WO2015149016A2 - Breast and ovarian cancer vaccines - Google Patents
Breast and ovarian cancer vaccines Download PDFInfo
- Publication number
- WO2015149016A2 WO2015149016A2 PCT/US2015/023161 US2015023161W WO2015149016A2 WO 2015149016 A2 WO2015149016 A2 WO 2015149016A2 US 2015023161 W US2015023161 W US 2015023161W WO 2015149016 A2 WO2015149016 A2 WO 2015149016A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- composition
- acid sequence
- seq
- sequence
- amino acid
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
- A61K39/001102—Receptors, cell surface antigens or cell surface determinants
- A61K39/001103—Receptors for growth factors
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
- A61K39/001102—Receptors, cell surface antigens or cell surface determinants
- A61K39/001103—Receptors for growth factors
- A61K39/001106—Her-2/neu/ErbB2, Her-3/ErbB3 or Her 4/ErbB4
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
- A61K39/001102—Receptors, cell surface antigens or cell surface determinants
- A61K39/001129—Molecules with a "CD" designation not provided for elsewhere
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
- A61K39/001148—Regulators of development
- A61K39/00115—Apoptosis related proteins, e.g. survivin or livin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
- A61K39/001152—Transcription factors, e.g. SOX or c-MYC
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P15/00—Drugs for genital or sexual disorders; Contraceptives
- A61P15/14—Drugs for genital or sexual disorders; Contraceptives for lactation disorders, e.g. galactorrhoea
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/04—Immunostimulants
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
- C07K14/4701—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
- C07K14/4702—Regulators; Modulating activity
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70567—Nuclear receptors, e.g. retinoic acid receptor [RAR], RXR, nuclear orphan receptors
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70596—Molecules with a "CD"-designation not provided for elsewhere
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/71—Receptors; Cell surface antigens; Cell surface determinants for growth factors; for growth regulators
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/62—DNA sequences coding for fusion proteins
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/10—Transferases (2.)
- C12N9/1025—Acyltransferases (2.3)
- C12N9/104—Aminoacyltransferases (2.3.2)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y203/00—Acyltransferases (2.3)
- C12Y203/02—Aminoacyltransferases (2.3.2)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/51—Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
- A61K2039/53—DNA (RNA) vaccination
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/54—Medicinal preparations containing antigens or antibodies characterised by the route of administration
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/57—Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2
- A61K2039/572—Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2 cytotoxic response
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
Definitions
- Cancer therapy has conventionally been accomplished by surgical reduction of a tumor mass and subsequent chemo- and/or radiotherapy. This strategy can reduce the tumor and, in less advanced stages, often results in complete remission. Unfortunately, the prognosis for more advanced tumors has changed little over the past 50 years and a significant proportion of cancer- related deaths are caused by subsequent metastases. New prophylactic and therapeutic treatments are needed to combat the increasing occurrence of cancer.
- compositions described herein include, in some aspects, a composition
- a first plasmid comprising a first nucleotide sequence, the first nucleotide sequence encoding a first epitope of a first antigen expressed by cells associated with breast cancer; and a second nucleotide sequence, the second nucleotide sequence encoding a second epitope of a second antigen expressed by cells associated with breast cancer, wherein the first nucleotide sequence and the second nucleotide sequence are located in one or more plasmids.
- the disclosure includes a composition comprising: a first plasmid comprising a first nucleotide sequence, the first nucleotide sequence encoding a first epitope of a first antigen, the first epitope is a portion of an HIF- ⁇ peptide, wherein the first nucleotide sequence is located in a plasmid.
- the disclosure includes a composition comprising: a first plasmid comprising a first nucleotide sequence, the first nucleotide sequence encoding a first epitope of a first antigen; and a second nucleotide sequence, the second nucleotide sequence encoding a second epitope of a second antigen, wherein the first and the second epitopes are portions of an HIF- ⁇ peptide, wherein the first nucleotide sequence and the second nucleotide sequence are located in one or more plasmids.
- compositions described herein include, in some aspects, a composition
- a first plasmid comprising a first nucleotide sequence, the first nucleotide sequence encoding a first epitope of a first antigen, the first epitope is a portion of a peptide selected from: CD105, Yb-1, SOX-2, CDH3 or MDM2, wherein the first nucleotide sequence is located in a plasmid.
- the disclosure includes a composition comprising: a first plasmid comprising a first nucleotide sequence, the first nucleotide sequence encoding a first epitope of a first antigen; and a second nucleotide sequence, the second nucleotide sequence encoding a second epitope of a second antigen, wherein the first and the second epitopes are independently selected from: CD105, Yb-1, SOX-2, CDH3 or MDM2, wherein the first nucleotide sequence and the second nucleotide sequence are located in one or more plasmids.
- compositions described herein include, in some aspects, a composition
- a first plasmid comprising a first nucleotide sequence, the first nucleotide sequence encoding a first epitope of a first antigen, the first epitope is a portion of a peptide selected from: IGFBP-2, HER-2, IGF-1R, wherein the first nucleotide sequence is located in a plasmid.
- the disclosure includes a composition comprising: a first plasmid comprising a first nucleotide sequence, the first nucleotide sequence encoding a first epitope of a first antigen; and a second nucleotide sequence, the second nucleotide sequence encoding a second epitope of a second antigen, wherein the first and the second epitopes are independently selected from: IGFBP-2, HER-2 or IGF-1R, wherein the first nucleotide sequence and the second nucleotide sequence are located in one or more plasmids.
- compositions described herein include, in some aspects, a composition
- the disclosure includes a composition comprising: at least a first epitope of a first antigen, the first epitope is a portion of a peptide from HIF- ⁇ .
- the disclosure includes, a composition comprising: at least a first epitope of a first antigen, at least a second epitope of a second antigen, the first and the second epitopes are from HIF-l .
- the disclosure includes a composition comprising: at least a first epitope of a first antigen, the first epitope is a portion of a peptide selected from: CD105, Yb-1, SOX-2, CDH3 or MDM2.
- the disclosure includes a composition
- first and the second epitopes are independently selected from: CD105, Yb-1, SOX- 2, CDH3 or MDM2.
- the disclosure includes a composition that comprises an isolated and purified plasmid comprising a nucleotide sequence encoding a polypeptide, wherein the polypeptide comprises a plurality of epitopes; and an excipient.
- the plurality of epitopes comprises one or more epitopes comprising at least 90% sequence identity to an amino acid sequence selected from SEQ ID NOs: 1, 6, 8-10, 14-16, 20, 25-28, 32-34, 46-56, 60-62, 66- 75, 82-85, and 87.
- the isolated and purified plasmid may further comprise a first nucleotide sequence encoding a first epitope of a first antigen expressed by cells associated with breast cancer.
- the composition further comprises a second nucleotide sequence encoding a second epitope of a second antigen expressed by cells associated with breast cancer.
- the first nucleotide sequence and the second nucleotide sequence may be located in one or more isolated and purified plasmids.
- the first epitope and the second epitope may independently be selected from a portion of an HIF- ⁇ peptide comprising at least 90% sequence identity to an amino acid sequence selected from SEQ ID NOs: 82-84.
- the first and the second epitopes may independently be selected from: CD105, Yb-1, SOX-2, CDH3 or MDM2, wherein the first nucleotide sequence and the second nucleotide sequence are located in one or more isolated and purified plasmids.
- the first and the second epitopes may independently be selected from:
- first nucleotide sequence and the second nucleotide sequence are located in one or more isolated and purified plasmids.
- the first and the second nucleic acid sequences may be located on the first isolated and purified plasmid.
- the second nucleic acid sequence may be located on a second isolated and purified plasmid.
- the disclosure includes a composition that comprises a first epitope of a first antigen expressed by cells associated with breast cancer or ovarian cancer; and a second epitope of a second antigen expressed by cells associated with breast cancer or ovarian cancer; wherein the first and the second epitopes independently comprise at least 90% sequence identity to an amino acid sequence selected from SEQ ID NOs: 1, 6, 8-10, 14-16, 20, 25-28, 32-34, 46- 56, 60-62, 66-75, 82-85, and 87.
- the disclosure includes a composition that comprises a plasmid comprising at least one nucleotide sequence encoding a polypeptide comprising at least 70% sequence identity to an epitope sequence selected from SEQ ID NOs: 54, 73, 85, and 87; and an excipient.
- the disclosure includes a composition that comprises a plasmid comprising four nucleotide sequences, wherein each of the four nucleotide sequences independently encodes a polypeptide comprising at least 70% sequence identity to an epitope sequence selected from SEQ ID NOs: 54, 73, 85, and 87; and an excipient.
- the disclosure includes a composition that comprises a plasmid comprising a nucleotide sequence encoding a polypeptide comprising at least 80% sequence identity to SEQ ID NO: 89; and an excipient.
- the disclosure includes a composition that comprises a polypeptide comprising at least 80% sequence identity to SEQ ID NO: 89.
- compositions described herein a method of administering one or more of the compositions described herein to a subject is disclosed herein.
- the subject may be in need thereof of one or more of the composition.
- a method of preventing breast cancer or ovarian cancer in a subject comprises administering a composition described herein to the subject.
- the cancer may be ovarian cancer.
- the cancer may be breast cancer.
- a method of preventing breast cancer in a subject is described herein, in which the method comprises administering a composition described herein to the subject.
- a method of treating breast cancer or ovarian cancer in a subject comprises administering a composition described herein to the subject.
- the cancer may be ovarian cancer.
- the cancer may be breast cancer.
- a method of treating breast cancer in a subject is described herein, in which the method comprises administering a composition described herein to the subject.
- the administering further comprises delivery of at least one dose of a composition described herein to the subject.
- the administering further comprises delivery of a composition described herein to the subject by subcutaneous injection, intradermal injection, intramuscular injection, intravascular injection, topical application or inhalation.
- a method of producing an immune response in a subject having a breast cancer or ovarian cancer comprises administering to the subject a composition described herein.
- the disclosure further includes an isolated and purified plasmid comprising at least one nucleotide sequence encoding a polypeptide comprising at least 90% sequence identity to an epitope sequence selected from SEQ ID NOs: 82-84.
- the isolated and purified plasmid may comprise a set of two or more nucleotide sequences in which each of the two or more nucleotide sequences independently encodes a polypeptide comprising at least 90% sequence identity selected from SEQ ID NOs: 82-84.
- the isolated and purified plasmid may comprise a set of two or more nucleotide sequences in which each of the two or more nucleotide sequences encodes a polypeptide comprising at least 90% sequence identity selected from SEQ ID NOs: 82-84; and each of the nucleotides are not identical within the set of two or more nucleotide sequences.
- the disclosure may also include an isolated and purified plasmid comprising at least one nucleotide sequence encoding a polypeptide comprising at least 90% sequence identity to an epitope sequence selected from SEQ ID NOs: 1, 6, 8-10, 14-16, 20, 25-28, and 32-34.
- the isolated and purified plasmid may comprise a set of two or more nucleotide sequences in which each of the two or more nucleotide sequences independently encodes a polypeptide comprising at least 90% sequence identity selected from SEQ ID NOs: 1, 6, 8-10, 14-16, 20, 25-28, and 32- 34.
- the isolated and purified plasmid may comprise a set of two or more nucleotide sequences in which each of the two or more nucleotide sequences encodes a polypeptide comprising at least 90% sequence identity selected from SEQ ID NOs: 1, 6, 8-10, 14-16, 20, 25-28, and 32-34; and each of the nucleotides are not identical within the set of two or more nucleotide sequences.
- the disclosure may include an isolated and purified plasmid comprising at least one nucleotide sequence encoding a polypeptide comprising at least 90% sequence identity to an epitope sequence selected from SEQ ID NOs: 46-56, 60-62, or 66-75.
- the isolated and purified plasmid may comprise a set of two or more nucleotide sequences in which each of the two or more nucleotide sequences independently encodes a polypeptide comprising at least 90% sequence identity selected from SEQ ID NOs: 46-56, 60-62, or 66-75.
- the isolated and purified plasmid may comprise a set of two or more nucleotide sequences in which each of the two or more nucleotide sequences encodes a polypeptide comprising at least 90% sequence identity selected from SEQ ID NOs: 46-56, 60-62, or 66-75; and each of the nucleotides are not identical within the set of two or more nucleotide sequences.
- the disclosure may further include an isolated and purified plasmid comprising at least one nucleotide sequence encoding a polypeptide comprising at least 70% sequence identity to an epitope sequence selected from SEQ ID NOs: 54, 73, 85, and 87.
- FIG. 9 shows extended epitopes for Yb-1 based on IFNy/IL-lO activity ratio.
- FIG. 10 shows magnitude and incidence of IFNy predominant. IFNy/IL-lO activity ratios for the CDH3 antigen.
- FIG. 12 depicts a chart of simultaneous in vivo evaluation in mice.
- FIG. 13 shows immunogenicity and efficacy of an exemplary Yb-1 plasmid based vaccine in mice.
- FIG. 14 depicts a map, immunogenicity and exemplary sequence of a composition described herein.
- SEQ ID NO: 39 is illustrated in Fig. 14.
- FIG. 15A shows an exemplary validation of peptide specific T-cells as native epitopes.
- FIG. 15C depicts a study schema for Phase I of a clinical trial using a composition described herein.
- FIG. 16 shows a Western blot analysis of HIFla expression in a single plasmid, pHIFla and a plasmid encoding 5 antigens, BCMA5.
- FIG. 17 shows magnitude and incidence of IFNy predominant. IFNy/IL-lO activity ratios for the CD 105 antigen.
- FIG. 18 shows magnitude and incidence of IFNy predominant. IFNy/IL-lO activity ratios for the MDM-2 antigen.
- FIG. 19 shows magnitude and incidence of IFNy predominant. IFNy/IL-lO activity ratios for the SOX-2 antigen.
- FIG. 20 shows magnitude and incidence of IFNy predominant. IFNy/IL-lO activity ratios for the Yb-1 antigen.
- FIG. 21 depicts HIFla peptide and plasmid vaccine immunogenicity and efficacy in mice.
- FIG. 23 depicts CDH3 peptide and plasmid vaccine immunogenicity and efficacy in mice.
- FIG. 24 depicts SOX2 peptide and plasmid vaccine immunogenicity and efficacy in mice.
- FIG. 25 depicts MDM2 peptide and plasmid vaccine immunogenicity and efficacy in mice.
- FIG. 26 shows the mass of mice three months after the last vaccine.
- FIG. 27 shows the mass of mice ten days after the last vaccine.
- FIG. 28 demonstrates that the IGFBP-2 C-terminus is enriched for epitopes that induce
- FIG. 29 shows that the N-terminus, but not C-terminus, IGFBP-2 vaccine both stimulates Type I immunity and inhibits tumor growth.
- FIG. 30 shows that the IGFBP-2 vaccine-induced Th2 abrogates the anti-tumor effect of IGFBP-2-specific Thl.
- FIG. 31 demonstrates that HER2 Thl epitope based vaccines may increase survival which is associated with epitope spreading in advanced stage HER2+ breast cancer patients.
- FIG. 32 demonstrates that extended Th plasmid based vaccines are more effective than peptide based vaccine in generating tumor antigen specific Thl immunity.
- FIG. 33 shows that persistent HER2 ICD specific immunity >1 year after plasmid DNA based vaccination has ended.
- FIG. 34 shows IGF-1R epitopes screened for IFNy and IL-10 T-cell secretion by ELISPOT.
- FIG. 35 demonstrates that multi-epitope IGF-1R vaccine inhibits the growth of implanted breast cancer.
- FIG. 36 shows that multiantigen ployepitope vaccines prevent the development of breast cancer in mice.
- FIG. 37 shows exemplary cytokine secretion patterns induced by HER2 vaccination.
- FIG. 38 depicts a ROC analysis of stem cell/EMT antigens.
- FIG. 40 illustrates a cartoon representation of a construct described herein.
- FIG. 41 shows a Western Blot image of IGFBP-2, Survivin, HIF-1A, and IGF-IR expression.
- FIG. 42A-Fig. 42D show the anti-tumor effects of a multi-antigen vaccine in ID8 ovarian cancer implant model. Mice were imaged on an IVIS Bioluminescent Imager three weeks after implant of ID8-Luc. Total flux (photons/second) were measure in Primary implant (Fig. 42A) and metastatic sites (Fig. 42B). Representative animals are shown as adjuvant alone (Fig. 42C), and Tri-antigen vaccinated (Fig. 42D).
- Fig. 43A shows the TH1 response with respect to HIF-1A peptides.
- Fig. 43B shows the TH1 response with respect to Survivin peptides. Vertical lines show the selected sequences.
- Fig. 44A-Fig. 44D show a comparison of IgG antibody expression levels in ovarian cancer patients and volunteers. IgG antibodies specific for candidate antigens are significantly elevated in ovarian cancer patients as compared to volunteer controls. IgG in ug/ml (y-axis) and experimental populations (X-axis) are shown for IGF-IR (Fig. 44A), IGFBP-2 (Fig. 44B), HIF- 1A (Fig. 44C), and Survivin (Fig. 44D). Mean and 2 stand dev of volunteer controls (dotted line), *p ⁇ 0.05; **p ⁇ 0.01; ***p ⁇ 0.001.
- compositions of breast cancer vaccines and ovarian cancer vaccines are provided, often for the prevention or treatment of breast cancer or ovarian cancer.
- the disclosure further provides methods of administering breast cancer vaccines or ovarian cancer vaccines to a subject.
