WO2015158365A1 - Treatment of myotonic dystrophy - Google Patents
Treatment of myotonic dystrophy Download PDFInfo
- Publication number
- WO2015158365A1 WO2015158365A1 PCT/EP2014/057553 EP2014057553W WO2015158365A1 WO 2015158365 A1 WO2015158365 A1 WO 2015158365A1 EP 2014057553 W EP2014057553 W EP 2014057553W WO 2015158365 A1 WO2015158365 A1 WO 2015158365A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- mbnl
- act3
- modified
- splicing
- polypeptide
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/1703—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- A61K38/1709—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
- A61K48/005—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the 'active' part of the composition delivered, i.e. the nucleic acid delivered
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
- A61K48/0075—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the delivery route, e.g. oral, subcutaneous
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P21/00—Drugs for disorders of the muscular or neuromuscular system
Definitions
- the present invention relates to compositions and methods for treating myotonic dystrophy.
- DM1 Myotonic dystrophy type 1
- UTR 3' untranslated region
- DMPK dystrophia myotonica protein kinase
- Clinical features of DM1 are variable but commonly include myotonia, progressive muscle weakness and atrophy as well as cardiac conduction defects but also extra-muscular symptoms such as cognitive dysfunctions, cataract, hypogonadism and endocrine deficiencies (Harper 2001).
- RNAs containing expanded CUG repeats located in the 3 ' UTR of the DMPK transcripts, which are responsible for a toxic RNA gain-of- function mechanism in DM1 pathogenesis (Klein et al. 201 1).
- CUGexp-RNAs that are retained in nuclei as discrete aggregates or foci alter the function of RNA splicing factors members of the MBNL and CELF families resulting in alternative splicing misregulation of a specific group of transcripts in affected DM1 tissues (Taneja et al. 1995; Ranum and Cooper 2006).
- Abnormal regulation of splicing events leads mainly to the re-expression of a fetal splicing pattern in DM1 adult tissues, and missplicing events affecting the CLC-1 , INSR and BIN1 pre-mRNAs have been associated respectively with myotonia, insulin resistance and muscle weakness (Savkur et al. 2001; Charlet et al. 2002; Mankodi et al. 2002; Fugier et al. 2011).
- MBNLl is a member of the muscleblind-like RNA-binding protein family including MBNLl, -2 and -3 (Pascual et al. 2006), and is the major MBNL protein expressed in adult skeletal muscle (Kanadia et al. 2003; Holt et al. 2009).
- MBNLl like the other MBNL protein paralogues binds to expanded CUG repeats with high affinity, and colocalizes with nuclear foci of CUGexp-RNA in DM1 muscle cells (Miller et al. 2000; Fardaei et al. 2001).
- Mbnll knockout mice reproduces most of the deregulated splicing events observed in muscle samples of DM1 patients or DM1 mouse model expressing CUGexp- RNAs (Mankodi et al. 2000; Kanadia et al. 2003; Lin et al. 2006; Du et al. 2010).
- the purpose of the present invention is to provide new tools and methods for myotonic dystrophy treatment.
- the present invention is based on the evidence provided herein that a modified MBNL polypeptide ectopically expressed, in particular through the use of viral vectors, is effective to counteract CUGexp-RNA toxicity both in vitro and in vivo.
- An aspect of this invention relates to a modified MBNL polypeptide.
- the modified MBNL polypeptide of the invention shares the YGCY binding property of MBNL but its splicing activity is reduced when compared to the full-length MBNL protein.
- the modified MBNL polypeptide of the invention is able to bind pathological CUG repeat.
- the modified MBNL polypeptide can counteract the CUGexp-RNA toxicity and restore the function of several MBNL paralogues such as MBNLl and MBNL2.
- the modified MBNL polypeptide of the present invention is used in the treatment of myotonic dystrophies.
- Another aspect relates to a method for treating myotonic dystrophies, comprising administering to a subject in need thereof an effective amount of a modified MBNL polypeptide according to the invention.
- a further aspect of the invention is the use of a modified MBNL polypeptide as described herein, for the manufacture of a medicament for use in the treatment of myotonic dystrophies.
- modified MBNL polypeptide for displacing MBNL 1 from CUG repeats in a cell or organism in need thereof, and thereby reversing deregulated splicing events induced by the CUGexp-RNA expression.
- the modified MBNL polypeptide is provided to the cell or organism using a viral vector.
- Fig 1 Genomic DNA organization of human MBNLl gene. Order and names of exons are shown as well as the length in nucleotides of each exon. Clear gray boxes represent UTR. Color boxes represent cassette exons. Empty boxes represent constitutive exons. Alternative splicing of MBNLl alternative cassettes leads to more than ten isoforms including MBNL 143 or MBNLl 40. The length in amino acids (aa) is indicated and the Dark gray boxes represent C 3 H1 zinc finger motifs. Two are located in MBNLl exon 2 and the two others are located in MBNLl exon 4.
- the modified MBNLl polypeptide (herein referred as ACT3) is the truncated MBNLl construct lacking the C-terminal domain of following the fourth C 3 H1 zinc finger motif.
- Fig 2 ACT3 colocalizes with nuclear CUGexp-RNA aggregates in vitro.
- GFP, GFP-ACT3 or GFP-MBNL140 constructs were co-transfected with 960CTG repeats in Hela cells.
- CUGexp- RNA foci were visualized by FISH using a Cy3-CAG7 probe.
- Fig 3 Expression of various MBNL1 iso forms as well as ACT3 construct restores DM1 deregulated splicing of Tau exon 2/3 minigene.
- the Tau exon 2/3 minigene comprises the two alternate cassettes 2 and 3 insert in the psvIRB splicing reporter minigene (Tran et al. 2011).
- MBNL1 35 or 38 or 41 or 43 isoforms (panel A) or GFP-ACT3 panel B) were co-expressed with Tau exon 2/3 minigene and a plasmid containing 960 interrupted CTG repeats in Hela cells, as previously described (Tran et al. 2011).
- the percentage of inclusion of Tau E2 was calculated and established following RT-PCR using primers surrounding Tau exon 2 and exon 3.
- Fig 4 Nuclear localization of ACT3 is required to modulate splicing events.
- ACT3 is able to displace MBNL1 from CUG repeats in vitro.
- Recombinant MBNL1 40 (or ACT3) protein was cross-linked to in vitro transcribed 32 P RNA containing 95 CUG repeats in the absence or presence of incremental concentrations of recombinant ACT3 (MBNL1 40 ) protein.
