단지 바람직한 실시양태일 뿐, 이에 대해 본 발명의 범위가 제한되는 것이 아닌 점은 명백할 것이다. 따라서, 본 발명의 실질적인 범위는 첨부된 청구사항들과 그것들의 등가물에 의하여 정의된다고 할 것이다.
본 발명의 폴리펩타이드는 표적 치료제로 널리 사용되는 단일클론항체에 버금가는 높은 친화력으로 EGFR의 세포외 도메인에 결합하여 그의 활성을 억제할 수 있어 EGFR 관련 질환의 예방 또는 치료용 제제의 개발에 유용하다.
전자파일 첨부하였음.

Claims (10)

  1. 상피세포 성장인자 수용체 단백질에 특이적 결합능을 갖는 폴리펩타이드로서 서열번호 1 내지 8 중 어느 하나의 아미노산 서열을 포함하는 폴리펩타이드.
  2. 제1항에 있어서, 상기 폴리펩티드는 상피세포 성장인자 수용체의 세포외 도메인에 결합하여 그의 활성 저해능을 가지는 폴리펩타이드.
  3. 제1항에 있어서, 인터날린 B 단백질의 N-말단, VLR(Variable Lymphocyte Receptor) 단백질의 변형된 반복모듈 및 VLR 단백질의 C-말단이 융합되어 있는 것을 특징으로 하는 폴리펩타이드.
  4. 제3항에 있어서, 상기 VLR 단백질의 변형된 반복모듈은 하기의 반복 모듈 패턴을 포함하는 폴리펩타이드:
    LxxLxxLxLxxN
    (상기 패턴에서, L은 알라닌, 글리신, 페닐알라닌, 티로신, 루이신, 이소루이신, 발린 또는 트립토판이며; N은 아스파라진, 글루타민, 세린, 시스테인 또는 트레오닌이며 및 x는 모든 종류의 20개의 아미노산이다).
  5. 제1항의 폴리펩타이드를 코딩하는 폴리뉴클레오티드.
  6. 제5항의 폴리뉴클레오티드를 포함하는 재조합벡터
  7. 제5항의 폴리뉴클레오티드 또는 제6항의 재조합벡터가 도입되어 있는 재조합 미생물.
  8. 다음 단계를 포함하는 상피세포 성장인자 수용체 단백질에 특이적으로 결합하는 폴리펩타이드의 제조방법;
    (i) 제7항의 재조합 미생물을 배양하여 제1항의 폴리펩타이드를 생성시키는 단계; 및
    (ii) 상기 배양된 재조합 미생물 또는 배양물로부터 제1항의 폴리펩타이드를 회수하는 단계.
  9. 제1항 내지 제4항의 폴리펩타이드를 유효성분으로 함유하는 암 예방 또는 치료용 조성물.
  10. 제9항에 있어서, 상기 암 예방 또는 치료는 상기 폴리펩타이드가 상피세포 성장인자 수용체와 결합하여 이루어지는 것인 암 예방 또는 치료용 조성물.
PCT/KR2015/005079 2014-05-23 2015-05-21 상피세포 성장인자 수용체의 세포외 도메인과 결합하는 신규 폴리펩타이드 Ceased WO2015178689A1 (ko)

Priority Applications (1)

Application Number Priority Date Filing Date Title
US15/310,585 US10364293B2 (en) 2014-05-23 2015-05-21 Polypeptide binding to extracellular domain of epidermal growth factor receptor

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
KR10-2014-0062391 2014-05-23
KR1020140062391A KR101587622B1 (ko) 2014-05-23 2014-05-23 상피세포 성장인자 수용체의 세포외 도메인과 결합하는 신규 폴리펩타이드

Publications (1)

Publication Number Publication Date
WO2015178689A1 true WO2015178689A1 (ko) 2015-11-26

Family

ID=54554285

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2015/005079 Ceased WO2015178689A1 (ko) 2014-05-23 2015-05-21 상피세포 성장인자 수용체의 세포외 도메인과 결합하는 신규 폴리펩타이드

Country Status (3)

Country Link
US (1) US10364293B2 (ko)
KR (1) KR101587622B1 (ko)
WO (1) WO2015178689A1 (ko)

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JP2018521631A (ja) * 2016-04-25 2018-08-09 エンジノミクス カンパニー リミテッド Taq DNAポリメラーゼに特異的に結合するポリペプチド及びその用途

Families Citing this family (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR102231974B1 (ko) * 2019-08-23 2021-03-25 한국과학기술원 사람의 프로그램된 세포사멸 단백질(pd-1)에 선택적으로 결합하는 신규한 폴리펩티드 및 이의 용도
KR102486958B1 (ko) * 2020-07-08 2023-01-11 한국과학기술원 인간 상피세포 증식인자 수용체 2형의 도메인 4에 특이적으로 결합하는 신규 폴리펩티드 및 이의 용도
CN118459549B (zh) * 2024-07-09 2024-10-18 同宜医药(苏州)有限公司 靶向表皮生长因子受体的多肽
KR102886400B1 (ko) * 2025-04-16 2025-11-17 주식회사 아윈바이오 인터날린 단백질 유래 키메릭 펩티드가 아미노 말단에 융합된 수용성 융합 폴리펩티드 및 이의 용도

Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20060017585A (ko) * 2003-04-04 2006-02-24 유니베르시떼 드 로잔느 암 치료용 펩타바디
KR20130098089A (ko) * 2012-02-27 2013-09-04 한국과학기술원 인터루킨-6와 결합할 수 있는 신규한 폴리펩타이드

Family Cites Families (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR101219628B1 (ko) * 2010-03-02 2013-01-10 한국과학기술원 인터날린 단백질의 n-말단 및 lrr 패밀리 단백질이 융합된 수용성 융합 폴리펩타이드 및 이의 제조 방법

Patent Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20060017585A (ko) * 2003-04-04 2006-02-24 유니베르시떼 드 로잔느 암 치료용 펩타바디
KR20130098089A (ko) * 2012-02-27 2013-09-04 한국과학기술원 인터루킨-6와 결합할 수 있는 신규한 폴리펩타이드

Non-Patent Citations (2)

* Cited by examiner, † Cited by third party
Title
BELLA J. ET AL.: "The leucine-rich repeat structure", CELL . MOL. LIFE SCI., vol. 65, no. 15, 14 April 2008 (2008-04-14), pages 2307 - 2333, XP019619956, ISSN: 1420-9071 *
LEE S-C. ET AL.: "Design of a binding scaffold based on variable lymphocyte receptors of jawless vertebrates by module engineering", PROC. NATL. ACAD. SCI., vol. 109, no. 9, 28 February 2012 (2012-02-28), pages 3299 - 3304, XP055200364, ISSN: 0027-8424 *

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JP2018521631A (ja) * 2016-04-25 2018-08-09 エンジノミクス カンパニー リミテッド Taq DNAポリメラーゼに特異的に結合するポリペプチド及びその用途

Also Published As

Publication number Publication date
US20170081422A1 (en) 2017-03-23
KR20150135700A (ko) 2015-12-03
US10364293B2 (en) 2019-07-30
KR101587622B1 (ko) 2016-01-22

Similar Documents

Publication Publication Date Title
EP2867360B1 (en) Designed ankyrin repeat proteins binding to platelet-derived growth factor
WO2015178689A1 (ko) 상피세포 성장인자 수용체의 세포외 도메인과 결합하는 신규 폴리펩타이드
EA013506B1 (ru) Антитело к il-23 и его применение
EP1539207A1 (en) Treatment of cell proliferative disorders with chlorotoxin
KR102582417B1 (ko) 인플라마솜 어댑터 단백질(asc)의 중합체화 도메인에 결합하는 신규한 폴리펩타이드 및 이의 용도
WO2016018133A1 (ko) 보체 단백질 C5a와 결합할 수 있는 신규한 폴리펩타이드 및 그 용도
US10017570B2 (en) Repebody for novel interleukin-6 and use thereof
WO2016204341A1 (ko) 신규한 혈관내피세포 성장인자와 결합할 수 있는 폴리펩타이드 및 이의 용도
KR101517196B1 (ko) 신규한 인터루킨-6 결합 폴리펩타이드 및 이의 용도
CN118206662A (zh) 一种靶向Her2的新型单克隆抗体及其应用
CN114133432B (zh) 一种抑制肿瘤细胞生长和转移的靶向肽及其应用
KR102056386B1 (ko) 브루톤티로신키나아제의 SH2 도메인(Src homology 2 domain)에 선택적으로 결합하는 신규한 폴리펩티드 및 이의 용도
EP0953572A2 (en) Peptides binding to bone marrow stromal cell antigen
KR20230146025A (ko) 신규 바이사이클릭 펩티드
WO2021040336A1 (ko) 사람의 프로그램된 세포사멸 단백질(pd-1)에 선택적으로 결합하는 신규한 폴리펩티드 및 이의 용도
KR102280725B1 (ko) 인간 b 세포 림프종-2 단백질에 선택적으로 결합하는 신규한 폴리펩타이드 및 이의 용도
KR102690857B1 (ko) 제2형 중증급성호흡기증후군 코로나바이러스의 수용체 결합 도메인 (SARS-CoV2 RBD)에 선택적으로 결합하는 신규한 폴리펩티드 및 이의 용도
CN116785402B (zh) 预防和/或治疗乳腺癌的多肽及其应用
CA3133147A1 (en) Core master regulators of glioblastoma stem cells
CN116789751B (zh) 预防和/或治疗纤维化疾病的多肽及其应用
KR101510831B1 (ko) 항 il-6r 및 tnfr2을 포함하는 이중특이적 단백질을 발현하는 미니서클 벡터를 포함하는 줄기세포 치료제
WO2022010254A1 (ko) 인간 상피세포 증식인자 수용체 2형의 도메인 4에 특이적으로 결합하는 신규 폴리펩티드 및 이의 용도
WO2021158092A2 (ko) 보체 단백 분해 산물 c3a와 결합할 수 있는 신규한 폴리펩타이드 및 이의 용도
CN118878624A (zh) 靶向表皮生长因子受体的多肽
Niyogi and recommend its acceptance

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 15795340

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 15310585

Country of ref document: US

NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 15795340

Country of ref document: EP

Kind code of ref document: A1