- the compositions provided herein may be used in combination with the methods provided herein for the prevention or treatment of breast cancer or ovarian cancer.
- the compositions may include; sequences of nucleic acids encoding epitopes of breast cancer or ovarian cancer antigens, the epitopes may elicit an immunogenic response in a subject, plasmids containing the sequences described herein, an adjuvant, a pharmaceutical carrier and, inert chemicals suitable for use with pharmaceutical compositions.
- the breast cancer or ovarian cancer antigens may be at least one of any antigen expressed in a subject that may have or may develop breast cancer or ovarian cancer. Often, the breast cancer or ovarian cancer antigens are expressed by breast cancer cells, ovarian cancer cells, and/or tissues such as breast cancer or ovarian cancer stem cells (CSC)s.
- CSC breast cancer stem cells
- CSCs may exhibit capable of self renewal, unregulated growth, and drug resistance.
- CSCs may express proteins (e.g., antigens) and for example, the level of expression of proteins (e.g., antigens) by CSCs may be upregulated (e.g., increased expression relative to a given amount) or
- proteins that are upregulated by CSCs compared to normal tissue or cells may be involved in the development and/or progression of breast cancer or ovarian cancer.
- the proteins may be identified and epitopes of antigens targeted using the compositions and methods described herein.
- one epitope of a breast cancer or ovarian cancer antigen may be used in the composition.
- more than one epitope of a breast cancer or ovarian cancer antigen may be used in the composition.
- more than two antigens more than three, more than four, more than five, more than six, more than seven, more than eight, more than nine, more than ten, more than 15, more than 20, more than 25 or more than 30 breast cancer or ovarian cancer antigens may be used in the composition.
- the antigens may be the same. In other cases, the antigens may be different.
- the compositions of breast cancer or ovarian cancer vaccines described herein could be formulated for the prevention of breast cancer or ovarian cancer.
- prevention compositions may eliminate cells (e.g., CSCs such as breast CSCs or ovarian CSCs) with abnormal (e.g., upregulated) expression of proteins to prevent breast cancer or ovarian cancer.
- the epitope and/or epitopes may be on the same breast cancer or ovarian cancer antigen or the epitope and/or epitopes may be on a different breast cancer or ovarian cancer antigen.
- one epitope on a breast cancer or ovarian cancer antigen may be used in the composition.
- more than one epitope on a breast cancer or ovarian cancer antigen more than two antigens, more than three, more than four, more than five, more than six, more than seven, more than eight, more than nine, more than ten, more than 15, more than 20, more than 25 or more than 30 epitope on a breast cancer or ovarian cancer antigens may be used in the composition.
- compositions and methods described herein may elicit an immune response in a subject.
- the immune response may be an immune response to the epitopes of the antigens in the composition (e.g., vaccine).
- Vaccines arm the immune system of the subject such that the immune system may detect and destroy that which contains the antigens of the vaccines in the subject.
- the compositions and methods described herein may elicit a Type 1 (Thl) immune response in the subject.
- Thl immune responses may include secretion of inflammatory cytokines (e.g., IFNy, TNFa) by a subset of immune cells (e.g., antigen specific T-cells).
- the inflammatory cytokines activate another subtype of immune cells (e.g., cytotoxic T-cells) which may destroy that which contains the antigen in the subject.
- the epitopes and/or antigens used in the compositions and methods described herein may be recognized by the immune system of a subject to elicit a Thl immune response and release Type I cytokines.
- the Thl response may be initiated by the interaction between the epitope and the T-cell, more specifically, the major histocompatibility complex (MHC) expressed by the T-cell.
- MHC major histocompatibility complex
- high affinity binding of an epitope to an MHC receptor may stimulate a Thl response.
- MHC receptors may be at least one of a plurality of types of MHC receptors. The MHC receptors engaged on a T-cell may vary across individuals in a population.
- compositions described herein may include additional components in addition to nucleic acids encoding epitopes of antigens.
- the compositions may include at least one adjuvant.
- the composition may include at least one pharmaceutical carrier.
- the composition may include at least one inert chemical suitable for use with pharmaceutical compositions.
- the composition may include at least one adjuvant and at least one pharmaceutical carrier.
- the composition may include at least one adjuvant and at least one inert chemical suitable for use with pharmaceutical compositions.
- the composition may include at least one inert chemical suitable for use with pharmaceutical compositions and a pharmaceutical carrier.
- the composition may contain a plurality of adjuvants, a plurality of pharmaceutical carriers and a plurality of inert chemicals suitable for use with pharmaceutical compositions.
- one adjuvant may be used in the composition.
- more than one adjuvant, more than two adjuvants, more than three adjuvants, more than four adjuvants, more than five adjuvants, more than six adjuvants, more than seven adjuvants, more than eight adjuvants, more than nine adjuvants or more than ten adjuvants may be used in the composition.
- one pharmaceutical carrier may be used in the composition.
- more than one pharmaceutical carrier, more than two pharmaceutical carriers, more than three pharmaceutical carriers, more than four adjuvants, more than five pharmaceutical carriers, more than six pharmaceutical carriers, more than seven pharmaceutical carriers, more than eight pharmaceutical carriers, more than nine pharmaceutical carriers or more than ten pharmaceutical carriers may be used in the composition.
- one chemical may be used in the composition.
- more than one chemical, more than two chemicals, more than three chemicals, more than four chemicals, more than five chemicals, more than six chemicals, more than seven chemicals, more than eight chemicals, more than nine chemicals or more than ten chemicals may be used in the composition.
- the disclosure further describes methods administering can breast cancer or ovarian cancer vaccines to a subject.
- the methods may include constructing a plasmid based vaccine that targets those antigens and determining whether administration of the vaccine is safe, immunogenic, and effective to prevent the development of breast cancer.
- the composition may be a multiantigen Thl polyepitope plasmid based vaccine.
- the method may include conducting at least one clinical trial to determine the safety and immunogenicity of the plasmid based vaccine in subjects with breast cancer or ovarian cancer.
- antigens may be expressed by or associated with CSCs (e.g., breast CSCs or ovarian CSCs) and/or the transition of a cell from an epithelial cell to a mesenchymal cell (EMT).
- CSCs e.g., breast CSCs or ovarian CSCs
- EMT mesenchymal cell
- epitopes of the compositions may be derived from antigens wherein the epitopes may elicit a Thl immune response in the subject.
- the Thl immune response may include immune cells, often CD4+ T-cells.
- the composition may be a nucleic acid (e.g., plasmid based vaccine) that may include nucleic acids encoding more than one antigen or more than one epitope of an antigen.
- the methods may be used to determine if the compositions described herein prevent the development of breast cancer or ovarian cancer in a plurality of organism, for example, in models of cancer (e.g., breast cancer or ovarian cancer) using genetically similar rodents (e.g., mice), using genetically diverse rodents (e.g., mice), and in subjects which may or may not have breast cancer or ovarian cancer.
- the cancer may be a breast cancer.
- breast cancer may be triple negative breast cancer (TNBC).
- compositions and methods described herein include the identification and engineering of breast cancer or ovarian cancer antigens in a pharmaceutical composition (e.g., a vaccine). While any techniques known to one of ordinary skill in the art may be used to identify antigens expressed by a subject with breast cancer or ovarian cancer, in an exemplary case, suitable antigens may be identified using the methods described herein.
- the methods may include by screening sera from subjects.
- the screening may be antibody screening.
- the antibodies screened may be IgG antibodies.
- the sera may be from a subject with breast cancer or ovarian cancer. In other cases, the sera may be from a subject that does not have breast cancer or ovarian cancer.
- Cancer antigens such as for example breast cancer antigens or ovarian cancer antigens, may be a portion of a protein, a portion of a peptide or a portion of a polyamino acid.
- the portion may be a percentage of a protein, a percentage of a peptide or a percentage of a polyamino acid.
- the percentage may be less than 1%, 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% or 100% of a protein, a peptide or a polyamino acid.
- the portion may be located at the C terminus of a protein, a peptide or a polyamino acid. In other cases, the portion may be located near the C terminus of a protein, a peptide or a polyamino acid. For example, near the C terminus may be within 1%, 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50% of the length of the total protein, peptide or polyamino acid from the median. In some cases, the portion may be located at the N terminus of a protein, a peptide or a polyamino acid. In other cases, the portion may be located near the N terminus of a protein, a peptide or a polyamino acid.
- near the N terminus may be within 1%, 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50% of the length of the total protein, peptide or polyamino acid from the median.
- the portion may be located near the middle of a protein, a peptide or a polyamino acid.
- the portion may be located near the middle of a protein, a peptide or a polyamino acid.
- near the middle may be within 1%, 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50% of the length of the total protein, peptide or polyamino acid from the termini.
- At least one antigen may identified and screened for suitability as an antigen in a composition described herein (e.g., a vaccine).
- one antigen may be identified and screened.
- more than one antigen may be identified and screened, more than two antigens may be identified and screened , more than three antigens may be identified and screened, more than four antigens may be identified and screened, more than five antigens may be identified and screened, more than six antigens may be identified and screened, more than seven antigens may be identified and screened, more than eight antigens may be identified and screened, more than nine antigens may be identified and screened, more than ten antigens may be identified and screened, more than 11 antigens may be identified and screened, more than 12 antigens may be identified and screened, more than 13 antigens may be identified and screened, more than 14 antigens may be identified and screened, more than 15 antigens may be identified and screened, more than 20
- the antigens screened for suitability in a vaccine may be derived from any protein detected in the sera from a subject with breast cancer or ovarian cancer using the screening techniques known to one of ordinary skill in the art. In some cases, the screening may often be antibody screening. While the proteins may be any protein detected in the sera from a subject with breast cancer or ovarian cancer, in an exemplary case, the proteins from which antigens may be derived may be classified as stem cell proteins and/or EMT proteins. For example, in breast cancer stem cell/EMT proteins may include SOX2, YBl, CD105, MDM2, CDH3+/- and HIFla. Often, the antigens may be immunogenic in both breast cancer subjects and subjects without breast cancer.
- the epitopes may be human leukocyte antigen (HLA) class I epitopes derived from breast cancer or ovarian cancer antigens.
- HLA class I epitopes may include epitopes which bind to HLA- A, -B, and -C molecules.
- the epitopes may be class II epitopes derived from breast cancer or ovarian cancer antigens for cancer vaccine (e.g., breast cancer or ovarian cancer) development.
- HLA class II epitopes may include epitopes which bind to HLA-DP, -DM, -DOA, -DOB, -DQ and -DR molecules.
- epitopes may be mapped using the steps of, (1) determining if the epitopes bind MHC (e.g., with high affinity) by at least one HLA allele (e.g., HLA-DR, , i.e., are universal epitopes), (2) determining if the epitopes stimulate IFNy rather than IL-10 secretion (e.g., from antigen specific T-cells), and (3) determining whether T- cells may recognize peptides (e.g., epitopes) processed by antigen presenting cells (APCs), i.e., are native epitopes.
- APCs antigen presenting cells
- T-cell lines may be used.
- the peptides are epitopes mapped from antigens and may be identified using the methods described herein for the selection of peptide epitopes.
- the epitopes may be derived from human proteins that may be used directly in a peptide based vaccine.
- the epitopes may be derived from human proteins and the encoding nucleic acid sequences may be incorporated into a nucleic acid construct designed to induce expression of the epitope in the subject following administration.
- the nucleic acid construct may allow for the immune response to at least one epitope to be entrained, amplified, attenuated, suppressed, or eliminated to specific sets of self-proteins.
- the peptide or the nucleic acid construct may be optimized into a protein or plasmid-based vaccination to induce, amplify or entrain a Thl immune response.
- the epitopes may be extended Thl epitopes.
- the peptide or the nucleic acid construct may be optimized into a protein or plasmid-based vaccination to suppress, attenuate or eliminate a pathological response, in a subject (e.g., human or animal) in need thereof.
- the peptides are located within portions of a protein, peptide or polyamino acid such that the protein, peptide or polyamino acid stimulates secretion of IFNy. In some cases, the peptides are located within portions of a protein, peptide or polyamino acid such that the protein, peptide or polyamino acid that inhibits secretion of IFNy. In some cases, the peptides are located within portions of a protein, peptide or polyamino acid such that the protein, peptide or polyamino acid stimulates secretion of IL-10.
- the peptides are located within portions of a protein, peptide or polyamino acid such that the protein, peptide or polyamino acid that inhibits secretion of IL-10.
- the peptide may stimulate secretion of IFNy and inhibits secretion of IL-10.
- the peptide may stimulate secretion of IL-10 and inhibits secretion of IFNy.
- the peptide may stimulate secretion of IFNy and stimulate secretion of IL-10.
- the peptide may inhibit secretion of IL-10 and inhibits secretion of IFNy.
- the amino acids comprising the peptide may be tuned such that the desired effect of the peptide on IFNy secretion and/or the desired effect of the peptide on IL-10 secretion may be achieved.
- a peptide which stimulates secretion of both IFNy and IL-10 may be tuned such that the length of the peptide is shortened to eliminate amino acids which stimulate IL-10 secretion such that the peptide only stimulates secretion of IFNy.
- identified epitopes may be included in vaccine compositions of extended epitope vaccines.
- extended epitopes may be 40-80-mer peptides.
- the in- tandem extended epitopes may contain short intervening, ⁇ 10 amino acid sequences.
- any of these peptides and/or extended epitopes may be optimized into a protein or plasmid-based vaccination that will specifically induce, amplify or entrain a protective immune response, or alternatively, will suppress, attenuate or eliminate a pathological one, in a subject (human or animal) in need thereof.
- the epitopes may be a length of amino acids. In some cases, the epitopes may be less than five amino acids, less than 10 amino acids, less than 15 amino acids, less than 20 amino acids, less than 25 amino acids, less than 30 amino acids, less than 35 amino acids, less than 40 amino acids, less than 45 amino acids, less than 50 amino acids, less than 55 amino acids, less than 60 amino acids, less than 70 amino acids, less than 75 amino acids, less than 80 amino acids, less than 85 amino acids, less than 90 amino acids, less than 95 amino acids, less than 100 amino acids, less than 110 amino acids, less than 120 amino acids, less than 130 amino acids, less than 140 amino acids, less than 150 amino acids, less than 160 amino acids, less than 170 amino acids, less than 180 amino acids, less than 190 amino acids, less than 200 amino acids, less than 210 amino acids, less than 220 amino acids, less than 230 amino acids, less than 240 amino acids, less than 250 amino acids, less than 260 amino acids, less than 270 amino
- the disclosure provides a composition comprising an isolated and purified plasmid comprising a nucleotide sequence encoding a polypeptide, wherein the polypeptide comprises a plurality of epitopes; and an excipient.
- the plurality of epitopes comprises one or more epitopes comprising at least 90% sequence identity to an amino acid sequence selected from SEQ ID NOs: 1, 6, 8-10, 14-16, 20, 25-28, 32-34, 46-56, 60- 62, 66-75, 82-85, and 87.
- the plurality of epitopes comprises one or more epitopes comprising at least 90% sequence identity to an amino acid sequence selected from SEQ ID NOs: 82-84.
- the plurality of epitopes comprises one or more epitopes comprising at least 90% sequence identity to an amino acid sequence selected from SEQ ID NOs: 1, 6, 8-10, 14-16, 20, 25-28, or 32-34. In some cases, the plurality of epitopes comprises one or more epitopes comprising at least 90% sequence identity to an amino acid sequence selected from SEQ ID NOs: 46-56, 60-62, or 66-75. In some cases, the plurality of epitopes comprises one or more epitopes comprising at least 90% sequence identity to an amino acid sequence selected from SEQ ID NOs: 54, 73, 85, and 87.
- the plurality of epitopes comprises one or more epitopes selected from SEQ ID NOs: 1, 6, 8-10, 14-16, 20, 25-28, 32-34, 46-56, 60-62, 66-75, 82-85, and 87.
- the plurality of epitopes is a plurality of contiguous epitopes.
- the contiguous epitopes further comprise a linker between one or more of the epitope sequences.
- the amino acid sequences of the first and the second epitopes are separated by a sequence of linker amino acids.
- the amino acid sequence of the first epitope is adjacent to the amino acid sequence of the second epitope.
- the composition further comprises an additional isolated and purified plasmid comprising an additional nucleotide sequence encoding an additional polypeptide, wherein the additional polypeptide comprises a plurality of epitopes comprising one or more epitopes comprising at least 90% sequence identity to an amino acid sequence selected from SEQ ID NOs: 1, 6, 8-10, 14-16, 20, 25-28, 32-34, 46-56, 60-62, 66-75, 82-85, and 87.
- the composition further comprises an additional isolated and purified plasmid comprising an additional nucleotide sequence encoding an additional polypeptide, wherein the additional polypeptide comprises a plurality of epitopes selected from SEQ ID NOs: 1, 6, 8-10, 14-16, 20, 25-28, 32-34, 46-56, 60-62, 66-75, 82-85, and 87.
- the sequences of the polypeptide and the additional polypeptide are different.
- the immune response is a Type 1 immune response. In some cases, the immune response is characterized by a ratio of Type I cytokine production to Type II cytokine production that is greater than 1. In some cases, the immune response is characterized by a ratio of Type I cytokine production to Type II cytokine production that is less than 1. In some cases, the immune response is characterized by a ratio of IFNy production to IL-10 production that is greater than 1. In some cases, the immune response is characterized by a ratio of IFNy production to IL-10 production that is less than 1.