- Fig 6 ACT3 colocalizes with nuclear CUGexp-RNA in human DM1 muscle cells. Primary DM1 muscle cells were transduced with lentiviral vectors containing the cDNA encoding the GFP-ACT3. CUGexp-RNA foci were visualized by FISH using a Cy3-CAG 7 probe.
- Fig 7 ACT3 normalizes missplicing events in differentiated human DM1 muscle cells.
- Primary human DM1 and non-DMl muscle cells were transduced or not with lentiviral vectors expressing GFP-ACT3 or GFP alone.
- Splicing profile of BIN1 exon 11, LDB3 exon 7 and DMD exon 78 transcripts were analyzed by RT-PCR.
- Fig 8 Intramuscular injection of adeno-associated virus of serotype 9 (AAV9) containing the GFP-ACT3 encoding cDNA normalizes splicing misregulations in DM 1 mice.
- AAV9 adeno-associated virus of serotype 9
- Fig 9 GFP-ACT3 colocalizes with nuclear CUGexp-RNA foci in vivo. FISH-IF were performed to detect CUGexp-RNA foci and GFP-ACT3 on muscle sections of HSA-LR mice injected with AAV9 GFP-ACT3.
- Fig 10 GFP-ACT3 displaces Mbnll from nuclear CUGexp-RNA foci in vivo.
- FISH-IF were performed to detect CUGexp-RNA foci, endogenous Mbnll and GFP-ACT3 on muscle sections of HSA-LR mice injected with AAV9 GFP-ACT3 or saline. The peak of intensity for each component was measured along an arbitrary lane crossing foci observed within the nucleus.
- Fig 13 Expression of AAV9 GFP-ACT3 alone did not deregulate alternative splicing in wt mice.
- Fig 14 Intramuscular injection of AAV9 GFP-ACT3 normalises splicing misregulations in DM1 mice.
- Fig 15 restores MBNL2-splicing dependent events.
- MBNL constructs (MBNLl, panel A ; MBNL2, panel B ; ACT3, panel C) were co-expressed with hTau exon2 minigene and 960 CTG repeats in T98G cells, as described in (Carpentier et al., 2014).
- Inclusion of Tau E2 was analyzed by RT-PCR. The graph indicates the percentage of Tau exon 2 exclusion (averaged ⁇ S.E.M. for at least three independent experiments). Significant differences are indicated by asterisks: *, p ⁇ 0.05; **, p ⁇ 0.01, ***, p ⁇ 0.001.
- 18S transcripts were used as internal controls to verify the amounts of RNA.
- the efficiency of DT960 transfection was verified by RT-PCR of the 3'UTR of the human DMPK gene.
- Panel D shows the mutant MBNLl sites that have been mutated (bold grey) in the Mut MBNL construct
- the modified MBNL polypeptide of the invention is able to bind the MBNL YGCY RNA- motif, with "Y” representing a pyrimidine (uridine or cytosine).
- the modified MBNL polypeptide of the invention is able to bind UGCU-motif, which is the building block of the pathological DM1 expanded CUG repeats.
- the modified MBNL polypeptide of the invention includes the amino acids corresponding to exon 3 of the MBNLl mRNA (accession number NM_021038).
- the modified MBNL polypeptide of the invention lacks the amino acids of SEQ ID NO: l (SEQ ID NO: l : TQSAVKSL RPLEATFDLGIPQAVLPPLPKRPALEKTNGATAVFNTGIFQYQQALAN MQLQQHTAFLPPGSILCMTPATSVVPMVHGATPATVSAATTSATSVPFAATTANQIPII SAEHLTSHKYVTQM) corresponding to exons 5 to 10 of the MBNLl mRNA.
- SEQ ID NO: l TQSAVKSL RPLEATFDLGIPQAVLPPLPKRPALEKTNGATAVFNTGIFQYQQALAN MQLQQHTAFLPPGSILCMTPATSVVPMVHGATPATVSAATTSATSVPFAATTANQIPII SAEHLTSHKYVTQM
- MBNL denotes all paralogue members of the muscleblind-like RNA-binding protein family and includes in particular MBNLl, -2 and -3.
- the modified MBNL polypeptide according to the invention is derived from the human MBNLl protein sequence.
- the modified MBNL polypeptide is a MBNLl protein having the exon 3 encoding sequence but lacking the encoding sequences of exons 5 to 10 of the MBNL1 protein.
- the MBNL 1 -derived polypeptide is referred to as ACT3 having the following amino acid sequence:
- a "functional variant" of the modified MBNL polypeptide of the invention is a protein having the same or similar binding properties to the YGCY motif, in particular to CUG repeats, as the wild-type MBNL protein it is derived from (in particular MBNL1, 2 or 3) or as the modified MBNL protein of SEQ ID NO: 2 as shown above, and having a reduced splicing activity as compared to the wild-type MBNL protein.
- the functional variant according to the invention may have a sequence at least 50 %, in particular at least 60%, 70 %, 80 %, 90 % and more particularly at least 95 % or even at least 99 % identical to the amino acid sequence corresponding to exons 1 to 4 of the wild-type MBNL protein (e.g. of MBNL1, 2 or 3) or to the amino acid sequence shown in SEQ ID NO: 2.
- the invention further relates to a pharmaceutical composition comprising the modified MBNL polypeptide of the invention.
- Another aspect of the invention is a nucleic acid sequence comprising or consisting of a nucleotide sequence encoding a modified MBNL polypeptide according to the invention.
- the invention further relates to a genetic construct consisting of or comprising a nucleotide sequence as defined herein, and regulatory sequences (such as a suitable promoter(s), enhancer(s), terminator(s), etc ..) allowing the expression (e.g. transcription and translation) of a modified MBNL polypeptide according to the invention in a host cell.
- the genetic constructs of the invention may be DNA or RNA, and are preferably double-stranded DNA.
- the genetic constructs of the invention may also be in a form suitable for transformation of the intended host cell or host organism, in a form suitable for integration into the genomic DNA of the intended host cell or in a form suitable for independent replication, maintenance and/or inheritance in the intended host organism.
- the genetic constructs of the invention may be in the form of a vector, such as for example a plasmid, cosmid, YAC, a viral encoding vector or transposon.
- the vector may be an expression vector, i.e. a vector that can provide for expression in vitro and/or in vivo (e.g. in a suitable host cell, host organism and/or expression system).
- a genetic construct of the invention comprises i) at least one nucleic acid sequence of the invention; operably linked to ii) one or more regulatory elements, such as a promoter and optionally a suitable terminator; and optionally also iii) one or more further elements of genetic constructs such as 3'- or 5'-UTR sequences, leader sequences, selection markers, expression markers/reporter genes, and/or elements that may facilitate or increase (the efficiency of) transformation or integration or subcellular localization or expression of the modified MBNL polypeptide.