- the composition is administered to a subject.
- the subject is in need of administration of the composition.
- the composition is effective to elicit an immune response in a subject.
- the composition is effective to eliminate a number of cells associated with breast cancer or ovarian cancer in a subject.
- the composition may be used to prevent the growth of cells associated with breast cancer or ovarian cancer in a subject.
- the cancer is breast cancer.
- the breast cancer is a relapsed or refractory or metastasized breast cancer.
- the cancer is ovarian cancer.
- the ovarian cancer is a relapsed or refractory or metastasized ovarian cancer.
- At least the first epitope is contained within a pharmaceutical composition. In some cases, at least the first epitope is contained within a pharmaceutical composition further comprising a pharmaceutical carrier. In some cases, at least the first epitope is contained within a pharmaceutical composition further comprising a pharmaceutical carrier and an adjuvant. In some cases, at least the first epitope is contained within a pharmaceutical composition further comprising an adjuvant. In some cases, the composition further comprises an adjuvant and a pharmaceutical carrier. In some cases, the adjuvant is GM-CSF.
- the disclosure also provides for a kit for preparing the compositions described herein, the kit comprising instructions for preparing the composition.
- the disclosure also provides for a kit for administering the compositions described herein, the kit comprising instructions for administering the composition.
- compositions Comprising Epitopes for a Breast Cancer Vaccine
- compositions described herein include a composition comprising: a first plasmid comprising a first nucleotide sequence, the first nucleotide sequence encoding a first epitope of a first antigen expressed by cells associated with breast cancer; and a second nucleotide sequence, the second nucleotide sequence encoding a second epitope of a second antigen expressed by cells associated with breast cancer, wherein the first nucleotide sequence and the second nucleotide sequence are located in one or more plasmids.
- the composition may include nucleic acids which encode epitopes from the following proteins, CD105, HIFla, MDM2, Ybl, SOX-2, HER-2, IGFBP2, IGF-1R, CDH3, and Survivin.
- the compositions may include a composition comprising: a first plasmid comprising a first nucleotide sequence, the first nucleotide sequence encoding a first epitope of a first antigen, the first epitope is a portion of a peptide selected from: CD105, Yb-1, SOX-2, CDH3 or MDM2, wherein the first nucleotide sequence is located in a plasmid.
- the composition may include a composition comprising: a first plasmid comprising a first nucleotide sequence, the first nucleotide sequence encoding a first epitope of a first antigen; and a second nucleotide sequence, the second nucleotide sequence encoding a second epitope of a second antigen, wherein the first and the second epitopes are independently selected from:
- CD105 CD105, Yb-1, SOX-2, CDH3 or MDM2, wherein the first nucleotide sequence and the second nucleotide sequence are located in one or more plasmids.
- the composition may include nucleic acids which encode epitopes from the following proteins, CD105, MDM2, Yb-1, SOX-2, and CDH3.
- the composition may include a nucleic acid sequence encoding an epitope of the peptide CD 105 is selected from the group consisting of: a nucleotide sequence having at least 90% sequence identity to the nucleotide sequence of
- TCCACCCAGTCCACCCCCTGCTCCACCTCCTCCATGGCC (SEQ ID NO: 4); a nucleotide sequence having at least 90% sequence identity to the nucleotide sequence of
- QNGTWPREVLLVLSVNSSVFLHLQALGIPLHLAYNSSLVTFQEPPGVNTTEL (SEQ ID NO: 7); a nucleotide sequence encoding an amino acid sequence, the amino acid sequence having at least 90% sequence identity to the amino acid sequence of
- composition may include a nucleic acid sequence encoding an epitope of the peptide Yb-1 is selected from the group consisting of: a nucleotide sequence having at least 90% sequence identity to the nucleotide sequence of
- nucleotide sequence having at least 90% sequence identity to the nucleotide sequence of GGCGTGCCCGTGCAGGGCTCCAAGTACGCCGCCGACCGCAACCACTACCGCCGCTA CCCCCGCCGCCGCGGCCCCCCCCGCAACTACCAGCAGAAC (SEQ ID NO: 12); a nucleotide sequence having at least 90% sequence identity to the nucleotide sequence of GGCGTGCCCGTGCAGGGCTCCAAGTACGCCGCCGACCGCAACCACTACCGCCGCTA CCCCCGCCGCCGCGGCCCCCCCCGCAACTACCAGCAGAAC (SEQ ID NO: 13); a nucleotide sequence encoding an amino acid sequence, the amino acid sequence having at least 90% sequence identity to the amino acid sequence of EDVFVHQTAIKKNN
- nucleotide sequence encoding an amino acid sequence the amino acid sequence having at least 90% sequence identity to the amino acid sequence of
- the composition may include a nucleic acid sequence encoding an epitope of the peptide SOX-2 is selected from the group consisting of: a nucleotide sequence having at least 90% sequence identity to the nucleotide sequence of
- composition may include, a nucleic acid sequence encoding an epitope of the peptide CDH3 is selected from the group consisting of: a nucleotide sequence having at least 90% sequence identity to the nucleotide sequence of
- nucleotide sequence encoding an amino acid sequence, the amino acid sequence having at least 90% sequence identity to the amino acid sequence of
- RSLKERNPLKIFPSKRILRRHKRDWVVAPISVPENGKGPFPQRLNQLKSNKDRDTKIFYSI TGPGADSPPEGVFAVEKET (SEQ ID NO: 25); a nucleotide sequence encoding an amino acid sequence, the amino acid sequence having at least 90% sequence identity to the amino acid sequence of
- LKIFPSKRILRRHKRDWVVAPISVPENGKGPFPQRLNQLKSNKDRDTKIFYSITGPGADSP PEGVFAVEKET (SEQ ID NO: 26); a nucleotide sequence encoding an amino acid sequence, the amino acid sequence having at least 90% sequence identity to the amino acid sequence of AMHSPPTRILRRRKREWVMPPIFVPENGKGPFPQRLNQLKSNKDRGTKIFYSITGPGADS PPEGVFTIEKES (SEQ ID NO: 27); or a nucleotide sequence encoding an amino acid sequence, the amino acid sequence having at least 90% sequence identity to the amino acid sequence of
- the composition may include, a nucleic acid sequence encoding an epitope of the peptide MDM2 is selected from the group consisting of: a nucleotide sequence having at least 90% sequence identity to the nucleotide sequence of
- TYTMKEVLFYLGQYIMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYR NLVVVNQQESSDSGTSV (SEQ ID NO: 32); a nucleotide sequence encoding an amino acid sequence, the amino acid sequence having at least 90% sequence identity to the amino acid sequence of
- TYTMKEIIFYIGQYIMTKRLYDEKQQHIVYCSNDLLGDVFGVPSFSVKEHRKIYAMIYRN LVAVSQQDSGTSLS (SEQ ID NO: 33); or a nucleotide sequence encoding an amino acid sequence, the amino acid sequence having at least 90% sequence identity to the amino acid sequence of
- compositions may include a nucleic acid sequence encoding a fusion peptide of five epitopes is selected from the group consisting of: a nucleotide sequence having at least 90% sequence identity to the nucleotide sequence of
- CGACTCCGGCACCTCCGTGTCCAGATCTTAG SEQ ID NO: 35; a nucleotide sequence having at least 90% sequence identity to the nucleotide sequence of
- GGCACCTCCCTGTCCAGATCTTAG SEQ ID NO: 37; a nucleotide sequence having at least 90% sequence identity to the nucleotide sequence of
- GGCACCTCCCCCTCCAGATCTTAG (SEQ ID NO: 38); a nucleotide sequence encoding an amino acid sequence, the amino acid sequence having at least 90% sequence identity to the amino acid sequence of
- SEQ ID NO: 40 a nucleotide sequence encoding an amino acid sequence, the amino acid sequence having at least 90% sequence identity to the amino acid sequence of
- nucleotide sequence encoding an amino acid sequence the amino acid sequence having at least 90% sequence identity to the amino acid sequence of
- the composition may include nucleic acids which encode epitopes from the following proteins, HER-2, IGFBP2 and IGF-IR.
- the composition may comprise a first plasmid comprising a first nucleotide sequence, the first nucleotide sequence encoding a first epitope of a first antigen, the first epitope is a portion of a peptide selected from: IGFBP-2, HER-2, IGF-IR, wherein the first nucleotide sequence is located in a plasmid.
- the composition may comprise: a first plasmid comprising a first nucleotide sequence, the first nucleotide sequence encoding a first epitope of a first antigen; and a second nucleotide sequence, the second nucleotide sequence encoding a second epitope of a second antigen, wherein the first and the second epitopes are independently selected from: IGFBP-2, HER-2 or IGF-IR, wherein the first nucleotide sequence and the second nucleotide sequence are located in one or more plasmids.
- ACGACCACTCCGAGGGCGGCCTGGTGGAG (SEQ ID NO: 44); a nucleotide sequence having at least 90% sequence identity to the nucleotide sequence of
- nucleotide sequence encoding an amino acid sequence, the amino acid sequence having at least 90% sequence identity to the amino acid sequence of PNTGKLIQGAPTIRG (SEQ ID NO:
- nucleotide sequence encoding an amino acid sequence, the amino acid sequence having at least 90% sequence identity to the amino acid sequence of PECHLFYNEQQEARG SEQ ID NO: 53
- nucleotide sequence encoding an amino acid sequence, the amino acid sequence having at least 90% sequence identity to the amino acid sequence of MLPRVGCPALPLPPPPLLPLLPLLLLLLGASGGGGGARAEVLFRCPPCTPERLAACGPPP VAPPAAVAAVAGGARMPCAELVREPGCGCCSVCARLEGEACGVYTPRCGQGLRCYPH PGSELPLQALVMGEGTCEKRRDAEYGASPEQVADNGDDHSEGGLVE SEQ ID NO: 54
- compositions may comprise a nucleic acid sequence encoding an epitope of the peptide HER-2 is selected from the group consisting of: a nucleotide sequence having at least 90% sequence identity to the nucleotide sequence of
- TTCGGCGGCGCCGTGGAGAACCCCGAGTACCTG (SEQ ID NO: 59); a nucleotide sequence encoding an amino acid sequence, the amino acid sequence having at least 90% sequence identity to the amino acid sequence of
- compositions may comprise a nucleic acid sequence encoding an epitope of the peptide IGF-1R is selected from the group consisting of: a nucleotide sequence having at least 90% sequence identity to the nucleotide sequence of
- ACGGAGGCCGCAAGAACGAGCGCGCCCTGCCC (SEQ ID NO: 63); a nucleotide sequence having at least 90% sequence identity to the nucleotide sequence of
- nucleotide sequence encoding an amino acid sequence, the amino acid sequence having at least 90% sequence identity to the amino acid sequence of
- compositions may comprise a nucleic acid sequence encoding a fusion protein of three epitopes is selected from the group consisting of: a nucleotide sequence having at least 90% sequence identity to the nucleotide sequence of
- GGAGGCCGCAAGAACGAGCGCGCCCTGCCCGCGGCCGCATAG SEQ ID NO: 76; a nucleotide sequence having at least 90% sequence identity to the nucleotide sequence of
- NERALPAAA (SEQ ID NO: 79); a nucleotide sequence encoding an amino acid sequence, the amino acid sequence having at least 90% sequence identity to the amino acid sequence of
- KAENGPGPGVLVLRASFDERQPYAHMNGGRANERALPAAA (SEQ ID NO: 80); and a nucleotide sequence encoding an amino acid sequence, the amino acid sequence having at least
- compositions may comprise a first and a second epitope
- compositions may comprise a third epitope, the first, second and third epitopes independently selected from: CD105, Yb-1, SOX-2, CDH3 or MDM2.
- compositions may comprise a third and a fourth epitope, the first, second, third and fourth epitopes independently selected from: CD105, Yb-1, SOX-2, CDH3 or MDM2.
- compositions may comprise a third, a fourth and a fifth epitope, the first, second, third, fourth and fifth epitopes independently selected from: CD105, Yb-1, SOX-2, CDH3 or MDM2.
- compositions may comprise a first and a second epitope
- compositions may comprise a third epitope, the first, second and third epitopes independently selected from:
- IGFBP2 IGFBP2, HER-2 or IGF-1R.
- compositions may be capable of being administered to a subject.
- the subject is in need of administration of the composition.
- the composition is effective to elicit an immune response in a subject.
- the composition is effective to elicit an immune response in a subject.
- composition is effective to eliminate a number of cells associated with breast cancer in a subject.
- the composition can be used to prevent the growth of cells associated with breast cancer in a subject.
- the first and the second nucleic acid sequences are located on the first plasmid. In some cases, the second nucleic acid sequence is located on a second plasmid.
- the first and the second nucleic acid sequences are purified to at least 70% purity. In some cases, the first and the second nucleic acid sequences are located on the first plasmid and are separated by a sequence of linker nucleic acids. In some cases, the first nucleic acid sequence is adjacent to the second nucleic acid sequence on the first plasmid. [0116] In some cases, at least the first plasmid is contained within a pharmaceutical composition. In some cases, at least the first plasmid is contained within a pharmaceutical composition further comprising a pharmaceutical carrier. In some cases, at least the first plasmid is contained within a pharmaceutical composition further comprising a pharmaceutical carrier and an adjuvant. In some cases, at least the first plasmid is contained within a pharmaceutical composition further comprising an adjuvant. In some cases, the composition further comprises an adjuvant and a pharmaceutically acceptable carrier. In some cases, the adjuvant is GM-CSF.
- a subject is selected from: a human with breast cancer, a mouse with breast cancer or a rat with breast cancer. In some cases, a subject is selected from: a human without breast cancer, a mouse without breast cancer or a rat without breast cancer.
- the immune response is a Type 1 immune response.
- the first nucleic acid sequence is a species selected from: human, mouse or rat.
- the second nucleic acid sequence is a species selected from: human, mouse or rat.
- the immune response is characterized by a ratio of Type I cytokine production to Type II cytokine production that is greater than 1.
- the immune response is characterized by a ratio of Type I cytokine production to Type II cytokine production that is less than 1.
- the immune response is characterized by a ratio of IFNy production to IL-10 production that is greater than 1.
- the immune response is characterized by a ratio of IFNy production to IL-10 production that is less than 1.
- compositions include a composition comprising: a first plasmid comprising a first nucleotide sequence, the first nucleotide sequence encoding a first epitope of a first antigen, the first epitope is a portion of an HIF- ⁇ peptide, wherein the first nucleotide sequence is located in a plasmid.
- compositions include a composition comprising: a first plasmid comprising a first nucleotide sequence, the first nucleotide sequence encoding a first epitope of a first antigen; and a second nucleotide sequence, the second nucleotide sequence encoding a second epitope of a second antigen, wherein the first and the second epitopes are portions of an HIF- ⁇ peptide, wherein the first nucleotide sequence and the second nucleotide sequence are located in one or more plasmids.
- nucleic acid sequences which encode epitopes from the following proteins, CD105, HIFla, MDM2, Ybl, SOX-2, HER-2, IGFBP2, IGF-1R and CDH3 may differ from those listed herein. In some cases, nucleic acid sequences which are greater than 95%, 90%, 85%, 80%, 75%, 70%, 65%, 60%, 55% or greater than 50% homologous to those disclosed herein may be used in the compositions described herein. [0121]
- the compositions described herein may include a composition comprising: a first epitope of a first antigen expressed by cells associated with breast cancer; and a second epitope of a second antigen expressed by cells associated with breast cancer.
- the composition may comprise: at least a first epitope of a first antigen, the first epitope is a portion of a peptide selected from: CD105, Yb-1, SOX-2, CDH3 or MDM2.
- the composition may comprise: at least a first epitope of a first antigen, at least a second epitope of a second antigen, the first and the second epitopes are independently selected from: CD105, Yb-1, SOX-2, CDH3 or MDM2.
- at least a first epitope of the peptide CD 105 is selected from the group consisting of: an amino acid sequence, the amino acid sequence having at least 90% sequence identity to the amino acid sequence of
- EARMLNASIVASFVELPL (SEQ ID NO: 6); an amino acid sequence, the amino acid sequence having at least 90% sequence identity to the amino acid sequence of
- QNGTWPREVLLVLSVNSSVFLHLQALGIPLHLAYNSSLVTFQEPPGVNTTEL (SEQ ID NO: 1); an amino acid sequence, the amino acid sequence having at least 90% sequence identity to the amino acid sequence of
- TVFMRLNIISPDLSGCTSKGLVLPAVLGITFGAFLIGALLTAALWYIYSHTRSPSKREPVV AVAAPASSESSSTNHSIGSTQSTPCSTSSMA (SEQ ID NO: 8); an amino acid sequence, the amino acid sequence having at least 90% sequence identity to the amino acid sequence of TVSMRLNIVSPDLSGKGLVLPSVLGITFGAFLIGALLTAALWYIYSHTRGPSKREPVVAV AAPASSESSSTNHSIGSTQSTPCSTSSMA (SEQ ID NO: 9); or an amino acid sequence, the amino acid sequence having at least 90% sequence identity to the amino acid sequence of TVSMRLNIVSPDLSGKGLVLPSVLGITFGAFLIGALLTAALWYIYSHTRAPSKREPVVAV AAPASSESSSTNHSIGSTQSTPCSTSSMA (SEQ ID NO: 10).
- At least a first epitope of the peptide Yb-1 is selected from the group consisting of: an amino acid sequence, the amino acid sequence having at least 90% sequence identity to the amino acid sequence of EDVFVHQTAIKKNNPRK (SEQ ID NO: 14); an amino acid sequence, the amino acid sequence having at least 90% sequence identity to the amino acid sequence of
- YRRNFNYRRRRPEN SEQ ID NO: 15
- amino acid sequence having at least 90% sequence identity to the amino acid sequence of
- At least a first epitope of the peptide SOX-2 is selected from the group consisting of: an amino acid sequence, the amino acid sequence having at least 90% sequence identity to the amino acid sequence of GLNAHGAAQMQPMHRYDVSALQYNSMTSSQTYMNGSPTYSMSYSQQGTPGMALGSM GSV (SEQ ID NO: 20).
- at least a first epitope of the peptide CDH3 is selected from the group consisting of: an amino acid sequence, the amino acid sequence having at least 90% sequence identity to the amino acid sequence of
- RSLKERNPLKIFPSKRILRRHKRDWVVAPISVPENGKGPFPQRLNQLKSNKDRDTKIFYSI TGPGADSPPEGVFAVEKET (SEQ ID NO: 25); an amino acid sequence, the amino acid sequence having at least 90% sequence identity to the amino acid sequence of
- AMHSPPTRILRRRKREWVMPPIFVPENGKGPFPQRLNQLKSNKDRGTKIFYSITGPGADS PPEGVFTIEKES (SEQ ID NO: 27); or an amino acid sequence, the amino acid sequence having at least 90% sequence identity to the amino acid sequence of
- TYTMKEIIFYIGQYIMTKRLYDEKQQHIVYCSNDLLGDVFGVPSFSVKEHRKIYAMIYRN LVAVSQQDSGTSLS (SEQ ID NO: 33); or an amino acid sequence, the amino acid sequence having at least 90% sequence identity to the amino acid sequence of
- compositions described herein include an amino acid sequence of a fusion peptide of five epitopes is selected from the group consisting of: an amino acid sequence, the amino acid sequence having at least 90% sequence identity to the amino acid sequence of MAVPMQLSCSRQNGTWPREVLLVLSVNSSVFLHLQALGIPLHLAYNSSLVTFQEPPGVN TTELRSTGGVPVQGSKYAADRNHYRRYPRRRGPPRNYQQNTRGLNAHGAAQMQPMH RYDVSALQYNSMTSSQTYMNGSPTYSMSYSQQGTPGMALGSMGSVRSQLRSLKERNP LKIFPSKRILRRHKRDWVVAPISVPENGKGPFPQRLNQLKSNKDRDTKIFYSITGPGADSP PEGVFAVEKETRSAGETYTMKEVLFYLGQYIMTKRLYDEKQQHIVYCSNDLLGDLFGV PSFSVKEHRKIYTMIYRNLVVVNQQESS
- amino acid sequence (SEQ ID NO: 40); an amino acid sequence, the amino acid sequence having at least 90% sequence identity to the amino acid sequence of
- compositions described herein may further include a composition comprising: a first plasmid comprising a first nucleotide sequence, the first nucleotide sequence encoding a first epitope of a first antigen, the first epitope is a portion of a peptide selected from: IGFBP-2, HER-2 or IGF-1R, wherein the first nucleotide sequence is located in a plasmid.
- the composition may comprise: a first plasmid comprising a first nucleotide sequence, the first nucleotide sequence encoding a first epitope of a first antigen; and a second nucleotide sequence, the second nucleotide sequence encoding a second epitope of a second antigen, wherein the first and the second epitopes are independently selected from: IGFBP-2, HER-2 or IGF-1R, wherein the first nucleotide sequence and the second nucleotide sequence are located in one or more plasmids.
- At least a first epitope of the peptide IGFBP-2 is selected from the group consisting of: an amino acid sequence, the amino acid sequence having at least 90% sequence identity to the amino acid sequence of NHVDSTMNMLGGGGS (SEQ ID NO: 46); an amino acid sequence, the amino acid sequence having at least 90% sequence identity to the amino acid sequence of ELAVFREKVTEQHRQ (SEQ ID NO: 47); an amino acid sequence, the amino acid sequence having at least 90% sequence identity to the amino acid sequence of LGLEEPKKLRPPPAR (SEQ ID NO: 48); an amino acid sequence, the amino acid sequence having at least 90% sequence identity to the amino acid sequence of DQVLERISTMRLPDE (SEQ ID NO: 49); an amino acid sequence, the amino acid sequence having at least 90% sequence identity to the amino acid sequence of GPLEHLYSLHIPNCD (SEQ ID NO: 50); an amino acid sequence, the amino acid sequence having at least 90% sequence identity to the amino acid sequence of KHGLYNLKQCKMSLN (SEQ ID NO: 51);
- At least a first epitope of the peptide HER-2 is selected from the group consisting of: a nucleotide sequence encoding an amino acid sequence, the amino acid sequence having at least 90% sequence identity to the amino acid sequence of
- a nucleic acid sequence encoding an epitope of the peptide IGF-1R is selected from the group consisting of: an amino acid sequence, the amino acid sequence having at least 90% sequence identity to the amino acid sequence of DYRSYRFPKLTVITE (SEQ ID NO: 66); an amino acid sequence, the amino acid sequence having at least 90% sequence identity to the amino acid sequence of IRGWKLFYNYALVIF (SEQ ID NO: 67); an amino acid sequence, the amino acid sequence having at least 90% sequence identity to the amino acid sequence of VVTGYVKIRHSHALV (SEQ ID NO: 68); an amino acid sequence, the amino acid sequence having at least 90% sequence identity to the amino acid sequence of FFYVQAKTGYENFIH (SEQ ID NO: 69); an amino acid sequence, the amino acid sequence having at least 90% sequence identity to the amino acid sequence of LIIALPVAVLLIVGG (SEQ ID NO: 70); an amino acid sequence, the amino acid sequence having at least 90% sequence identity to the amino acid sequence of LIIALPV
- amino acid sequence the amino acid sequence having at least 90% sequence identity to the amino acid sequence of
- amino acid sequence having at least 90% sequence identity to the amino acid sequence of
- compositions described herein may further include a nucleic acid sequence encoding a fusion protein of three epitopes is selected from the group consisting of: an amino acid sequence, the amino acid sequence having at least 90% sequence identity to the amino acid sequence of
- NERALPAAA (SEQ ID NO: 79); an amino acid sequence, the amino acid sequence having at least 90% sequence identity to the amino acid sequence of MAVPMLPRLGGPALPLLLPSLLLLLLLGAGGCGPGVRAEVLFRCPPCTPERLAACGPPP
- KAENGPGPGVLVLRASFDERQPYAHMNGGRANERALPAAA (SEQ ID NO: 80); or an amino acid sequence, the amino acid sequence having at least 90% sequence identity to the amino acid sequence of
- the composition comprises a first and a second epitope independently selected from: CD105, Yb-1, SOX-2, CDH3 or MDM2.
- the composition further comprises a Third epitope, the first, second and Third epitopes independently selected from: CD105, Yb-1, SOX-2, CDH3 or MDM2.
- the composition further comprises a Third and a fourth epitope, the first, second, Third and fourth epitopes independently selected from: CD105, Yb-1, SOX-2, CDH3 or MDM2.
- the composition further comprises a Third, a fourth and a fifth epitope, the first, second, Third, fourth and fifth epitopes independently selected from: CD105, Yb-1, SOX-2, CDH3 or MDM2.
- the composition comprises a first and a second epitope independently selected from: IGFBP2, HER-2 or IGF-1R.
- the composition further comprises a Third epitope, the first, second and Third epitopes independently selected from: IGFBP2, HER-2 or IGF-1R.
- a composition may comprise: at least a first epitope of a first antigen, the first epitope is a portion of a peptide from HIF- ⁇ . In some cases, a composition may comprise: at least a first epitope of a first antigen, at least a second epitope of a second antigen, the first and the second epitopes are from HIF-l .
- compositions may include a nucleic acid sequence encoding an epitope of the peptide HIF- ⁇ is selected from the group consisting of: a nucleotide sequence encoding an amino acid sequence, the amino acid sequence having at least 90% sequence identity to the amino acid sequence of
- DSKTFLSRHSLDMKFSYCDERITELMGYEPEELLGRSIYEYYHALDSDHLTKTHHDMFT KGQVTTGQYRMLAKRGGYVWVETQATVIYN (SEQ ID NO: 82); a nucleotide sequence encoding an amino acid sequence, the amino acid sequence having at least 90% sequence identity to the amino acid sequence of SDNVNKYMGLTQFELTGHSVFDFTHP (SEQ ID NO: 83); and a nucleotide sequence encoding an amino acid sequence, the amino acid sequence having at least 90% sequence identity to the amino acid sequence of
- the composition may include at least a first epitope of the peptide HIF- l is selected from the group consisting of: an amino acid sequence, the amino acid sequence having at least 90% sequence identity to the amino acid sequence of
- DSKTFLSRHSLDMKFSYCDERITELMGYEPEELLGRSIYEYYHALDSDHLTKTHHDMFT KGQVTTGQYRMLAKRGGYVWVETQATVIYN (SEQ ID NO: 82); an amino acid sequence, the amino acid sequence having at least 90% sequence identity to the amino acid sequence of SDNVNKYMGLTQFELTGHSVFDFTHP (SEQ ID NO: 83); and an amino acid sequence, the amino acid sequence having at least 90% sequence identity to the amino acid sequence of GGYV WVETQ AT VI YNTKNS Q (SEQ ID NO: 84).
- amino acid sequences of the epitopes from the following proteins, CD105, HIFla, MDM2, Ybl, SOX-2, HER-2, IGFBP2, IGF-1R and CDH3 may differ from those listed herein.
- amino acid sequences which are greater than 95%, 90%, 85%, 80%, 75%, 70%, 65%, 60%, 55% or greater than 50% homologous to those disclosed herein may be used in the compositions described herein.
- the first amino acid sequences are selected from a group of species consisting of, human, mouse and rat.
- the second amino acid sequences are selected from a group of species consisting of, human, mouse and rat.
- the first and the second nucleic acid sequences are located on the first plasmid. In some cases, the second nucleic acid sequence is located on a second plasmid. In some cases, the amino acid sequences of the first and the second epitopes are separated by a sequence of linker amino acids. In some cases, the amino acid sequence of the first epitope is adjacent to the amino acid sequence of the second epitope.
- the immune response is a Type 1 immune response. In some cases, the immune response is characterized by a ratio of Type I cytokine production to Type II cytokine production that is greater than 1. In some cases, the immune response is characterized by a ratio of Type I cytokine production to Type II cytokine production that is less than 1. In some cases, the immune response is characterized by a ratio of IFNy production to IL-10 production that is greater than 1. In some cases, the immune response is characterized by a ratio of IFNy production to IL-10 production that is less than 1.
- the composition is administered to a subject.
- the subject is in need of administration of the composition.
- the composition is effective to elicit an immune response in a subject.
- the composition is effective to eliminate a number of cells associated with breast cancer in a subject.
- the composition may be used to prevent the growth of cells associated with breast cancer in a subject.
- a subject is selected from the group consisting of a human with breast cancer, a mouse with breast cancer and a rat with breast cancer. In some cases, a subject is selected from the group consisting of a human without breast cancer, a mouse without breast cancer and a rat without breast cancer.
- the cells associated with breast cancer are selected from: breast cells expressing atypical features, pre-neoplastic breast cells, breast cancer cells, pre-invasive breast cancer cells, breast cancer stem cells, epithelial cells, mesenchymal cells, stromal cells, or a combination thereof.
- At least the first epitope is contained within a pharmaceutical composition. In some cases, at least the first epitope is contained within a pharmaceutical composition further comprising a pharmaceutical carrier. In some cases, at least the first epitope is contained within a pharmaceutical composition further comprising a pharmaceutical carrier and an adjuvant. In some cases, at least the first epitope is contained within a pharmaceutical composition further comprising an adjuvant. In some cases, the composition further comprises an adjuvant and a pharmaceutical carrier. In some cases, the adjuvant is GM-CSF.
- the composition may be administered to a subject.
- the subject is in need thereof.
- methods for preventing breast cancer in a subject are provided herein such that the method comprises administering the compositions described herein to a subject.
- methods for treating breast cancer in a subject are provided herein such that the method comprises administering the compositions described herein to a subject.
- administering further comprises delivery of at least one dose of the composition described herein to the subject.
- the administering further comprises delivery of the compositions described herein to the subject by subcutaneous injection, intradermal injection, intramuscular injection, intravascular injection, topical application or inhalation.
- the disclosure also provides for a kit for preparing the compositions described herein, the kit comprising instructions for preparing the composition.
- the disclosure also provides for a kit for administering the compositions described herein, the kit comprising instructions for administering the composition.
- compositions comprising Epitopes Selected From Survivin, HIF- ⁇ , IGFBP-2, and IGF- 1R
- compositions described herein include a plasmid comprising at least one nucleotide sequence encoding a polypeptide comprising at least 70% sequence identity to an epitope sequence selected from SEQ ID NOs: 54, 73, 85, and 87; and an excipient.
- the composition may include a plasmid which comprises at least one nucleotide sequence encoding a polypeptide comprising at least 80% sequence identity to an epitope sequence selected from SEQ ID NOs: 54, 73, 85, and 87.
- the composition may include a plasmid which comprises at least one nucleotide sequence encoding a polypeptide comprising at least 90% sequence identity to an epitope sequence selected from SEQ ID NOs: 54, 73, 85, and 87.
- the composition may include a plasmid which comprises at least one nucleotide sequence encoding a polypeptide comprising at least 95% sequence identity to an epitope sequence selected from SEQ ID NOs: 54, 73, 85, and 87.
- the composition may include a plasmid which comprises at least one nucleotide sequence encoding a polypeptide comprising at least 99% sequence identity to an epitope sequence selected from SEQ ID NOs: 54, 73, 85, and 87.
- the composition may include a plasmid which comprises at least one nucleotide sequence encoding a polypeptide comprising 100% sequence identity to an epitope sequence selected from SEQ ID NOs: 54, 73, 85, and 87.
- the composition may include a plasmid which comprises at least one nucleotide sequence encoding a polypeptide consisting of 100% sequence identity to the full length of an epitope sequence selected from SEQ ID NOs: 54, 73, 85, and 87.
- the at least one nucleotide sequence may encode a polypeptide comprising at least 70% sequence identity to at least 20 contiguous amino acids of SEQ ID NO: 85.
- the at least one nucleotide sequence may encode a polypeptide comprising at least 80% sequence identity to at least 20 contiguous amino acids of SEQ ID NO: 85.
- the at least one nucleotide sequence may encode a polypeptide comprising at least 90% sequence identity to at least 20 contiguous amino acids of SEQ ID NO: 85.
- the at least one nucleotide sequence may encode a polypeptide comprising at least 95% sequence identity to at least 20 contiguous amino acids of SEQ ID NO: 85.
- the at least one nucleotide sequence may encode a polypeptide comprising at least 99% sequence identity to at least 20 contiguous amino acids of SEQ ID NO: 85.
- the at least one nucleotide sequence may encode a polypeptide comprising at least 100% sequence identity to at least 20 contiguous amino acids of SEQ ID NO: 85.
- the at least one nucleotide sequence may encode a polypeptide comprising at least 70% sequence identity to at least 60 contiguous amino acids of SEQ ID NO: 87.
- the at least one nucleotide sequence may encode a polypeptide comprising at least 80% sequence identity to at least 60 contiguous amino acids of SEQ ID NO: 87.
- the at least one nucleotide sequence may encode a polypeptide comprising at least 90% sequence identity to at least 60 contiguous amino acids of SEQ ID NO: 87.
- the at least one nucleotide sequence may encode a polypeptide comprising at least 95% sequence identity to at least 60 contiguous amino acids of SEQ ID NO: 87.
- the at least one nucleotide sequence may encode a polypeptide comprising at least 99% sequence identity to at least 60 contiguous amino acids of SEQ ID NO: 87.
- the at least one nucleotide sequence may encode a polypeptide comprising at least 100% sequence identity to at least 60 contiguous amino acids of SEQ ID NO: 87.
- the composition comprises an isolated plasmid which comprises at least four nucleotide sequences.
- each of the at least four nucleotide sequences independently encodes a polypeptide comprising at least 60%, 70%, 80%, 90%, 95%, 99%, or 100% sequence identity to an epitope sequence selected from SEQ ID NOs: 54, 73, 85, and 87.
- the isolated plasmid may comprise four nucleotide sequences.
- each of the four nucleotide sequences may independently encode a polypeptide comprising at least 60%, 70%, 80%, 90%, 95%, 99%, or 100% sequence identity to an epitope sequence selected from SEQ ID NOs: 54, 73, 85, and 87.
- each of the four nucleotide sequences may encode a different polypeptide.
- each of the different polypeptide may comprise at least 60%, 70%, 80%, 90%, 95%, 99%, or 100% sequence identity to an epitope sequence selected from SEQ ID NOs: 54, 73, 85, and 87.
- one of the four nucleotide sequences may encode a polypeptide comprising at least 70% sequence identity to at least 20 contiguous amino acids of SEQ ID NO: 85.
- One of the four nucleotide sequences may encode a polypeptide comprising at least 80% sequence identity to at least 20 contiguous amino acids of SEQ ID NO: 85.
- One of the four nucleotide sequences may encode a polypeptide comprising at least 90% sequence identity to at least 20 contiguous amino acids of SEQ ID NO: 85.