- regulatory elements such as a promoter and optionally a suitable terminator
- further elements of genetic constructs such as 3'- or 5'-UTR sequences, leader sequences, selection markers, expression markers/reporter genes, and/or elements that may facilitate or increase (the efficiency of) transformation or integration or subcellular localization or expression of the modified MBNL polypeptide.
- the genetic construct corresponds to the genome of a recombinant viral vector.
- Suitable viral vectors used in practicing the present invention include retroviruses, lentiviruses, adenoviruses and adeno-associated viruses.
- the invention relates to a lentivirus comprising a nucleic acid sequence encoding a modified MBNL polypeptide according to the invention.
- the invention relates to an AAV vector, in particular an AAV1, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV10 or AAVl l vector, in particular an AAV9 vector, comprising a nucleic acid sequence encoding a modified MBNL protein according to the invention.
- the AVV vector may be a pseudotyped vector, i.e. its genome and its capsid may be derived from different AAV serotypes.
- the genome may be derived from an, AAV2 genome and its capsid proteins may be of the AAV1, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV10 or AAV11 serotype.
- Another aspect relates to a modified MBNL polypeptide according to the invention, for use as a medicament.
- the modified MBNL polypeptide of the invention is an useful therapeutic agent, in particular in the treatment of a disease or disorder linked to a sequestration of a MBNL protein, or to a deregulated function of a MBNL member such as MBNL1, or other paralogue members (including MBNL2 and MBNL3).
- the modified polypeptide of the invention is used for the treatment of a myotonic dystrophy such as DM1 and DM2, or any disease where a loss of MBNL function (e.g. sequestration, aggregation, mutations...) may be rescued by ectopic delivery of the modified MBNL polypeptide of the invention.
- the invention relates to a modified MBNL polypeptide as described above, for use in a method for the treatment of a myotonic dystrophy.
- treatment includes curative and/or preventive treatment. More particularly, curative treatment refers to any of the alleviation, amelioration and/or elimination, reduction and/or stabilization (e.g., failure to progress to more advanced stages) of a symptom, as well as delay in progression of a symptom of a particular disorder.
- Preventive treatment refers to any of: halting the onset, delaying the onset, reducing the development, reducing the risk of development, reducing the incidence, reducing the severity, as well as increasing the time to onset of symptoms and survival for a given disorder.
- a method for treating myotonic dystrophies in a subject in need thereof comprises administering said patient with a modified MBNL polypeptide according to the invention, or with a nucleic acid sequence encoding said modified MBNL polypeptide.
- subject or “patient” means a mammal, particularly a human, whatever its age or sex, suffering of a myotonic dystrophy.
- the term specifically includes domestic and common laboratory mammals, such as non-human primates, felines, canines, equines, porcines, bovines, goats, sheep, rabbits, rats and mice.
- the patient to treat is a human being, including a child or an adolescent.
- the modified MBNL polypeptide, the nucleic acid, the genetic construct, or the viral vector may be formulated by methods known in the art.
- any route of administration may be envisioned.
- the modified MBNL polypeptide, the nucleic acid, the genetic construct and the viral vector may be administered by any conventional route of administration including, but not limited to oral, pulmonary, intraperitoneal (ip), intravenous (iv), intramuscular (im), subcutaneous (sc), transdermal, buccal, nasal, sublingual, ocular, rectal and vaginal.
- administration directly to the nervous system may include, and are not limited to, intracerebral, intraventricular, intracerebroventricular, intrathecal, intracistemal, intraspinal or peri-spinal routes of administration by delivery via intracranial or intravertebral needles or catheters with or without pump devices.
- the subject is administered a viral vector encoding a modified MBNL polypeptide according to the invention by the intramuscular route.
- the vector is an AAV vector as defined above, in particular an AAV9 vector.
- the subject receives a single injection of the vector.
- control release preparations can include appropriate macromolecules, for example polymers, polyesters, polyamino acids, polyvinyl, pyrolidone, ethylenevinylacetate, methyl cellulose, carboxymethyl cellulose or protamine sulfate.
- the pharmaceutical composition may comprise nanoparticles that contain the modified MBNL polypeptide of the present invention.
- the plasmid containing the 3'UTR of DMPK with 960 interrupted CTGs was a minigene vector also under the control of the CMV promoter (kindly gift from T. Cooper, Baylor College of Medecine, Houston TX, USA).
- the sequence of MBNL1 full-length variant constructs and truncated ACT3 used in this study were previously described (Tran et al. 2011).
- NES was derived from the REV protein of HIV (Fischer et al. 1995) and fused to the ACT3 construct.
- MBNL1, ACT3 and ACT3-NES splicing activity was assessed using three minigenes previously described: the RTB300 minigene containing exon 5 of human cTNT (hcTNT); the INSR minigene containing exon 11 of human insulin receptor and the pSVIRB/Tau minigene containing exons 2 and 3. All plasmids DNA were double-strand sequenced at GATC Biotech (France) and purified using the Nucleobond® AX endotoxin free kit (Macherey Nagel, Germany).
- the cDNA coding for GFP-ACT3 or for the GFP protein containing both a ozak consensus sequence were cloned in the SIN-cPPT-PGK-WHV or pSMD2 transfer vectors.
- Lentiviral and AAV9 vectors were obtained as previously described (Caillierez et al. 2013; Francois et al. ; Fugier et al. 201 1) and stored frozen at -80°C.
- Recombinant GST-MBNL1 and ACT3 proteins were produced and UV-cross-linking experiments performed as describe before (Laurent et al. 2012, Tran et al. 201 1).
- the hTau E2 minigene consists of exon 1 , exon 2 and exon 4 sequences of the human MAPT gene inserted into the pEGFP l eucaryote expression vector (Clontech).
- the exon 2 is preceded and followed by 878 and 2100 nucleotides of the intronic sequences 2 and 3 of the human MAPT gene, respectively (detailed in Carpentier et al., 2014).
- the Seq250 E2 250 MBNL1 mutated sites in figure 15D represents the 250 nucleotides of the intronic sequences surrounding exon 2 for which the MBNL binding sites are mutated (sequences in bold grey).
- This mutant minigene is no more responsive to MBNL splicing regulatory activity.
- These minigenes were generated by GeneArt®, Gene Synthesis company, and the sequence of plasmid preparation was verified by double strand sequence by GATC (Biotech, Constance, Germany).