- One of the four nucleotide sequences may encode a polypeptide comprising at least 95% sequence identity to at least 20 contiguous amino acids of SEQ ID NO: 85.
- One of the four nucleotide sequences may encode a polypeptide comprising at least 100% sequence identity to at least 20 contiguous amino acids of SEQ ID NO: 85.
- one of the four nucleotide sequences may encode a polypeptide comprising at least 70% sequence identity to at least 60 contiguous amino acids of SEQ ID NO: 87.
- One of the four nucleotide sequences may encode a polypeptide comprising at least 80% sequence identity to at least 60 contiguous amino acids of SEQ ID NO: 87.
- One of the four nucleotide sequences may encode a polypeptide comprising at least 90% sequence identity to at least 60 contiguous amino acids of SEQ ID NO: 87.
- One of the four nucleotide sequences may encode a polypeptide comprising at least 95% sequence identity to at least 60 contiguous amino acids of SEQ ID NO: 87.
- One of the four nucleotide sequences may encode a polypeptide comprising at least 100% sequence identity to at least 60 contiguous amino acids of SEQ ID NO: 87.
- the four nucleotide sequences are positioned in tandem within the plasmid.
- the four nucleotide sequences may be separated by a sequence of linker nucleic acids.
- the sequence of linker nucleic acids may be from about 1 to about 150, from about 5 to about 100, or from about 10 to about 50 nucleic acids in length.
- the nucleic acids may encode one or more amino acid residues.
- the amino acid sequence of the linker may be from about 1 to about 50, or from about 5 to about 25 amino acid residues in length.
- the linker may include a linker (SEQ ID NO: 14) as shown as underlined in Fig. 14.
- the composition may further comprise at least one additional isolated plasmid.
- the composition may further comprise at least 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 30, 35, 40, 45, 50, or more additional isolated plasmid.
- the at least one additional isolated plasmid comprises a nucleotide sequence encoding a polypeptide comprising at least 70% sequence identity to an epitope sequence selected from SEQ ID NOs: 54, 73, 85, and 87.
- the at least one additional isolated plasmid may comprise a nucleotide sequence encoding a polypeptide comprising at least 80% sequence identity to an epitope sequence selected from SEQ ID NOs: 54, 73, 85, and 87.
- the at least one additional isolated plasmid may comprise a nucleotide sequence encoding a polypeptide comprising at least 90% sequence identity to an epitope sequence selected from SEQ ID NOs: 54, 73, 85, and 87.
- the at least one additional isolated plasmid may comprise a nucleotide sequence encoding a polypeptide comprising at least 95% sequence identity to an epitope sequence selected from SEQ ID NOs: 54, 73, 85, and 87.
- the at least one additional isolated plasmid may comprise a nucleotide sequence encoding a polypeptide comprising at least 99% sequence identity to an epitope sequence selected from SEQ ID NOs: 54, 73, 85, and 87.
- the at least one additional isolated plasmid may comprise a nucleotide sequence encoding a polypeptide comprising 100% sequence identity to an epitope sequence selected from SEQ ID NOs: 54, 73, 85, and 87.
- a composition described herein may include a composition comprising: a plasmid comprising a nucleotide sequence encoding a polypeptide comprising at least 80% sequence identity to SEQ ID NO: 89; and an excipient.
- the composition may include a plasmid which comprises a nucleotide sequence encoding a polypeptide comprising at least 90% sequence identity to SEQ ID NO: 89.
- the composition may include a plasmid which comprises a nucleotide sequence encoding a polypeptide comprising at least 95% sequence identity to SEQ ID NO: 89.
- the composition may include a plasmid which comprises a nucleotide sequence encoding a polypeptide comprising 100% sequence identity to SEQ ID NO: 89.
- composition may include a plasmid which comprises a nucleotide sequence encoding a polypeptide consisting of 100% sequence identity to SEQ ID NO: 89.
- a composition described herein may include a composition that comprises a polypeptide comprising at least 80% sequence identity to SEQ ID NO: 89.
- the composition may include a polypeptide which comprises at least 90% sequence identity to SEQ ID NO: 89.
- the composition may include a polypeptide which comprises at least 95% sequence identity to SEQ ID NO: 89.
- the composition may include a polypeptide which comprises 100% sequence identity to SEQ ID NO: 89.
- the composition may include a polypeptide which consists of 100% sequence identity to SEQ ID NO: 89.
- the composition may be formulated for the treatment of breast cancer or ovarian cancer in a subject.
- the breast cancer may be a relapsed or refractory breast cancer.
- the ovarian cancer may be a relapsed or refractory ovarian cancer.
- the breast cancer may be a metastasized breastcancer.
- the ovarian cancer may be a metastasized ovarian cancer.
- the composition may elicits an immune response.
- the immune response may be characterized by a ratio of Type I cytokine production to Type II cytokine production that is greater than 1.
- the immune response may be characterized by a ratio of Type I cytokine production to Type II cytokine production that is less than 1.
- the immune response may be characterized by a ratio of IFN- ⁇ production to IL-10 production that is greater than 1.
- the immune response may be characterized by a ratio of IFN- ⁇ production to IL-10 production that is less than 1.
- composition may further comprises an adjuvant.
- the adjuvant is GM-CSF.
- composition may further comprises an excipient.
- the excipient may be a pharmaceutically acceptable carrier.
- composition may be formulated for subcutaneous, intramuscular, or intradermal administration.
- the disclosure also provides for a kit for preparing the compositions described herein, the kit comprising instructions for preparing the composition.
- the disclosure also provides for a kit for administering the compositions described herein, the kit comprising instructions for administering the composition.
- the epitopes may be derived from human proteins that may be used directly in a peptide based vaccine.
- the epitopes may be derived from human proteins and the encoding nucleic acid sequences encoding the epitopes may be incorporated into a nucleic acid construct designed to induce expression of the epitope in a subject following administration.
- epitopes encoded from the nucleic acid construct may allow for the immune response to at least one epitope to be entrained, amplified, attenuated, suppressed, or eliminated to specific sets of proteins (e.g., self-proteins).
- the peptide or the nucleic acid construct may be optimized into a protein or plasmid-based vaccination to induce, amplify or entrain a Thl immune response.
- the epitopes may be extended Thl epitopes.
- the peptide or the nucleic acid construct may be optimized into a protein or plasmid-based vaccination to suppress, attenuate or eliminate a pathological response, in a subject (e.g., human or animal) in need thereof.
- compositions described herein may include plasmids which contain nucleic acid sequences to express at least one epitope in a subject following administration of the
- composition e.g., vaccine
- Any plasmid backbones e.g., vectors
- suitable for pharmaceutical use for expression of a nucleic sequence may be used in the compositions described herein.
- commercially available plasmid backbones may be used.
- the plasmid pUMVC3 may be used.
- commercially available plasmid backbones may be modified, mutated, engineered or cloned prior to use.
- non-commercially available plasmid backbones may be used.
- the plasmid backbone may be less than about 500bp, about 1.0 kB, about 1.2 kB, about 1.4 kB, about 1.6 kB, about 1.8 kB, about 2.0 kB, about 2.2 kB, about 2.4 kB, about 2.6 kB, about 2.8 kB, about 3.0 kB, about 3.2 kB, about 3.4 kB, about 3.6 kB, about 3.8 kB, about 4.0 kB, about 4.2 kB, about 4.4 kB, about 4.6 kB, about 4.8 kB, about 5.0 kB, about 5.2 kB, about 5.4 kB, about 5.6 kB, about 5.8 kB, about 6.0 kB, about 6.2 kB, about 6.4 kB, about 6.6 kB, about 6.8 kB, about 7.0 kB, about
- the compositions described herein may include one plasmid. In other cases, the compositions described herein may include more than one plasmid. For example, the compositions described herein may include two plasmids, three plasmids, four plasmids, five plasmids, six plasmids, seven plasmids, eight plasmids, nine plasmids, ten plasmids, 11 plasmids, 12 plasmids, 13 plasmids, 14 plasmids, 15 plasmids, 16 plasmids, 17 plasmids, 18 plasmids 19 plasmids, 20 plasmids or more than 20 plasmids.
- the nucleic acids which encode at least one epitope of a plasmid may be deoxyribonucleic acids.
- the deoxyribonucleic acids may be single stranded, double stranded or complementary.
- the deoxyribonucleic acids may be derived from genomic, mitochondrial or plasmid deoxyribonucleic acids.
- the nucleic acids of a plasmid may be ribonucleic acids.
- the ribonucleic acids may be single stranded or double stranded.
- the ribonucleic acids may be micro, antisense, short hairpin, small interfering, messenger, transfer, ribosomal, or the like.
- the nucleic acids of the plasmids may be a portion of deoxyribonucleic acids and a portion of ribonucleic acids.
- the nucleic acids which encode at least one epitope of a plasmid may be derived from any species such that the epitope expressed from the nucleic acids results in an immune response in a subject.
- the subject may be a rodent, a non-human primate or a human.
- the nucleic acids encoding the epitope of the plasmid may be isolated from any source of nucleic acids using methods and techniques known to one of ordinary skill in the art.
- the nucleic acids encoding the epitope of the plasmid may be cloned into the plasmid backbone using methods and techniques known to one of ordinary skill in the art.
- the nucleic acid sequence encoding the epitope may be an endogenous nucleic acid sequence to the subject.
- the nucleic acid sequence for CD 105 from a human may be used to express CD 105 in a human.
- the nucleic acid sequence for the antigenic epitope may be an exogenous nucleic acid sequence to the subject.
- the nucleic acid sequence for CD 105 from a no n- human may be used to express CD 105 in a human.
- the nucleic acid sequences to express the antigenic epitope may be wild- type nucleic acid sequences.
- the naturally occurring nucleic acid sequence for CD105 in the genome of a species may be used to express CD105 in a subject.
- the nucleic acid sequences encoding the epitope may be synthetic nucleic acid sequences.
- the naturally occurring nucleic acid sequence for CD 105 in the genome of a species may be modified using molecular techniques known to one of ordinary skill in the art and may be used to express CD 105 in a subject.
- the nucleic acid sequence encoding the epitope may be an endogenous nucleic acid sequence to the subject.
- the nucleic acid sequence for CD 105 from a human may be used to express CD 105 in a human.
- the nucleic acid sequence for the antigenic epitope may be an exogenous nucleic acid sequence to the subject.
- the nucleic acid sequence for CD 105 from a no n- human may be used to express CD 105 in a human.
- the nucleic acid sequences to express the antigenic epitope may be wild- type nucleic acid sequences.
- the naturally occurring nucleic acid sequence for CD105 in the genome of a species may be used to express CD105 in a subject.
- the nucleic acid sequences encoding the epitope may be synthetic nucleic acid sequences.
- the naturally occurring nucleic acid sequence for CD 105 in the genome of a species may be modified using molecular techniques known to one of ordinary skill in the art and may be used to express CD 105 in a subject.
- the nucleic acid sequence encoding the epitope may be an endogenous nucleic acid sequence to the subject.
- the nucleic acid sequence for HIF-IA from a human may be used to express HIF-IA in a human.
- the nucleic acid sequence for the antigenic epitope may be an exogenous nucleic acid sequence to the subject.
- the nucleic acid sequence for HIF-IA from a non-human may be used to express HIF-IA in a human.
- the nucleic acid sequences to express the antigenic epitope may be wild- type nucleic acid sequences.
- the naturally occurring nucleic acid sequence for HIF- IA in the genome of a species may be used to express HIF-IA in a subject.
- the nucleic acid sequences encoding the epitope may be synthetic nucleic acid sequences.
- the naturally occurring nucleic acid sequence for HIF-IA in the genome of a species may be modified using molecular techniques known to one of ordinary skill in the art and may be used to express HIF-IA in a subject.
- the nucleic acid sequence encoding the epitope may be an endogenous nucleic acid sequence to the subject.
- the nucleic acid sequence for HIF-IA from a human may be used to express HIF-IA in a human.
- the nucleic acid sequence for the antigenic epitope may be an exogenous nucleic acid sequence to the subject.
- the nucleic acid sequence for HIF-IA from a non-human may be used to express HIF-IA in a human.
- the nucleic acid sequences to express the antigenic epitope may be wild- type nucleic acid sequences.
- the naturally occurring nucleic acid sequence for HIF- IA in the genome of a species may be used to express HIF-IA in a subject.
- the nucleic acid sequences encoding the epitope may be synthetic nucleic acid sequences.
- the naturally occurring nucleic acid sequence for HIF-1A in the genome of a species may be modified using molecular techniques known to one of ordinary skill in the art and may be used to express HIF-1A in a subject.
- the nucleic acid sequence encoding the epitope may be an endogenous nucleic acid sequence to the subject.
- the nucleic acid sequence for MDM2 from a human may be used to express MDM2 in a human.
- the nucleic acid sequence for the antigenic epitope may be an exogenous nucleic acid sequence to the subject.
- the nucleic acid sequence for MDM2 from a non-human may be used to express MDM2 in a human.
- the nucleic acid sequences to express the antigenic epitope may be wild- type nucleic acid sequences.
- the naturally occurring nucleic acid sequence for MDM2 in the genome of a species may be used to express MDM2 in a subject.
- the nucleic acid sequences encoding the epitope may be synthetic nucleic acid sequences.
- the naturally occurring nucleic acid sequence for MDM2 in the genome of a species may be modified using molecular techniques known to one of ordinary skill in the art and may be used to express MDM2 in a subject.
- the nucleic acid sequence encoding the epitope may be an endogenous nucleic acid sequence to the subject.
- the nucleic acid sequence for MDM2 from a human may be used to express MDM2 in a human.
- the nucleic acid sequence for the antigenic epitope may be an exogenous nucleic acid sequence to the subject.
- the nucleic acid sequence for MDM2 from a non-human may be used to express MDM2 in a human.
- the nucleic acid sequences to express the antigenic epitope may be wild- type nucleic acid sequences.
- the naturally occurring nucleic acid sequence for MDM2 in the genome of a species may be used to express MDM2 in a subject.
- the nucleic acid sequences encoding the epitope may be synthetic nucleic acid sequences.
- the naturally occurring nucleic acid sequence for MDM2 in the genome of a species may be modified using molecular techniques known to one of ordinary skill in the art and may be used to express MDM-2 in a subject.
- the nucleic acid sequence encoding the epitope may be an endogenous nucleic acid sequence to the subject.
- the nucleic acid sequence for Yb-1 from a human may be used to express Yb-1 in a human.
- the nucleic acid sequence for the antigenic epitope may be an exogenous nucleic acid sequence to the subject.
- the nucleic acid sequence for Yb-1 from a non- human may be used to express Yb-1 in a human.
- the nucleic acid sequences to express the antigenic epitope may be wild- type nucleic acid sequences.
- the naturally occurring nucleic acid sequence for Yb- 1 in the genome of a species may be used to express Yb-1 in a subject.
- the nucleic acid sequences encoding the epitope may be synthetic nucleic acid sequences.
- the naturally occurring nucleic acid sequence for Yb-1 in the genome of a species may be modified using molecular techniques known to one of ordinary skill in the art and may be used to express Yb-1 in a subject.
- the nucleic acid sequence encoding the epitope may be an endogenous nucleic acid sequence to the subject.
- the nucleic acid sequence for Yb-1 from a human may be used to express Yb-1 in a human.
- the nucleic acid sequence for the antigenic epitope may be an exogenous nucleic acid sequence to the subject.
- the nucleic acid sequence for Yb-1 from a non- human may be used to express Yb-1 in a human.
- the nucleic acid sequences to express the antigenic epitope may be wild- type nucleic acid sequences.
- the naturally occurring nucleic acid sequence for Yb- 1 in the genome of a species may be used to express Yb-1 in a subject.
- the nucleic acid sequences encoding the epitope may be synthetic nucleic acid sequences.
- the naturally occurring nucleic acid sequence for Yb-1 in the genome of a species may be modified using molecular techniques known to one of ordinary skill in the art and may be used to express Yb-1 in a subject.
- the nucleic acid sequence encoding the epitope may be an endogenous nucleic acid sequence to the subject.
- the nucleic acid sequence for SOX-2 from a human may be used to express SOX-2 in a human.
- the nucleic acid sequence for the antigenic epitope may be an exogenous nucleic acid sequence to the subject.
- the nucleic acid sequence for SOX-2 from a non-human may be used to express SOX-2 in a human.
- the nucleic acid sequences to express the antigenic epitope may be wild- type nucleic acid sequences.
- the naturally occurring nucleic acid sequence for SOX-2 in the genome of a species may be used to express SOX-2 in a subject.
- the nucleic acid sequences encoding the epitope may be synthetic nucleic acid sequences.
- the naturally occurring nucleic acid sequence for SOX-2 in the genome of a species may be modified using molecular techniques known to one of ordinary skill in the art and may be used to express SOX-2 in a subject.
- the nucleic acid sequence encoding the epitope may be an endogenous nucleic acid sequence to the subject.
- the nucleic acid sequence for SOX-2 from a human may be used to express SOX-2 in a human.
- the nucleic acid sequence for the antigenic epitope may be an exogenous nucleic acid sequence to the subject.
- the nucleic acid sequence for SOX-2 from a non-human may be used to express SOX-2 in a human.
- the nucleic acid sequences to express the antigenic epitope may be wild- type nucleic acid sequences.
- the naturally occurring nucleic acid sequence for SOX-2 in the genome of a species may be used to express SOX-2 in a subject.
- the nucleic acid sequences encoding the epitope may be synthetic nucleic acid sequences.
- the naturally occurring nucleic acid sequence for SOX-2 in the genome of a species may be modified using molecular techniques known to one of ordinary skill in the art and may be used to express SOX-2 in a subject.
- the nucleic acid sequence encoding the epitope may be an endogenous nucleic acid sequence to the subject.
- the nucleic acid sequence for HER-2 from a human may be used to express HER-2 in a human.
- the nucleic acid sequence for the antigenic epitope may be an exogenous nucleic acid sequence to the subject.
- the nucleic acid sequence for HER-2 from a non-human may be used to express HER-2 in a human.
- the nucleic acid sequences to express the antigenic epitope may be wild- type nucleic acid sequences.
- the naturally occurring nucleic acid sequence for HER-2 in the genome of a species may be used to express HER-2 in a subject.
- the nucleic acid sequences encoding the epitope may be synthetic nucleic acid sequences.
- the naturally occurring nucleic acid sequence for HER-2 in the genome of a species may be modified using molecular techniques known to one of ordinary skill in the art and may be used to express HER-2 in a subject.
- the nucleic acid sequence encoding the epitope may be an endogenous nucleic acid sequence to the subject.
- the nucleic acid sequence for HER-2 from a human may be used to express HER-2 in a human.
- the nucleic acid sequence for the antigenic epitope may be an exogenous nucleic acid sequence to the subject.
- the nucleic acid sequence for HER-2 from a non-human may be used to express HER-2 in a human.
- the nucleic acid sequences to express the antigenic epitope may be wild- type nucleic acid sequences.
- the naturally occurring nucleic acid sequence for HER-2 in the genome of a species may be used to express HER-2 in a subject.
- the nucleic acid sequences encoding the epitope may be synthetic nucleic acid sequences.
- the naturally occurring nucleic acid sequence for HER-2 in the genome of a species may be modified using molecular techniques known to one of ordinary skill in the art and may be used to express HER-2 in a subject.
- the nucleic acid sequence encoding the epitope may be an endogenous nucleic acid sequence to the subject.
- the nucleic acid sequence for IGFBP2 from a human may be used to express IGFBP2 in a human.
- the nucleic acid sequence for the antigenic epitope may be an exogenous nucleic acid sequence to the subject.
- the nucleic acid sequence for IGFBP2 from a non-human may be used to express IGFBP2 in a human.
- the nucleic acid sequences to express the antigenic epitope may be wild- type nucleic acid sequences.
- the naturally occurring nucleic acid sequence for IGFBP2 in the genome of a species may be used to express IGFBP2 in a subject.
- the nucleic acid sequences encoding the epitope may be synthetic nucleic acid sequences.
- the naturally occurring nucleic acid sequence for IGFBP2 in the genome of a species may be modified using molecular techniques known to one of ordinary skill in the art and may be used to express IGFBP2 in a subject.
- the nucleic acid sequence encoding the epitope may be an endogenous nucleic acid sequence to the subject.
- the nucleic acid sequence for IGFBP2 from a human may be used to express IGFBP2 in a human.
- the nucleic acid sequence for the antigenic epitope may be an exogenous nucleic acid sequence to the subject.
- the nucleic acid sequence for IGFBP2 from a non-human may be used to express IGFBP2 in a human.
- the nucleic acid sequences to express the antigenic epitope may be wild- type nucleic acid sequences.
- the naturally occurring nucleic acid sequence for IGFBP2 in the genome of a species may be used to express IGFBP2 in a subject.
- the nucleic acid sequences encoding the epitope may be synthetic nucleic acid sequences.
- the naturally occurring nucleic acid sequence for IGFBP2 in the genome of a species may be modified using molecular techniques known to one of ordinary skill in the art and may be used to express IGFBP2 in a subject.
- the nucleic acid sequence encoding the epitope may be an endogenous nucleic acid sequence to the subject.
- the nucleic acid sequence for IGF-IR from a human may be used to express IGF-IR in a human.
- the nucleic acid sequence for the antigenic epitope may be an exogenous nucleic acid sequence to the subject.
- the nucleic acid sequence for IGF-IR from a non- human may be used to express IGF-IR in a human.
- the nucleic acid sequences to express the antigenic epitope may be wild- type nucleic acid sequences.
- the naturally occurring nucleic acid sequence for IGF- IR in the genome of a species may be used to express IGF-IR in a subject.
- the nucleic acid sequences encoding the epitope may be synthetic nucleic acid sequences.
- the naturally occurring nucleic acid sequence for IGF-IR in the genome of a species may be modified using molecular techniques known to one of ordinary skill in the art and may be used to express IGF-IR in a subject.
- the nucleic acid sequence encoding the epitope may be an endogenous nucleic acid sequence to the subject.
- the nucleic acid sequence for IGF-IR from a human may be used to express IGF-IR in a human.
- the nucleic acid sequence for the antigenic epitope may be an exogenous nucleic acid sequence to the subject.
- the nucleic acid sequence for IGF-IR from a non- human may be used to express IGF-IR in a human.
- the nucleic acid sequences to express the antigenic epitope may be wild- type nucleic acid sequences.
- the naturally occurring nucleic acid sequence for IGF- IR in the genome of a species may be used to express IGF-IR in a subject.
- the nucleic acid sequences encoding the epitope may be synthetic nucleic acid sequences.
- the naturally occurring nucleic acid sequence for IGF-IR in the genome of a species may be modified using molecular techniques known to one of ordinary skill in the art and may be used to express IGF-IR in a subject.
- the nucleic acid sequence encoding the epitope may be an endogenous nucleic acid sequence to the subject.
- the nucleic acid sequence for CDH3 from a human may be used to express CDH3 in a human.
- the nucleic acid sequence for the antigenic epitope may be an exogenous nucleic acid sequence to the subject.
- the nucleic acid sequence for CDH3 from a non-human may be used to express CDH3 in a human.
- the nucleic acid sequences to express the antigenic epitope may be wild- type nucleic acid sequences.
- the naturally occurring nucleic acid sequence for CDH3 in the genome of a species may be used to express CDH3 in a subject.
- the nucleic acid sequences encoding the epitope may be synthetic nucleic acid sequences.
- the naturally occurring nucleic acid sequence for CDH3 in the genome of a species may be modified using molecular techniques known to one of ordinary skill in the art and may be used to express CDH3 in a subject.
- the nucleic acid sequence encoding the epitope may be an endogenous nucleic acid sequence to the subject.
- the nucleic acid sequence for CDH3 from a human may be used to express CDH3 in a human.
- the nucleic acid sequence for the antigenic epitope may be an exogenous nucleic acid sequence to the subject.
- the nucleic acid sequence for CDH3 from a non-human may be used to express CDH3 in a human.
- the nucleic acid sequences to express the antigenic epitope may be wild- type nucleic acid sequences.
- the naturally occurring nucleic acid sequence for CDH3 in the genome of a species may be used to express CDH3 in a subject.
- the nucleic acid sequences encoding the epitope may be synthetic nucleic acid sequences.
- the naturally occurring nucleic acid sequence for CDH3 in the genome of a species may be modified using molecular techniques known to one of ordinary skill in the art and may be used to express CDH3 in a subject.
- compositions described herein include a composition comprising: a first plasmid comprising a first nucleotide sequence, the first nucleotide sequence encoding a first epitope of a first antigen expressed by cells associated with breast cancer; and a second nucleotide sequence, the second nucleotide sequence encoding a second epitope of a second antigen expressed by cells associated with breast cancer, wherein the first nucleotide sequence and the second nucleotide sequence are located in one or more plasmids.
- the composition may include nucleic acids which encode epitopes from the following proteins, CD105, HIFla, MDM2, Yb-1, SOX-2, HER-2, IGFBP2, IGF-1R and CDH3.
- the compositions may include a composition comprising: a first plasmid comprising a first nucleotide sequence, the first nucleotide sequence encoding a first epitope of a first antigen, the first epitope is a portion of a peptide selected from: CD105, Yb-1, SOX-2, CDH3 or MDM2, wherein the first nucleotide sequence is located in a plasmid.
- the composition may include a composition comprising: a first plasmid comprising a first nucleotide sequence, the first nucleotide sequence encoding a first epitope of a first antigen; and a second nucleotide sequence, the second nucleotide sequence encoding a second epitope of a second antigen, wherein the first and the second epitopes are independently selected from:
- CD105 CD105, Yb-1, SOX-2, CDH3 or MDM2, wherein the first nucleotide sequence and the second nucleotide sequence are located in one or more plasmids.
- the composition may include nucleic acids which encode epitopes from the following proteins, CD105, MDM2, Yb-1, SOX-2, and CDH3.
- the composition may include a nucleic acid sequence encoding an epitope of the peptide CD 105 is selected from the group consisting of: a nucleotide sequence having at least 50%, 60%, 70%, 80%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the nucleotide sequence of
- nucleotide sequence having at least 50%, 60%, 70%, 80%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the nucleotide sequence of
- nucleotide sequence having at least 50%, 60%, 70%, 80%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the nucleotide sequence of
- QNGTWPREVLLVLSVNSSVFLHLQALGIPLHLAYNSSLVTFQEPPGVNTTEL (SEQ ID NO: 1); a nucleotide sequence encoding an amino acid sequence, the amino acid sequence having at least 50%, 60%, 70%, 80%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of
- TVFMRLNIISPDLSGCTSKGLVLPAVLGITFGAFLIGALLTAALWYIYSHTRSPSKREPVV AVAAPASSESSSTNHSIGSTQSTPCSTSSMA (SEQ ID NO: 8); a nucleotide sequence encoding an amino acid sequence, the amino acid sequence having at least 50%, 60%, 70%, 80%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of
- TVSMRLNIVSPDLSGKGLVLPSVLGITFGAFLIGALLTAALWYIYSHTRGPSKREPVVAV AAPASSESSSTNHSIGSTQSTPCSTSSMA (SEQ ID NO: 9); or a nucleotide sequence encoding an amino acid sequence, the amino acid sequence having at least 50%, 60%, 70%, 80%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of
- the composition may include a nucleic acid sequence encoding an epitope of the peptide Yb-1 is selected from the group consisting of: a nucleotide sequence having at least 50%, 60%, 70%, 80%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the nucleotide sequence of
- the composition may include a nucleic acid sequence encoding an epitope of the peptide SOX-2 is selected from the group consisting of: a nucleotide sequence having at least 50%, 60%, 70%, 80%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the nucleotide sequence of
- nucleotide sequence having at least 50%, 60%, 70%, 80%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the nucleotide sequence of
- the composition may include, a nucleic acid sequence encoding an epitope of the peptide CDH3 is selected from the group consisting of: a nucleotide sequence having at least 50%, 60%, 70%, 80%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the nucleotide sequence of
- nucleotide sequence having at least 50%, 60%, 70%, 80%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the nucleotide sequence of
- nucleotide sequence having at least 50%, 60%, 70%, 80%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the nucleotide sequence of
- nucleotide sequence encoding an amino acid sequence, the amino acid sequence having at least 50%, 60%, 70%, 80%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of
- RSLKERNPLKIFPSKRILRRHKRDWVVAPISVPENGKGPFPQRLNQLKSNKDRDTKIFYSI TGPGADSPPEGVFAVEKET SEQ ID NO: 25
- a nucleotide sequence encoding an amino acid sequence the amino acid sequence having at least 50%, 60%, 70%, 80%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of
- AMHSPPTRILRRRKREWVMPPIFVPENGKGPFPQRLNQLKSNKDRGTKIFYSITGPGADS PPEGVFTIEKES (SEQ ID NO: 27); or a nucleotide sequence encoding an amino acid sequence, the amino acid sequence having at least 50%, 60%, 70%, 80%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VMNSPPSRILRRRKREWVMPPISVPENGKGPFPQRLNQLKSNKDRGTKLFYSITGPGADS PPEGVFTIEKET (SEQ ID NO: 28).
- the composition may include, a nucleic acid sequence encoding an epitope of the peptide MDM2 is selected from the group consisting of: a nucleotide sequence having at least 50%, 60%, 70%, 80%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the nucleotide sequence of
- nucleotide sequence having at least 50%, 60%, 70%, 80%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the nucleotide sequence of
- TYTMKEVLFYLGQYIMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYR NLVVVNQQESSDSGTSV (SEQ ID NO: 32); a nucleotide sequence encoding an amino acid sequence, the amino acid sequence having at least 50%, 60%, 70%, 80%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of TYTMKEIIFYIGQYIMTKRLYDEKQQHIVYCSNDLLGDVFGVPSFSVKEHRKIYAMIYRN LVAVSQQDSGTSLS (SEQ ID NO: 33); or a nucleotide sequence encoding an amino acid sequence, the amino acid sequence having at least 50%, 60%, 70%, 80%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of
- compositions may include a nucleic acid sequence encoding a fusion peptide of five epitopes is selected from the group consisting of: a nucleotide sequence having at least 50%, 60%, 70%, 80%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the nucleotide sequence of
- AGCAGGAGTCCTCCGACTCCGGCACCTCCGTGTCCAGATCTTAG (SEQ ID NO: 36); a nucleotide sequence having at least 50%, 60%, 70%, 80%, 90%, 91%, 92%, 93%, 94%, 95%,
- GGCACCTCCCTGTCCAGATCTTAG (SEQ ID NO: 37); a nucleotide sequence having at least 50%, 60%, 70%, 80%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the nucleotide sequence of
- nucleotide sequence encoding an amino acid sequence, the amino acid sequence having at least 50%, 60%, 70%, 80%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of
- amino acid sequence (SEQ ID NO: 40); a nucleotide sequence encoding an amino acid sequence, the amino acid sequence having at least 50%, 60%, 70%, 80%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of
- the composition may include nucleic acids which encode epitopes from the following proteins, HER-2, IGFBP2 and IGF-IR.
- the composition may comprise a first plasmid comprising a first nucleotide sequence, the first nucleotide sequence encoding a first epitope of a first antigen, the first epitope is a portion of a peptide selected from: IGFBP-2, HER-2, IGF-IR, wherein the first nucleotide sequence is located in a plasmid.
- the composition may comprise: a first plasmid comprising a first nucleotide sequence, the first nucleotide sequence encoding a first epitope of a first antigen; and a second nucleotide sequence, the second nucleotide sequence encoding a second epitope of a second antigen, wherein the first and the second epitopes are independently selected from: IGFBP-2, HER-2 or IGF-IR, wherein the first nucleotide sequence and the second nucleotide sequence are located in one or more plasmids.
- compositions may comprise a nucleic acid sequence encoding an epitope of the peptide IGFBP-2 is selected from the group consisting of: a nucleotide sequence having at least 50%, 60%, 70%, 80%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the nucleotide sequence of
- ACGACCACTCCGAGGGCGGCCTGGTGGAG (SEQ ID NO: 44); a nucleotide sequence having at least 50%, 60%, 70%, 80%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the nucleotide sequence of
- MLPRVGCPALPLPPPPLLPLLPLLLLLLGASGGGGGARAEVLFRCPPCTPERLAACGPPP VAPPAAVAAVAGGARMPCAELVREPGCGCCSVCARLEGEACGVYTPRCGQGLRCYPH PGSELPLQALVMGEGTCEKRRDAEYGASPEQVADNGDDHSEGGLVE (SEQ ID NO: 54); a nucleotide sequence encoding an amino acid sequence, the amino acid sequence having at least 50%, 60%, 70%, 80%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of
- amino acid sequence MLPRLGGPALPLLLPSLLLLLLLGAGGCGPGVRAEVLFRCPPCTPERLAACGPPPDAPCA ELVREPGCGCCSVCARQEGEACGVYIPRCAQTLRCYPNPGSELPLKALVTGAGTCEKRR VGTTPQQVADSDDDHSEGGLVE (SEQ ID NO: 55); and a nucleotide sequence encoding an amino acid sequence, the amino acid sequence having at least 50%, 60%, 70%, 80%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of
- compositions may comprise a nucleic acid sequence encoding an epitope of the peptide HER-2 is selected from the group consisting of: a nucleotide sequence having at least 50%, 60%, 70%, 80%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the nucleotide sequence of
- TTCGGCGGCGCCGTGGAGAACCCCGAGTACCTG (SEQ ID NO: 59); a nucleotide sequence encoding an amino acid sequence, the amino acid sequence having at least 50%, 60%,
- KDVFAFGGAVENPEYL (SEQ ID NO: 60); a nucleotide sequence encoding an amino acid sequence, the amino acid sequence having at least 50%, 60%, 70%, 80%, 90%, 91%, 92%, 93%,
- DVFAFGGAVENPEYL (SEQ ID NO: 61); and a nucleotide sequence encoding an amino acid sequence, the amino acid sequence having at least 50%, 60%, 70%, 80%, 90%, 91%, 92%, 93%,
- compositions may comprise a nucleic acid sequence encoding an epitope of the peptide IGF-1R is selected from the group consisting of: a nucleotide sequence having at least 50%, 60%, 70%, 80%, 90%, 91%, 92%,
- nucleotide sequence having at least 50%, 60%, 70%, 80%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the nucleotide sequence of
- nucleotide sequence having at least 50%, 60%, 70%, 80%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the nucleotide sequence of
- nucleotide sequence encoding an amino acid sequence the amino acid sequence having at least 50%, 60%, 70%, 80%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of DYRSYRFPKLTVITE (SEQ ID NO: 66); a nucleotide sequence encoding an amino acid sequence, the amino acid sequence having at least 50%, 60%, 70%, 80%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of DYRSYRFPKLTVITE (SEQ ID NO: 66); a nucleo
- nucleotide sequence encoding an amino acid sequence, the amino acid sequence having at least 50%, 60%, 70%, 80%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of
- nucleotide sequence encoding an amino acid sequence, the amino acid sequence having at least 50%, 60%, 70%, 80%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of
- compositions may comprise a nucleic acid sequence encoding a fusion protein of three epitopes is selected from the group consisting of: a nucleotide sequence having at least 50%, 60%, 70%, 80%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the nucleotide sequence of
- GGAGGCCGCAAGAACGAGCGCGCCCTGCCCGCGGCCGCATAG (SEQ ID NO: 76); a nucleotide sequence having at least 50%, 60%, 70%, 80%, 90%, 91%, 92%, 93%, 94%, 95%,
- CGCGCCCTGCCCGCGGCCGCATAG (SEQ ID NO: 77); a nucleotide sequence having at least 50%, 60%, 70%, 80%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the nucleotide sequence of
- CCCTGCCCGCGGCCGCATAG (SEQ ID NO: 78); a nucleotide sequence encoding an amino acid sequence, the amino acid sequence having at least 50%, 60%, 70%, 80%, 90%, 91%, 92%,
- NERALPAAA (SEQ ID NO: 79); a nucleotide sequence encoding an amino acid sequence, the amino acid sequence having at least 50%, 60%, 70%, 80%, 90%, 91%, 92%, 93%, 94%, 95%,
- KAENGPGPGVLVLRASFDERQPYAHMNGGRANERALPAAA (SEQ ID NO: 80); and a nucleotide sequence encoding an amino acid sequence, the amino acid sequence having at least
- compositions may comprise a first and a second epitope
- compositions may comprise a Third epitope, the first, second and Third epitopes independently selected from: CD105, Yb-1, SOX-2, CDH3 or MDM2.