- HeLa cells were grown in monolayer cultures in 6 well plates in Dulbecco's Modified Essential Medium (DMEM) (Invitrogen) supplemented with 10% fetal calf serum (FBS) at 37°C in a humidified CO 2 (5%) incubator. Cells grown to ⁇ 70% confluence were transiently co-transfected with ⁇ g of minigene plasmid DNA, ⁇ g of CUG repeats and 3 ⁇ g of MBNL plasmid DNA in triplicate, using FuGENE HD transfection reagent (Roche Diagnostics) according to the manufacturer's instructions.
- DMEM Dulbecco's Modified Essential Medium
- FBS fetal calf serum
- Wild-type (WT) and DM1 myoblasts were grown in HAM's F10 medium supplemented with 20 % FBS and 5 ⁇ g/mL gentamycin (Invitrogen), at 5% C02 and 37°C. lOOng ⁇ 24/ ⁇ 1 were used to transduce 2xl0 5 human muscle cells. Vector transduction was performed overnight in the presence of 4 ⁇ g/ml of polybrene (Sigma). To trigger differentiation, growth medium was removed from subconfluent cultures and replaced by DMEM medium supplemented with 10 ⁇ g/mL insulin (Sigma).
- HSA-LR mice were obtained from C. Thornton and control FVB mice from Janvier. All mouse procedures were done according to experimental protocols approved by the Ethic Committee on Animal Resources at the Centre d'Exploration Fonctionnelle of Pitie- Salpetriere animal facility and under appropriate biological containment.
- the gastronemius or tibialis anterior muscles of adult mice were injected respectively with 30 to 100 ⁇ of physiological solution containing or not AAV9 vectors.
- one muscle was injected with AAV GFP-ACT3 and the contralateral muscle was injected with control AAV containing any transgene (MCS) or GFP or vehicle alone (PBS).
- FISH Fluorescent in situ hybridization
- Fluorescent in situ hybridization was done as described using a Cy3-labeled 2-0- methyl RNA (CAG)7 probe.
- Combined FISH-immunofluorescence (IF) experiment was done as described (Francois et al.) using polyclonal MBNL1 (Everest Biotech.) or GFP (Invitrogen) antibodies followed respectively by secondary Cy5- or Alexa 488-conjugated antibodies. Pictures were captured using a Leica confocal microscope and software (Leica microsytems), and processed with ImageJ software. Immunofluorescence on muscle section was done as described using embryonic MyHC (Novocastra) and Laminin (Novocastra) antibodies.
- GFP- ACT3 colocalizes with the nuclear foci of CUGexp-RNA as observed for the full length MBNLl .
- a splicing reporter minigene in Hela cells Fig 3
- inclusion of Tau exon 2 is significantly reduced as observed in DM1 patients, and over-expression of various MBNLl isoforms that have similar splicing activities (Tran et al. 201 1) restores partially Tau exon 2 inclusion (Fig 3 A).
- the GFP-ACT3-NES has a complete cytoplasmic localization when compared to GFP-ACT3, which displayed a nucleo-cytoplasmic localization (Fig 4A). Due to efficient nuclear export and exclusive cytoplasmic localization, GFP-ACT3-NES has no more residual splicing activity as shown using hcTNT exon 5 and IR exon 11 minigenes (Fig 4B). By contrast, co-expression of GFP-ACT3-NES with CUG repeats and Tau exons 2/3 splicing reporter minigenes is still able to restore a normal splicing of Tau as observed previously with the full length MBNLl and GFP-ACT3 ( Figure 4C).
- GFP-ACT3-NES colocalizes with the CUGexp-RNA foci but the free remaining unbound GFP-ACT3-NES is efficiently exported out of the nucleus, and therefore is no more available for alternative splicing regulation. All together, our results indicate that ACT3 reverses the deregulated splicing events in the presence of pathogenic CUG repeats by saturating the CUG binding sites and releasing sufficient quantity of functional MBNL 1 from the CUGexp-RNA foci.
- recombinant MBNL 1 protein was cross-linked to in vitro transcribed 32 P RNA containing 95 CUG repeats in the absence or presence of growing concentrations of recombinant ACT3 protein, or vise-et-versa (Fig. 5). In both conditions, incremental concentrations of recombinant ACT3 or MBNLl were able to reduced respectively, the amount of recombinant MBNLl or ACT3 indicating that ACT3 is able to compete and displace efficiently MBNLl from CUG repeats.
- GFP-ACT3 significantly normalized the splicing profiles of these transcripts in DM 1 cells, whereas it did not affect their splicing in control non-DMl ceils. These results confirm that expression of GFP-ACT3 is able to reverse molecular changes induced by toxic CUGexp-RNAs in DM1 muscle ceils. Moreover, it also shows that GFP-ACT3 alone does not modify the splicing of endogenous targets.
- ACT The capacity of ACT to neutralize in vivo the RNA toxicity induced by the expanded CUG repeats was next tested in the DM 1 mouse model ( HSA-LR) expressing 220 CTG in the 3'UTR of the human skeletal actin gene (Mankodi et al. 2000). These mice accumulate CUGexp-RNA in the nuclei of their skeletal muscle fibers and display missplicing events as well as myotonia.
- Gastronemius (GAS) muscle of HSA-LR mice was injected intramuscularly with AAV9-GFP-ACT3 vectors whereas contralateral GAS was injected with saline solution.
- mice After 6 weeks, the contraction properties of these muscles were measured in situ, mice were thereafter sacrificed and the muscles were taken for histological and biochemical analysis.
- splicing changes in the HSA-LR mice that are similar to those observed in DM1 patients, we examined the splicing mis regulation of Sercal, Mbnll and Clc-1.
- injection of AAV9-GFP-ACT3 corrected the splicing pattern of these transcripts when compared to HSA-LR contralateral muscles and restores an almost complete normal splicing profile when compared to FVB wt mice.
- Tibialis Anterior (TA) muscles of wt mice were also injected with AAV9-GFP-ACT3 or an empty AAV9-MCS and sacrificed after 3, 4 and 6 weeks (Fig 12). These muscles showed no signs of toxicity or muscle regeneration/degeneration as indicated by the almost absence (less than 1%) of central nuclei, embryonic myosin heavy chain re-expression as well as abnormal size of the muscle fibers.
- splicing profile of genes that are abnormally spliced in DM1 is not perturbed in wt mice by either ACT3 expression or AAV9 transduction (Fig 13).
- injection of AAV9-GFP-ACT3 in TA muscles of HSA-LR mice also corrects the splicing misregulation of several DM1 genes when compared to contralateral muscles injected with empty AAV9-MCS (Fig. 14).