- compositions may comprise a Third and a fourth epitope, the first, second, Third and fourth epitopes independently selected from: CD105, Yb-1, SOX-2, CDH3 or MDM2.
- compositions may comprise a Third, a fourth and a fifth epitope, the first, second, Third, fourth and fifth epitopes independently selected from: CD105, Yb-1, SOX-2, CDH3 or MDM2.
- compositions may comprise a first and a second epitope
- compositions may comprise a Third epitope, the first, second and Third epitopes independently selected from: IGFBP2, HER-2 or IGF-1R.
- compositions may be capable of being administered to a subject.
- the subject is in need of administration of the composition.
- the composition is effective to elicit an immune response in a subject.
- the composition is effective to elicit an immune response in a subject.
- composition is effective to eliminate a number of cells associated with breast cancer in a subject.
- the composition can be used to prevent the growth of cells associated with breast cancer in a subject.
- the first and the second nucleic acid sequences are located on the first plasmid. In some cases, the second nucleic acid sequence is located on a second plasmid.
- the cells associated with breast cancer are selected from: breast cells expressing atypical features, pre-neoplastic breast cells, breast cancer cells, pre-invasive breast cancer cells, breast cancer stem cells, epithelial cells, mesenchymal cells, stromal cells, or a combination thereof.
- the first and the second nucleic acid sequences are purified to at least 70% purity. In some cases, the first and the second nucleic acid sequences are located on the first plasmid and are separated by a sequence of linker nucleic acids. In some cases, the first nucleic acid sequence is adjacent to the second nucleic acid sequence on the first plasmid.
- At least the first plasmid is contained within a pharmaceutical composition. In some cases, at least the first plasmid is contained within a pharmaceutical composition further comprising a pharmaceutical carrier. In some cases, at least the first plasmid is contained within a pharmaceutical composition further comprising a pharmaceutical carrier and an adjuvant. In some cases, at least the first plasmid is contained within a pharmaceutical composition further comprising an adjuvant. In some cases, the composition further comprises an adjuvant and a pharmaceutically acceptable carrier. In some cases, the adjuvant is GM-CSF.
- a subject is selected from: a human with breast cancer, a mouse with breast cancer or a rat with breast cancer. In some cases, a subject is selected from: a human without breast cancer, a mouse without breast cancer or a rat without breast cancer.
- the immune response is a Type 1 immune response.
- the first nucleic acid sequence is a species selected from: human, mouse or rat.
- the second nucleic acid sequence is a species selected from: human, mouse or rat.
- the immune response is characterized by a ratio of Type I cytokine production to Type II cytokine production that is greater than 1.
- the immune response is characterized by a ratio of Type I cytokine production to Type II cytokine production that is less than 1.
- the immune response is characterized by a ratio of IFNy production to IL-10 production that is greater than 1.
- the immune response is characterized by a ratio of IFNy production to IL-10 production that is less than 1.
- compositions include a composition comprising: a first plasmid comprising a first nucleotide sequence, the first nucleotide sequence encoding a first epitope of a first antigen, the first epitope is a portion of an HIF- ⁇ peptide, wherein the first nucleotide sequence is located in a plasmid.
- compositions include a composition comprising: a first plasmid comprising a first nucleotide sequence, the first nucleotide sequence encoding a first epitope of a first antigen; and a second nucleotide sequence, the second nucleotide sequence encoding a second epitope of a second antigen, wherein the first and the second epitopes are portions of an HIF- ⁇ peptide, wherein the first nucleotide sequence and the second nucleotide sequence are located in one or more plasmids.
- nucleic acid sequences which encode epitopes from the following proteins, CD105, HIFla, MDM2, Yb-1, SOX-2, HER-2, IGFBP2, IGF-1R and CDH3 may differ from those listed herein.
- nucleic acid sequences which are greater than 50%, 60%, 70%, 80%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%, or greater than 50% homologous to those disclosed herein may be used in the compositions described herein.
- compositions described herein may include a composition comprising: a first epitope of a first antigen expressed by cells associated with breast cancer; and a second epitope of a second antigen expressed by cells associated with breast cancer.
- the composition may comprise: at least a first epitope of a first antigen, the first epitope is a portion of a peptide selected from: CD105, Yb-1, SOX-2, CDH3 or MDM2.
- the composition may comprise: at least a first epitope of a first antigen, at least a second epitope of a second antigen, the first and the second epitopes are independently selected from: CD105, Yb-1, SOX-2, CDH3 or MDM2.
- At least a first epitope of the peptide CD 105 is selected from the group consisting of: an amino acid sequence, the amino acid sequence having at least 50%, 60%, 70%, 80%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of
- EARMLNASIVASFVELPL (SEQ ID NO: 6); an amino acid sequence, the amino acid sequence having at least 50%, 60%, 70%, 80%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of
- QNGTWPREVLLVLSVNSSVFLHLQALGIPLHLAYNSSLVTFQEPPGVNTTEL (SEQ ID NO: 1); an amino acid sequence, the amino acid sequence having at least 50%, 60%, 70%, 80%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of
- At least a first epitope of the peptide Yb-1 is selected from the group consisting of: an amino acid sequence, the amino acid sequence having at least 50%, 60%, 70%, 80%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of EDVFVHQTAIKKNNPRK (SEQ ID NO: 14); an amino acid sequence, the amino acid sequence having at least 50%, 60%, 70%, 80%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of YRRNFNYRRRRPEN (SEQ ID NO: 15); or an amino acid sequence, the amino acid sequence having at least
- At least a first epitope of the peptide SOX-2 is selected from the group consisting of: an amino acid sequence, the amino acid sequence having at least 50%, 60%, 70%, 80%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of
- At least a first epitope of the peptide CDH3 is selected from the group consisting of: an amino acid sequence, the amino acid sequence having at least 50%, 60%, 70%, 80%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of
- RSLKERNPLKIFPSKRILRRHKRDWVVAPISVPENGKGPFPQRLNQLKSNKDRDTKIFYSI TGPGADSPPEGVFAVEKET (SEQ ID NO: 25); an amino acid sequence, the amino acid sequence having at least 50%, 60%, 70%, 80%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of
- LKIFPSKRILRRHKRDWVVAPISVPENGKGPFPQRLNQLKSNKDRDTKIFYSITGPGADSP PEGVFAVEKET (SEQ ID NO: 26); an amino acid sequence, the amino acid sequence having at least 50%, 60%, 70%, 80%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of
- AMHSPPTRILRRRKREWVMPPIFVPENGKGPFPQRLNQLKSNKDRGTKIFYSITGPGADS PPEGVFTIEKES (SEQ ID NO: 27); or an amino acid sequence, the amino acid sequence having at least 50%, 60%, 70%, 80%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Organic Chemistry (AREA)
- Medicinal Chemistry (AREA)
- Immunology (AREA)
- Genetics & Genomics (AREA)
- Microbiology (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Zoology (AREA)
- Oncology (AREA)
- Mycology (AREA)
- Epidemiology (AREA)
- Engineering & Computer Science (AREA)
- Biochemistry (AREA)
- Cell Biology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Molecular Biology (AREA)
- Wood Science & Technology (AREA)
- Biophysics (AREA)
- General Engineering & Computer Science (AREA)
- Toxicology (AREA)
- Gastroenterology & Hepatology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biomedical Technology (AREA)
- Biotechnology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Physics & Mathematics (AREA)
- High Energy & Nuclear Physics (AREA)
- Plant Pathology (AREA)
- Reproductive Health (AREA)
- Endocrinology (AREA)
- Pregnancy & Childbirth (AREA)
- Gynecology & Obstetrics (AREA)
Priority Applications (11)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US15/300,208 US10293035B2 (en) | 2014-03-28 | 2015-03-27 | Breast and ovarian cancer vaccines |
| ES15768124T ES2868305T3 (es) | 2014-03-28 | 2015-03-27 | Vacunas contra el cáncer de mama y de ovario |
| EP15768124.8A EP3122375B1 (en) | 2014-03-28 | 2015-03-27 | Breast and ovarian cancer vaccines |
| JP2016559329A JP6836400B2 (ja) | 2014-03-28 | 2015-03-27 | 乳がんおよび卵巣がんワクチン |
| CN202110616676.3A CN113403338B (zh) | 2014-03-28 | 2015-03-27 | 乳腺癌和卵巢癌疫苗 |
| CN201580028159.7A CN106456735B (zh) | 2014-03-28 | 2015-03-27 | 乳腺癌和卵巢癌疫苗 |
| CN202510854439.9A CN120514834A (zh) | 2014-03-28 | 2015-03-27 | 乳腺癌和卵巢癌疫苗 |
| DK15768124.8T DK3122375T3 (da) | 2014-03-28 | 2015-03-27 | Vacciner mod bryst- og ovariecancer |
| US16/370,683 US11160853B2 (en) | 2014-03-28 | 2019-03-29 | Breast and ovarian cancer vaccines |
| US17/304,823 US11185578B1 (en) | 2014-03-28 | 2021-06-25 | Breast and ovarian cancer vaccines |
| US17/451,607 US12042531B2 (en) | 2014-03-28 | 2021-10-20 | Breast and ovarian cancer vaccines |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201461972176P | 2014-03-28 | 2014-03-28 | |
| US61/972,176 | 2014-03-28 |
Related Child Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US15/300,208 A-371-Of-International US10293035B2 (en) | 2014-03-28 | 2015-03-27 | Breast and ovarian cancer vaccines |
| US16/370,683 Division US11160853B2 (en) | 2014-03-28 | 2019-03-29 | Breast and ovarian cancer vaccines |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2015149016A2 true WO2015149016A2 (en) | 2015-10-01 |
| WO2015149016A3 WO2015149016A3 (en) | 2016-01-28 |
Family
ID=54196576
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2015/023161 Ceased WO2015149016A2 (en) | 2014-03-28 | 2015-03-27 | Breast and ovarian cancer vaccines |
Country Status (7)
| Country | Link |
|---|---|
| US (4) | US10293035B2 (OSRAM) |
| EP (1) | EP3122375B1 (OSRAM) |
| JP (5) | JP6836400B2 (OSRAM) |
| CN (3) | CN113403338B (OSRAM) |
| DK (1) | DK3122375T3 (OSRAM) |
| ES (1) | ES2868305T3 (OSRAM) |
| WO (1) | WO2015149016A2 (OSRAM) |
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US10293035B2 (en) | 2014-03-28 | 2019-05-21 | University Of Washington Through Its Center For Commercialization | Breast and ovarian cancer vaccines |
| JP2023155245A (ja) * | 2017-12-13 | 2023-10-20 | イノビオ ファーマシューティカルズ,インコーポレイティド | サバイビンを標的とするがんワクチンおよびその使用 |
Families Citing this family (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN109298171B (zh) * | 2018-11-15 | 2022-06-28 | 武汉中生毓晋生物医药有限责任公司 | 醛化红细胞中内毒素的去除方法与应用 |
| CN113851187B (zh) * | 2021-09-15 | 2025-05-06 | 南方科技大学 | 一种糖肽表位预测方法、存储介质及终端设备 |
| WO2023235771A2 (en) * | 2022-05-31 | 2023-12-07 | The University Of Chicago | Chemical screen of modulators for vaccine adjuvants |
Citations (53)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US3625214A (en) | 1970-05-18 | 1971-12-07 | Alza Corp | Drug-delivery device |
| US4270537A (en) | 1979-11-19 | 1981-06-02 | Romaine Richard A | Automatic hypodermic syringe |
| US4469863A (en) | 1980-11-12 | 1984-09-04 | Ts O Paul O P | Nonionic nucleic acid alkyl and aryl phosphonates and processes for manufacture and use thereof |
| US4596556A (en) | 1985-03-25 | 1986-06-24 | Bioject, Inc. | Hypodermic injection apparatus |
| US4789734A (en) | 1985-08-06 | 1988-12-06 | La Jolla Cancer Research Foundation | Vitronectin specific cell receptor derived from mammalian mesenchymal tissue |
| US4790824A (en) | 1987-06-19 | 1988-12-13 | Bioject, Inc. | Non-invasive hypodermic injection device |
| US4886499A (en) | 1986-12-18 | 1989-12-12 | Hoffmann-La Roche Inc. | Portable injection appliance |
| US4897268A (en) | 1987-08-03 | 1990-01-30 | Southern Research Institute | Drug delivery system and method of making the same |
| US4906474A (en) | 1983-03-22 | 1990-03-06 | Massachusetts Institute Of Technology | Bioerodible polyanhydrides for controlled drug delivery |
| US4925673A (en) | 1986-08-18 | 1990-05-15 | Clinical Technologies Associates, Inc. | Delivery systems for pharmacological agents encapsulated with proteinoids |
| US4940460A (en) | 1987-06-19 | 1990-07-10 | Bioject, Inc. | Patient-fillable and non-invasive hypodermic injection device assembly |
| US4941880A (en) | 1987-06-19 | 1990-07-17 | Bioject, Inc. | Pre-filled ampule and non-invasive hypodermic injection device assembly |
| US5015235A (en) | 1987-02-20 | 1991-05-14 | National Carpet Equipment, Inc. | Syringe needle combination |
| US5034506A (en) | 1985-03-15 | 1991-07-23 | Anti-Gene Development Group | Uncharged morpholino-based polymers having achiral intersubunit linkages |
| US5064413A (en) | 1989-11-09 | 1991-11-12 | Bioject, Inc. | Needleless hypodermic injection device |
| US5075109A (en) | 1986-10-24 | 1991-12-24 | Southern Research Institute | Method of potentiating an immune response |
| US5141496A (en) | 1988-11-03 | 1992-08-25 | Tino Dalto | Spring impelled syringe guide with skin penetration depth adjustment |
| US5190521A (en) | 1990-08-22 | 1993-03-02 | Tecnol Medical Products, Inc. | Apparatus and method for raising a skin wheal and anesthetizing skin |
| US5216141A (en) | 1988-06-06 | 1993-06-01 | Benner Steven A | Oligonucleotide analogs containing sulfur linkages |
| US5235033A (en) | 1985-03-15 | 1993-08-10 | Anti-Gene Development Group | Alpha-morpholino ribonucleoside derivatives and polymers thereof |
| US5312335A (en) | 1989-11-09 | 1994-05-17 | Bioject Inc. | Needleless hypodermic injection device |
| US5328483A (en) | 1992-02-27 | 1994-07-12 | Jacoby Richard M | Intradermal injection device with medication and needle guard |
| US5334144A (en) | 1992-10-30 | 1994-08-02 | Becton, Dickinson And Company | Single use disposable needleless injector |
| US5339163A (en) | 1988-03-16 | 1994-08-16 | Canon Kabushiki Kaisha | Automatic exposure control device using plural image plane detection areas |
| US5383851A (en) | 1992-07-24 | 1995-01-24 | Bioject Inc. | Needleless hypodermic injection device |
| US5386023A (en) | 1990-07-27 | 1995-01-31 | Isis Pharmaceuticals | Backbone modified oligonucleotide analogs and preparation thereof through reductive coupling |
| US5417662A (en) | 1991-09-13 | 1995-05-23 | Pharmacia Ab | Injection needle arrangement |
| US5466220A (en) | 1994-03-08 | 1995-11-14 | Bioject, Inc. | Drug vial mixing and transfer device |