- a CT3 is also able to rescue the defective splicing of Tau exon 2 (Fig 15C).
- the rescue effect observed with either MBNL2 or ACT3 overexpression was abrogated while using a MBNL mutated minigene (Fig 15B and C) with mutated MBNL sites surrounding Tau exon 2 (Fig 15D) demonstrating that the rescue is not independent of MBNL or not due to an indirect effect. Therefore, A CT3 can rescue both MBNLl- and MBNL2 -deregulated splicing events by releasing several MBNL paralogues from expanded CUG repeats.
- ACT3 modified MBNL
- ACT3 modified MBNL
- intramuscular administration of AAV vectors expressing ACT3 proteins corrects both alternative splicing misregulation and myotonia in DM1 mice.
- ACT3 expressing only the RNA-binding domain of MBNLl interacts with the pathogenic CUG repeats and releases sequestered MBNLl from the nuclear CUGexp-RNA foci. This mechanism restores endogenous functional MBNLl in DM1 muscle cells and corrects DM1 -associated phenotypes in vivo.
- ACT3 maintains its ability to bind to CUG repeats and colocalizes with CUGexp-RNA in muscle cells, both in vitro and in vivo.
- ACT3 displaces MBNLl from expanded CUG tracts suggesting that in vivo the binding of ACT3 to pathogenic DM1 repeats is able either to block deleterious interaction of MBNLl as well as other unidentified poly-CUG binding proteins or displace sequestered MBNLl from the nuclear CUGexp-RNA foci.
- release of functional MBNLl will reverse DMl-misregulated events.
- MBNLl is sequestered and co localized with CUGexp- RNA foci in control HSA-LR mice, its localization is less associated with the nuclear foci than ACT3 in HSA-LR injected mice. Sequestration of ACT3 by CUGexp-RNA displaces endogenous MBNLl from these abnormal structures resulting in the correction of MBNLl - misregulated events in the DM1 mice.
- Our AAV-ACT3 strategy is the first gene therapy approach that target CUGexp-RNA to inhibit deleterious of poly-CUG binding proteins and correct their toxic effects in vivo.
- MBNL proteins are almost the only proteins in DM1 human tissue samples that were found sequestered in nuclear foci, and recently, splicing abnormalities present in affected muscles of DM1 patients were mainly associated to functional loss of MBNL 1 (Nakamori et al. 2013). Depletion of functional MBNL splicing factors due to their abnormal binding and sequestration by CUGexp-RNA leads to alternative splicing misregulation of specific subset of transcripts and ultimately to pathological changes in DM1 tissues.
- MBNL 1 -regulated events were associated to DM1 skeletal muscle defects whereas MBNL2-regulated events were misregulated in DM1 brain.
- overexpression of MBNL 1 using AAV vectors is sufficient to reverse missplicing and myotonia in DM1 mice as confirmed by doubly transgenic HSA-LR:MBNLl-OE mice (Kanadia et al. 2006; Chamberlain and Ranum 2012).
- This strategy compensates for the loss of MBNL 1 in DM 1 mice cells by increasing the pool of none sequestered and functional MBNL1.
- MBNL1 isoforms-40 and -41 were successfully overexpressed in muscles however up to 10 different MBNL1 iso forms with various expression profiles and tissue-specific patterns were described.
- missplicing of MBNL 1 it-self that change the MBNL1 isoforms ratio in DM1 tissues is corrected in the muscle tissue of DM1 mice expressing ACT3.
- MBNL1 overexpression can restore or compensate for the loss of other MBNL paralogues such as MBNL2.
- ACT3 will release other MBNL proteins from CUGexp-RNA and correct MBNL-misspliced events in other tissues than skeletal muscle.
- Our in vitro results indicate that ACT3 is most probably able to compensate for the loss of MBNL2 in a DM1 context (Fig. 15).
- HIV-1 Rev activation domain is a nuclear export signal that accesses an export pathway used by specific cellular RNAs.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- General Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Engineering & Computer Science (AREA)
- Animal Behavior & Ethology (AREA)
- Medicinal Chemistry (AREA)
- Pharmacology & Pharmacy (AREA)
- Epidemiology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Biotechnology (AREA)
- Molecular Biology (AREA)
- Genetics & Genomics (AREA)
- Marine Sciences & Fisheries (AREA)
- Zoology (AREA)
- Immunology (AREA)
- Gastroenterology & Hepatology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Physical Education & Sports Medicine (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Organic Chemistry (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Orthopedic Medicine & Surgery (AREA)
- Neurology (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
- Peptides Or Proteins (AREA)
Priority Applications (10)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| PCT/EP2014/057553 WO2015158365A1 (en) | 2014-04-14 | 2014-04-14 | Treatment of myotonic dystrophy |
| US15/303,769 US10799556B2 (en) | 2014-04-14 | 2015-04-14 | Treatment of myotonic dystrophy |
| ES15716781T ES2970841T3 (es) | 2014-04-14 | 2015-04-14 | Polipéptido MBNL para su uso en el tratamiento de la distrofia miotónica |
| PCT/EP2015/058111 WO2015158740A1 (en) | 2014-04-14 | 2015-04-14 | Treatment of myotonic dystrophy |
| CA2944606A CA2944606C (en) | 2014-04-14 | 2015-04-14 | Treatment of myotonic dystrophy |
| EP15716781.8A EP3145529B1 (en) | 2014-04-14 | 2015-04-14 | Mbnl polypeptide for use in the treatment of myotonic dystrophy |
| JP2016562263A JP6953131B2 (ja) | 2014-04-14 | 2015-04-14 | 筋強直性ジストロフィーの処置 |
| US17/037,804 US12503495B2 (en) | 2014-04-14 | 2020-09-30 | Treatment of myotonic dystrophy |
| JP2021042924A JP7739017B2 (ja) | 2014-04-14 | 2021-03-16 | 筋強直性ジストロフィーの処置 |
| JP2023072627A JP7752148B2 (ja) | 2014-04-14 | 2023-04-26 | 筋強直性ジストロフィーの処置 |
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| PCT/EP2014/057553 WO2015158365A1 (en) | 2014-04-14 | 2014-04-14 | Treatment of myotonic dystrophy |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2015158365A1 true WO2015158365A1 (en) | 2015-10-22 |
Family
ID=50588655
Family Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/EP2014/057553 Ceased WO2015158365A1 (en) | 2014-04-14 | 2014-04-14 | Treatment of myotonic dystrophy |
| PCT/EP2015/058111 Ceased WO2015158740A1 (en) | 2014-04-14 | 2015-04-14 | Treatment of myotonic dystrophy |
Family Applications After (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/EP2015/058111 Ceased WO2015158740A1 (en) | 2014-04-14 | 2015-04-14 | Treatment of myotonic dystrophy |
Country Status (6)
| Country | Link |
|---|---|
| US (1) | US10799556B2 (https=) |
| EP (1) | EP3145529B1 (https=) |
| JP (3) | JP6953131B2 (https=) |
| CA (1) | CA2944606C (https=) |
| ES (1) | ES2970841T3 (https=) |
| WO (2) | WO2015158365A1 (https=) |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2021048424A1 (en) | 2019-09-12 | 2021-03-18 | Association Institut De Myologie | Nucleic acid sequence for regulation of transgene expression |
Families Citing this family (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2015158365A1 (en) * | 2014-04-14 | 2015-10-22 | Association Institut De Myologie | Treatment of myotonic dystrophy |
| WO2024249893A1 (en) * | 2023-05-31 | 2024-12-05 | The Trustees Of Columbia University In The City Of New York | Generation of mature neurons differentiated from pluripotent stem cells |
Citations (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2010044894A1 (en) * | 2008-10-15 | 2010-04-22 | 4S3 Bioscience Inc. | Methods and compositions for treatment of myotonic dystrophy |
Family Cites Families (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP2019143A1 (en) * | 2007-07-23 | 2009-01-28 | Genethon | CNS gene delivery using peripheral administration of AAV vectors |
| WO2015158365A1 (en) * | 2014-04-14 | 2015-10-22 | Association Institut De Myologie | Treatment of myotonic dystrophy |
-
2014
- 2014-04-14 WO PCT/EP2014/057553 patent/WO2015158365A1/en not_active Ceased
-
2015
- 2015-04-14 CA CA2944606A patent/CA2944606C/en active Active
- 2015-04-14 US US15/303,769 patent/US10799556B2/en active Active
- 2015-04-14 JP JP2016562263A patent/JP6953131B2/ja active Active
- 2015-04-14 WO PCT/EP2015/058111 patent/WO2015158740A1/en not_active Ceased
- 2015-04-14 ES ES15716781T patent/ES2970841T3/es active Active
- 2015-04-14 EP EP15716781.8A patent/EP3145529B1/en active Active
-
2021
- 2021-03-16 JP JP2021042924A patent/JP7739017B2/ja active Active
-
2023
- 2023-04-26 JP JP2023072627A patent/JP7752148B2/ja active Active
Patent Citations (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2010044894A1 (en) * | 2008-10-15 | 2010-04-22 | 4S3 Bioscience Inc. | Methods and compositions for treatment of myotonic dystrophy |
Non-Patent Citations (47)
| Title |
|---|
| BOTTA, A.; A. MALENA ET AL.: "MBNL142 and MBNL143 gene isoforms, overexpressed in DMl-patient muscle, encode for nuclear proteins interacting with Src family kinases", CELL DEATH DIS, vol. 4, 2013, pages E770 |
| BROOK, J. D.; M. E. MCCURRACH ET AL.: "Molecular basis of myotonic dystrophy: expansion of a trinucleotide (CTG) repeat at the 3' end of a transcript encoding a protein kinase family member", CELL, vol. 69, no. 2, 1992, pages 385 |
| C. M. CHAMBERLAIN ET AL: "Mouse model of muscleblind-like 1 overexpression: skeletal muscle effects and therapeutic promise", HUMAN MOLECULAR GENETICS, vol. 21, no. 21, 1 November 2012 (2012-11-01), pages 4645 - 4654, XP055152726, ISSN: 0964-6906, DOI: 10.1093/hmg/dds306 * |
| CAILLIEREZ R; BEGARD S ET AL.: "Lentiviral delivery of the human wild-type tau protein mediates a slow and progressive neurodegenerative tau pathology in the rat brain", MOL THER., 2013, pages 1358 - 68 |
| CARPENTIER C; GHANEM D ET AL.: "Tau exon 2 responsive elements deregulated in myotonic dystrophy type I are proximal to exon 2 and synergistically regulated by MBNL and MBNL2", BIOCHIM BIOPHYS ACTA, vol. 1842, no. 4, 2014, pages 654 - 664, XP028617178, DOI: doi:10.1016/j.bbadis.2014.01.004 |
| CHAMBERLAIN, C. M.; L. P. RANUM: "Mouse model of muscleblind-like 1 overexpression: skeletal muscle effects and therapeutic promise", HUM MOL GENET, vol. 21, no. 21, 2012, pages 4645 - 54, XP055152726, DOI: doi:10.1093/hmg/dds306 |
| CHARIZANIS, K.; K. Y. LEE ET AL.: "Muscleblind-like 2-mediated alternative splicing in the developing brain and dysregulation in myotonic dystrophy", NEURON, vol. 75, no. 3, pages 437 - 50 |
| CHARLET, B. N.; R. S. SAVKUR ET AL.: "Loss of the muscle-specific chloride channel in type 1 myotonic dystrophy due to misregulated alternative splicing", MOL CELL, vol. 10, no. 1, 2002, pages 45 - 53, XP002691207, DOI: doi:10.1016/S1097-2765(02)00572-5 |
| DU, H.; M. S. CLINE ET AL.: "Aberrant alternative splicing and extracellular matrix gene expression in mouse models of myotonic dystrophy", NAT STRUCT MOL BIOL, vol. 17, no. 2, 2010, pages 187 - 93, XP055147734, DOI: doi:10.1038/nsmb.1720 |
| ERIN PENNOCK FOFF ET AL: "Therapeutics development in myotonic dystrophy type 1", MUSCLE & NERVE, vol. 44, no. 2, 23 August 2011 (2011-08-23), pages 160 - 169, XP055152590, ISSN: 0148-639X, DOI: 10.1002/mus.22090 * |
| FARDAEI, M.; K. LARKIN ET AL.: "In vivo co-localisation Of MBNL protein with DMPK expanded-repeat transcripts", NUCLEIC ACIDS RES, vol. 29, no. 13, 2001, pages 2766 - 71 |
| FISCHER, U.; J. HUBER ET AL.: "The HIV-1 Rev activation domain is a nuclear export signal that accesses an export pathway used by specific cellular RNAs", CELL, vol. 82, no. 3, 1995, pages 475 - 83, XP002055418, DOI: doi:10.1016/0092-8674(95)90436-0 |
| FRANCOIS, V.; A. F. KLEIN ET AL.: "Selective silencing of mutated mRNAs in DM1 by using modified hU7-snRNAs", NAT STRUCT MOL BIOL, vol. 18, no. 1, 2011, pages 85 - 7, XP002642560, DOI: doi:10.1038/NSMB.1958 |
| FUGIER, C.; A. F. KLEIN ET AL.: "Misregulated alternative splicing ofBINl is associated with T tubule alterations and muscle weakness in myotonic dystrophy", NAT MED, vol. 17, no. 6, 2011, pages 720 - 5 |
| FURLING. D; L. COIFFIER ET AL.: "Defective satellite cells in congenital myotonic dystrophy", HUMAN MOLECULAR GENETICS, vol. 10, no. 19, 2001, pages 2079 - 87 |
| GARCIA-LOPEZ, A.; B. LLAMUSI ET AL.: "In vivo discovery of a peptide that prevents CUG-RNA hairpin formation and reverses RNA toxicity in myotonic dystrophy models", PROC NATL ACAD SCI U S A, vol. 108, no. 29, 2011, pages 11866 - 71 |
| H. TRAN ET AL: "Analysis of Exonic Regions Involved in Nuclear Localization, Splicing Activity, and Dimerization of Muscleblind-like-1 Isoforms", JOURNAL OF BIOLOGICAL CHEMISTRY, vol. 286, no. 18, 6 May 2011 (2011-05-06), pages 16435 - 16446, XP055152599, ISSN: 0021-9258, DOI: 10.1074/jbc.M110.194928 * |
| HARPER, P. S.: "Myotonic dystrophy", 2001, W.B. SAUNDER |
| HOLT, I.; V. JACQUEMIN ET AL.: "Muscleblind-like proteins: similarities and differences in normal and myotonic dystrophy muscle", AM J PATHOL, vol. 174, no. 1, 2009, pages 216 - 27 |
| HUNTER, A.; C. TSILFIDIS ET AL.: "The correlation of age of onset with CTG trinucleotide repeat amplification in myotonic dystrophy", J MED GENET, vol. 29, no. 11, 1992, pages 774 - 9 |
| KANADIA, R. N.; J. SHIN ET AL.: "Reversal of RNA missplicing and myotonia after muscleblind overexpression in a mouse poly(CUG) model for myotonic dystrophy", PROC NATL ACAD SCI U S A, vol. 103, no. 31, 2006, pages 11748 - 53, XP008107839, DOI: doi:10.1073/pnas.0604970103 |
| KANADIA, R. N.; K. A. JOHNSTONE ET AL.: "A muscleblind knockout model for myotonic dystrophy", SCIENCE, vol. 302, no. 5652, 2003, pages 1978 - 80, XP002996065, DOI: doi:10.1126/science.1088583 |
| KLEIN, A. F.; E. GASNIER ET AL.: "Gain ofRNA function in pathological cases: Focus on myotonic dystrophy", BIOCHIMIE, vol. 93, no. 11, 2011, pages 2006 - 12, XP028302262, DOI: doi:10.1016/j.biochi.2011.06.028 |
| LAURENT FX; SUREAU A ET AL.: "New function for the RNA helicase p68/DDXS as a modifier of MBNL1 activity on expanded CUG repeats", NUCLEIC ACIDS RES., vol. 40, no. 7, 2012, pages 3159 - 71 |
| LEGER, A. J.; L. M. MOSQUEA ET AL.: "Systemic delivery of a Peptide-linked morpholino oligonucleotide neutralizes mutant RNA toxicity in a mouse model of myotonic dystrophy", NUCLEIC ACID THER, vol. 23, no. 2, 2013, pages 109 - 17 |
| LIN, X.; J. W. MILLER ET AL.: "Failure of MBNLl-dependent post-natal splicing transitions in myotonic dystrophy", HUM MOL GENET, vol. 15, no. 13, 2006, pages 2087 - 97, XP008107835, DOI: doi:10.1093/hmg/ddl132 |
| MANKODI, A.; E. LOGIGIAN ET AL.: "Myotonic dystrophy in transgenic mice expressing an expanded CUG repeat", SCIENCE, vol. 289, no. 5485, 2000, pages 1769 - 73, XP002507412, DOI: doi:10.1126/science.289.5485.1769 |
| MANKODI, A.; M. P. TAKAHASHI ET AL.: "Expanded CUG repeats trigger aberrant splicing of C1C-1 chloride channel pre-mRNA and hyperexcitability of skeletal muscle in myotonic dystrophy", MOL CELL, vol. 10, no. 1, 2002, pages 35 - 44, XP002507411, DOI: doi:10.1016/S1097-2765(02)00563-4 |
| MASUDA, A.; H. S. ANDERSEN ET AL.: "CUGBPl and MBNL1 preferentially bind to 3' UTRs and facilitate mRNA decay", SCI REP, vol. 2, 2012, pages 209 |
| MILLER, J. W.; C. R. URBINATI ET AL.: "Recruitment of human muscleblind proteins to (CUG)(n) expansions associated with myotonic dystrophy", EMBO J, vol. 19, no. 17, 2000, pages 4439 - 48, XP002973031, DOI: doi:10.1093/emboj/19.17.4439 |
| MOUISEL, E.; B. BLONDET ET AL.: "Outcome of acetylcholinesterase deficiency for neuromuscular functioning", NEUROSCI RES, vol. 55, no. 4, 2006, pages 389 - 96, XP024955936, DOI: doi:10.1016/j.neures.2006.05.002 |
| MULDERS, S. A.; W. J. VAN DEN BROEK ET AL.: "Triplet-repeat oligonucleotide-mediated reversal of RNA toxicity in myotonic dystrophy", PROC NATL ACAD SCI USA, vol. 106, no. 33, 2009, pages 13915 - 20, XP055007026, DOI: doi:10.1073/pnas.0905780106 |
| NAKAMORI, M.; K. SOBCZAK ET AL.: "Splicing biomarkers of disease severity in myotonic dystrophy", ANN NEUROL, 2013 |
| PASCUAL, M.; M. VICENTE ET AL.: "The Muscleblind family of proteins: an emerging class of regulators of developmentally programmed alternative splicing", DIFFERENTIATION, vol. 74, no. 2-3, 2006, pages 65 - 80, XP026770166, DOI: doi:10.1111/j.1432-0436.2006.00060.x |
| RANUM, L. P.; T. A. COOPER: "RNA-mediated neuromuscular disorders", ANNU REV NEUROSCI, vol. 29, 2006, pages 259 - 77 |
| RAU, F.; F. FREYERMUTH ET AL.: "Misregulation ofmiR-1 processing is associated with heart defects in myotonic dystrophy", NAT STRUCT MOL BIOL, vol. 18, no. 7, 2011, pages 840 - 5 |
| RIVERA, V. M.; G. P. GAO ET AL.: "Long-term pharmacologically regulated expression of erythropoietin in primates following AAV-mediated gene transfer", BLOOD, vol. 105, no. 4, 2005, pages 1424 - 30, XP002560536, DOI: doi:10.1182/blood-2004-06-2501 |
| SAVKUR, R. S.; A. V. PHILIPS ET AL.: "Aberrant regulation of insulin receptor alternative splicing is associated with insulin resistance in myotonic dystrophy", NAT GENET, vol. 29, no. 1, 2001, pages 40 - 7 |
| SOBCZAK, K.; T. M. WHEELER ET AL.: "RNA interference targeting CUG repeats in a mouse model of myotonic dystrophy", MOL THER, vol. 21, no. 2, 2012, pages 380 - 7 |
| TANEJA, K. L.; M. MCCURRACH ET AL.: "Foci of trinucleotide repeat transcripts in nuclei of myotonic dystrophy cells and tissues", J CELL BIOL, vol. 128, no. 6, 1995, pages 995 - 1002 |
| TRAN, H.; N. GOURRIER ET AL.: "Analysis of exonic regions involved in nuclear localization, splicing activity, and dimerization of Muscleblind-like-1 isoforms", J BIOL CHEM, vol. 286, no. 18, 2011, pages 16435 - 46, XP055152599, DOI: doi:10.1074/jbc.M110.194928 |
| TSILFIDIS, C.; A. E. MACKENZIE ET AL.: "Correlation between CTG trinucleotide repeat length and frequency of severe congenital myotonic dystrophy", NAT GENET, vol. 1, no. 3, 1992, pages 192 - 5 |
| WANG, E. T.; N. A. CODY ET AL.: "Transcriptome-wide regulation of pre-mRNA splicing and mRNA localization by muscleblind proteins", CELL, vol. 150, no. 4, 2012, pages 710 - 24, XP028935063, DOI: doi:10.1016/j.cell.2012.06.041 |
| WARF, M. B.; M. NAKAMORI ET AL.: "Pentamidine reverses the splicing defects associated with myotonic dystrophy", PROC NATL ACAD SCI U S A, vol. 106, no. 44, 2009, pages 18551 - 6 |
| WHEELER, T. M.; A. J. LEGER ET AL.: "Targeting nuclear RNA for in vivo correction of myotonic dystrophy", NATURE, vol. 488, no. 7409, 2012, pages 111 - 5, XP055037666, DOI: doi:10.1038/nature11362 |
| WHEELER, T. M.; J. D. LUECK ET AL.: "Correction of CIC-1 splicing eliminates chloride channelopathy and myotonia in mouse models of myotonic dystrophy", J CLIN INVEST, vol. 117, no. 12, 2007, pages 3952 - 7 |
| WHEELER, T. M.; K. SOBCZAK ET AL.: "Reversal of RNA dominance by displacement of protein sequestered on triplet repeat RNA", SCIENCE, vol. 325, no. 5938, 2009, pages 336 - 9, XP055012134, DOI: doi:10.1126/science.1173110 |
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2021048424A1 (en) | 2019-09-12 | 2021-03-18 | Association Institut De Myologie | Nucleic acid sequence for regulation of transgene expression |
| JP2022548261A (ja) * | 2019-09-12 | 2022-11-17 | アソシエーション・アンスティトゥート・ドゥ・マイオロジー | 導入遺伝子発現の制御のための核酸配列 |
Also Published As
| Publication number | Publication date |
|---|---|
| JP2021101713A (ja) | 2021-07-15 |
| WO2015158740A1 (en) | 2015-10-22 |
| ES2970841T3 (es) | 2024-05-30 |
| US10799556B2 (en) | 2020-10-13 |
| JP2023099082A (ja) | 2023-07-11 |
| JP7752148B2 (ja) | 2025-10-09 |
| EP3145529A1 (en) | 2017-03-29 |
| EP3145529B1 (en) | 2023-11-15 |
| CA2944606A1 (en) | 2015-10-22 |
| US20170035841A1 (en) | 2017-02-09 |
| JP6953131B2 (ja) | 2021-10-27 |
| JP7739017B2 (ja) | 2025-09-16 |
| CA2944606C (en) | 2023-06-27 |
| JP2017511145A (ja) | 2017-04-20 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| JP7416451B2 (ja) | CRISPR-Casによる標的化された核内RNA切断及びポリアデニル化 | |
| Bilsen et al. | Identification and allele-specific silencing of the mutant huntingtin allele in Huntington's disease patient-derived fibroblasts | |
| US20180256752A1 (en) | Selective gene therapy expression system | |
| JP7752148B2 (ja) | 筋強直性ジストロフィーの処置 | |
| KR20210010549A (ko) | 스플라이싱이상을 감소시키고 rna 우성 질환을 치료하기 위한 조성물 및 방법 | |
| CN113710693B (zh) | Dna结合结构域反式激活因子及其用途 | |
| WO2017207979A1 (en) | Inhibitors of srsf1 to treat neurodegenerative disorders | |
| JP2024133570A (ja) | 変異型garsタンパク質の発現を阻害するための生成物および方法 | |
| EP2212348B1 (en) | Materials and methods for gene mediated therapy of psychiatric disorders | |
| US20250302996A1 (en) | Method | |
| TW202221119A (zh) | Dna結合域轉活化子及其用途 | |
| US12503495B2 (en) | Treatment of myotonic dystrophy | |
| WO2023091943A2 (en) | Compositions and methods to prevent, inhibit or treat neurodegenerative diseases | |
| JP7461687B2 (ja) | 筋強直性ジストロフィー1型治療薬 | |
| WO2024036343A2 (en) | Synergistic nucleic acid based therapeutics and methods of use for treating genetic disorders | |
| AU2024359274A1 (en) | Recombinant regulatory sequences and therapeutic regulating of splicing | |
| US20220313843A1 (en) | Nucleic acid sequence for regulation of transgene expression | |
| WO2025080847A1 (en) | Therapeutic regulation of scn1a splicing | |
| WO2026055323A1 (en) | Therapeutic regulation of scn2a splicing | |
| Mastroyiannopoulos et al. | Myotonic Dystrophy Type 1: Focus on the RNA Pathology and Therapy |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 14719675 Country of ref document: EP Kind code of ref document: A1 |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| 122 | Ep: pct application non-entry in european phase |
Ref document number: 14719675 Country of ref document: EP Kind code of ref document: A1 |