| US5480381A (en) | 1991-08-23 | 1996-01-02 | Weston Medical Limited | Needle-less injector |
| US5527288A (en) | 1990-12-13 | 1996-06-18 | Elan Medical Technologies Limited | Intradermal drug delivery device and method for intradermal delivery of drugs |
| US5569189A (en) | 1992-09-28 | 1996-10-29 | Equidyne Systems, Inc. | hypodermic jet injector |
| US5599302A (en) | 1995-01-09 | 1997-02-04 | Medi-Ject Corporation | Medical injection system and method, gas spring thereof and launching device using gas spring |
| US5602240A (en) | 1990-07-27 | 1997-02-11 | Ciba Geigy Ag. | Backbone modified oligonucleotide analogs |
| WO1997013537A1 (en) | 1995-10-10 | 1997-04-17 | Visionary Medical Products Corporation | Gas pressured needle-less injection device |
| US5637684A (en) | 1994-02-23 | 1997-06-10 | Isis Pharmaceuticals, Inc. | Phosphoramidate and phosphorothioamidate oligomeric compounds |
| US5644048A (en) | 1992-01-10 | 1997-07-01 | Isis Pharmaceuticals, Inc. | Process for preparing phosphorothioate oligonucleotides |
| US5649912A (en) | 1994-03-07 | 1997-07-22 | Bioject, Inc. | Ampule filling device |
| WO1997037705A1 (en) | 1996-04-11 | 1997-10-16 | Weston Medical Limited | Spring-powered dispensing device for medical purposes |
| US5811128A (en) | 1986-10-24 | 1998-09-22 | Southern Research Institute | Method for oral or rectal delivery of microencapsulated vaccines and compositions therefor |
| US5893397A (en) | 1996-01-12 | 1999-04-13 | Bioject Inc. | Medication vial/syringe liquid-transfer apparatus |
| WO1999034850A1 (en) | 1998-01-08 | 1999-07-15 | Fiderm S.R.L. | Device for controlling the penetration depth of a needle, for application to an injection syringe |
| US5928647A (en) | 1993-01-11 | 1999-07-27 | Dana-Farber Cancer Institute | Inducing cytotoxic T lymphocyte responses |
| US5993412A (en) | 1997-05-19 | 1999-11-30 | Bioject, Inc. | Injection apparatus |
| WO2000050590A1 (en) | 1999-02-23 | 2000-08-31 | Curagen Corporation | Mdm interacting protein and methods of use thereof |
| WO2001002556A2 (de) | 1999-06-30 | 2001-01-11 | Max-Delbrück-Centrum für Molekulare Medizin | Mittel zur diagnose, prognose und therapie maligner erkrankungen |
| US20070083334A1 (en) | 2001-09-14 | 2007-04-12 | Compugen Ltd. | Methods and systems for annotating biomolecular sequences |
| WO2008073660A1 (en) | 2006-11-09 | 2008-06-19 | University Of Washington | Molecules and methods for treatment and detection of cancer |
| US20090170767A1 (en) | 2006-05-31 | 2009-07-02 | Beth Israel Deaconess Medical Center | Soluble Endoglin Compounds for the Treatment and Prevention of Cancer |
| US20100150918A1 (en) | 2007-04-03 | 2010-06-17 | Micromet Ag | Cross-species-specific binding domain |
| US20110008347A1 (en) | 2006-12-01 | 2011-01-13 | Agency For Science ,Technology And Research | Cancer-related protein kinases |
| US20120128584A1 (en) | 2008-06-30 | 2012-05-24 | Oncotherapy Science, Inc. | Anti-cdh3 antibodies labeled with radioisotope label and uses thereof |
| US20120135033A1 (en) | 2008-05-19 | 2012-05-31 | Anu Wallecha | Multiple delivery system for heterologous antigens |
| US20130034566A1 (en) | 2009-12-28 | 2013-02-07 | Onco Therapy Science, Inc. | Anti-cdh3 antibodies and uses thereof |
Family Cites Families (23)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CA2139756A1 (en) | 1992-07-08 | 1994-01-20 | Eric M. Bonnem | Use of gm-csf as a vaccine adjuvant |
| US5882914A (en) | 1995-06-06 | 1999-03-16 | The Johns Hopkins University School Of Medicine | Nucleic acids encoding the hypoxia inducible factor-1 |
| EP1196772A2 (en) | 1999-07-08 | 2002-04-17 | Stressgen Biotechnologies Corporation | Induction of a th1-like response in vitro |
| WO2001008636A2 (en) * | 1999-08-03 | 2001-02-08 | The Ohio State University | Polypeptides and polynucleotides for enhancing immune reactivity to her-2 protein |
| DE60142615D1 (de) | 2000-04-28 | 2010-09-02 | Mannkind Corp | Epitop-synchronisierung in antigen präsentierenden zellen |
| US20030215460A1 (en) * | 2002-05-07 | 2003-11-20 | Schall Thomas J. | Methods and compositions for inducing an immune response |
| AU2002950188A0 (en) | 2002-07-12 | 2002-09-12 | The University Of Adelaide | Altered insulin-like growth factor binding proteins |
| US7632920B2 (en) * | 2003-04-10 | 2009-12-15 | Schering Corporation | Soluble, stable form of HDM2, crystalline forms thereof and methods of use thereof |
| WO2005058967A2 (en) * | 2003-12-16 | 2005-06-30 | Pierre Fabre Medicament | Novel anti-insulin/igf-i hybrid receptor or anti-insulin/igf-i hybrid receptor and igf-ir antibodies and uses thereof |
| DE602004019215D1 (de) * | 2004-10-02 | 2009-03-12 | Immatics Biotechnologies Gmbh | Immunogene T-Helfer Epitope von menschlichen Tumorantigenen und deren Verwendung in immunotherapeutischen Methoden |
| US20080124354A1 (en) * | 2006-07-10 | 2008-05-29 | Yvonne Paterson | Methods for administering tumor vaccines |
| US20090162383A1 (en) | 2006-12-26 | 2009-06-25 | Padlan Eduardo A | Method for designing vaccines against constantly mutating pathogens |
| EP2178548B1 (en) | 2007-07-19 | 2014-12-24 | Health Research, INC. | Survivin peptides as cancer vaccines |
| CN105566450A (zh) | 2007-07-27 | 2016-05-11 | 伊玛提克斯生物技术有限公司 | 免疫疗法的新型免疫抗原表位 |
| CA2991175A1 (en) | 2007-11-01 | 2009-05-07 | Mayo Foundation For Medical Education And Research | Hla-dr binding peptides and their uses |
| JP5546448B2 (ja) * | 2008-03-31 | 2014-07-09 | 株式会社バイオイミュランス | MHCクラスII分子に提示されるサーバイビン(Survivin)の部分ペプチドとその利用法 |
| US8666674B2 (en) | 2009-07-28 | 2014-03-04 | Promising Future, Llc | Pairing processes for preparing reactive cytotoxic T cells |
| WO2012054588A2 (en) * | 2010-10-22 | 2012-04-26 | T2 Biosystems, Inc. | Conduit-containing devices and methods for analyte processing and detection |
| SG192759A1 (en) | 2011-02-15 | 2013-09-30 | Immune Design Corp | Methods for enhancing immunogen specific immune responses by vectored vaccines |
| CN103582815A (zh) * | 2011-02-24 | 2014-02-12 | 佛米利昂公司 | 用于卵巢癌的生物标志物组、诊断方法和测试试剂盒 |
| DK2699590T3 (en) * | 2011-04-20 | 2019-05-06 | Acceleron Pharma Inc | ENDOGLIN POLYPEPTIDES AND APPLICATIONS THEREOF |
| WO2015149010A1 (en) | 2014-03-28 | 2015-10-01 | University Of Washington Through Its Center For Commercialization | Methods of identifying antigens for vaccines |
| JP6836400B2 (ja) | 2014-03-28 | 2021-03-03 | ユニバーシティ オブ ワシントン スルー イッツ センター フォー コマーシャリゼーション | 乳がんおよび卵巣がんワクチン |
-
2015
- 2015-03-27 JP JP2016559329A patent/JP6836400B2/ja active Active
- 2015-03-27 WO PCT/US2015/023161 patent/WO2015149016A2/en not_active Ceased
- 2015-03-27 CN CN202110616676.3A patent/CN113403338B/zh active Active
- 2015-03-27 EP EP15768124.8A patent/EP3122375B1/en active Active
- 2015-03-27 DK DK15768124.8T patent/DK3122375T3/da active
- 2015-03-27 CN CN202510854439.9A patent/CN120514834A/zh active Pending
- 2015-03-27 US US15/300,208 patent/US10293035B2/en active Active
- 2015-03-27 ES ES15768124T patent/ES2868305T3/es active Active
- 2015-03-27 CN CN201580028159.7A patent/CN106456735B/zh active Active
-
2019
- 2019-03-29 US US16/370,683 patent/US11160853B2/en active Active
- 2019-09-27 JP JP2019177337A patent/JP2020015755A/ja not_active Withdrawn
-
2021
- 2021-06-25 US US17/304,823 patent/US11185578B1/en active Active
- 2021-10-08 JP JP2021165941A patent/JP7301408B2/ja active Active
- 2021-10-20 US US17/451,607 patent/US12042531B2/en active Active
-
2023
- 2023-06-14 JP JP2023097667A patent/JP7659333B2/ja active Active
-
2025
- 2025-03-21 JP JP2025046658A patent/JP2025094154A/ja active Pending
Patent Citations (60)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US3625214A (en) | 1970-05-18 | 1971-12-07 | Alza Corp | Drug-delivery device |
| US4270537A (en) | 1979-11-19 | 1981-06-02 | Romaine Richard A | Automatic hypodermic syringe |
| US4469863A (en) | 1980-11-12 | 1984-09-04 | Ts O Paul O P | Nonionic nucleic acid alkyl and aryl phosphonates and processes for manufacture and use thereof |
| US4906474A (en) | 1983-03-22 | 1990-03-06 | Massachusetts Institute Of Technology | Bioerodible polyanhydrides for controlled drug delivery |
| US5034506A (en) | 1985-03-15 | 1991-07-23 | Anti-Gene Development Group | Uncharged morpholino-based polymers having achiral intersubunit linkages |
| US5235033A (en) | 1985-03-15 | 1993-08-10 | Anti-Gene Development Group | Alpha-morpholino ribonucleoside derivatives and polymers thereof |
| US4596556A (en) | 1985-03-25 | 1986-06-24 | Bioject, Inc. | Hypodermic injection apparatus |
| US4789734A (en) | 1985-08-06 | 1988-12-06 | La Jolla Cancer Research Foundation | Vitronectin specific cell receptor derived from mammalian mesenchymal tissue |
| US4925673A (en) | 1986-08-18 | 1990-05-15 | Clinical Technologies Associates, Inc. | Delivery systems for pharmacological agents encapsulated with proteinoids |
| US5942252A (en) | 1986-10-24 | 1999-08-24 | Southern Research Institute | Method for delivering bioactive agents into and through the mucosally-associated lymphoid tissues and controlling their release |
| US5853763A (en) | 1986-10-24 | 1998-12-29 | Southern Research Institute | Method for delivering bioactive agents into and through the mucosally-associated lymphoid tissue and controlling their release |
| US5820883A (en) | 1986-10-24 | 1998-10-13 | Southern Research Institute | Method for delivering bioactive agents into and through the mucosally-associated lymphoid tissues and controlling their release |
| US5811128A (en) | 1986-10-24 | 1998-09-22 | Southern Research Institute | Method for oral or rectal delivery of microencapsulated vaccines and compositions therefor |
| US5075109A (en) | 1986-10-24 | 1991-12-24 | Southern Research Institute | Method of potentiating an immune response |
| US5814344A (en) | 1986-10-24 | 1998-09-29 | Southern Research Institute | Method for delivering bioactive agents into and through the mucosally associated lymphoid tissues and controlling their release |
| US4886499A (en) | 1986-12-18 | 1989-12-12 | Hoffmann-La Roche Inc. | Portable injection appliance |
| US5015235A (en) | 1987-02-20 | 1991-05-14 | National Carpet Equipment, Inc. | Syringe needle combination |
| US4790824A (en) | 1987-06-19 | 1988-12-13 | Bioject, Inc. | Non-invasive hypodermic injection device |
| US4941880A (en) | 1987-06-19 | 1990-07-17 | Bioject, Inc. | Pre-filled ampule and non-invasive hypodermic injection device assembly |
| US4940460A (en) | 1987-06-19 | 1990-07-10 | Bioject, Inc. | Patient-fillable and non-invasive hypodermic injection device assembly |
| US4897268A (en) | 1987-08-03 | 1990-01-30 | Southern Research Institute | Drug delivery system and method of making the same |
| US5339163A (en) | 1988-03-16 | 1994-08-16 | Canon Kabushiki Kaisha | Automatic exposure control device using plural image plane detection areas |
| US5216141A (en) | 1988-06-06 | 1993-06-01 | Benner Steven A | Oligonucleotide analogs containing sulfur linkages |
| US5141496A (en) | 1988-11-03 | 1992-08-25 | Tino Dalto | Spring impelled syringe guide with skin penetration depth adjustment |
| US5312335A (en) | 1989-11-09 | 1994-05-17 | Bioject Inc. | Needleless hypodermic injection device |
| US5064413A (en) | 1989-11-09 | 1991-11-12 | Bioject, Inc. | Needleless hypodermic injection device |
| US5503627A (en) | 1989-11-09 | 1996-04-02 | Bioject, Inc. | Ampule for needleless injection |
| US5386023A (en) | 1990-07-27 | 1995-01-31 | Isis Pharmaceuticals | Backbone modified oligonucleotide analogs and preparation thereof through reductive coupling |
| US5602240A (en) | 1990-07-27 | 1997-02-11 | Ciba Geigy Ag. | Backbone modified oligonucleotide analogs |
| US5190521A (en) | 1990-08-22 | 1993-03-02 | Tecnol Medical Products, Inc. | Apparatus and method for raising a skin wheal and anesthetizing skin |
| US5527288A (en) | 1990-12-13 | 1996-06-18 | Elan Medical Technologies Limited | Intradermal drug delivery device and method for intradermal delivery of drugs |
| US5480381A (en) | 1991-08-23 | 1996-01-02 | Weston Medical Limited | Needle-less injector |
| US5417662A (en) | 1991-09-13 | 1995-05-23 | Pharmacia Ab | Injection needle arrangement |
| US5644048A (en) | 1992-01-10 | 1997-07-01 | Isis Pharmaceuticals, Inc. | Process for preparing phosphorothioate oligonucleotides |
| US5328483A (en) | 1992-02-27 | 1994-07-12 | Jacoby Richard M | Intradermal injection device with medication and needle guard |
| US5383851A (en) | 1992-07-24 | 1995-01-24 | Bioject Inc. | Needleless hypodermic injection device |
| US5520639A (en) | 1992-07-24 | 1996-05-28 | Bioject, Inc. | Needleless hypodermic injection methods and device |
| US5704911A (en) | 1992-09-28 | 1998-01-06 | Equidyne Systems, Inc. | Needleless hypodermic jet injector |
| US5569189A (en) | 1992-09-28 | 1996-10-29 | Equidyne Systems, Inc. | hypodermic jet injector |
| US5334144A (en) | 1992-10-30 | 1994-08-02 | Becton, Dickinson And Company | Single use disposable needleless injector |
| US5928647A (en) | 1993-01-11 | 1999-07-27 | Dana-Farber Cancer Institute | Inducing cytotoxic T lymphocyte responses |
| US5637684A (en) | 1994-02-23 | 1997-06-10 | Isis Pharmaceuticals, Inc. | Phosphoramidate and phosphorothioamidate oligomeric compounds |
| US5649912A (en) | 1994-03-07 | 1997-07-22 | Bioject, Inc. | Ampule filling device |
| US5466220A (en) | 1994-03-08 | 1995-11-14 | Bioject, Inc. | Drug vial mixing and transfer device |
| US5599302A (en) | 1995-01-09 | 1997-02-04 | Medi-Ject Corporation | Medical injection system and method, gas spring thereof and launching device using gas spring |
| WO1997013537A1 (en) | 1995-10-10 | 1997-04-17 | Visionary Medical Products Corporation | Gas pressured needle-less injection device |
| US5893397A (en) | 1996-01-12 | 1999-04-13 | Bioject Inc. | Medication vial/syringe liquid-transfer apparatus |
| WO1997037705A1 (en) | 1996-04-11 | 1997-10-16 | Weston Medical Limited | Spring-powered dispensing device for medical purposes |
| US5993412A (en) | 1997-05-19 | 1999-11-30 | Bioject, Inc. | Injection apparatus |
| WO1999034850A1 (en) | 1998-01-08 | 1999-07-15 | Fiderm S.R.L. | Device for controlling the penetration depth of a needle, for application to an injection syringe |
| WO2000050590A1 (en) | 1999-02-23 | 2000-08-31 | Curagen Corporation | Mdm interacting protein and methods of use thereof |
| WO2001002556A2 (de) | 1999-06-30 | 2001-01-11 | Max-Delbrück-Centrum für Molekulare Medizin | Mittel zur diagnose, prognose und therapie maligner erkrankungen |
| US20070083334A1 (en) | 2001-09-14 | 2007-04-12 | Compugen Ltd. | Methods and systems for annotating biomolecular sequences |
| US20090170767A1 (en) | 2006-05-31 | 2009-07-02 | Beth Israel Deaconess Medical Center | Soluble Endoglin Compounds for the Treatment and Prevention of Cancer |
| WO2008073660A1 (en) | 2006-11-09 | 2008-06-19 | University Of Washington | Molecules and methods for treatment and detection of cancer |
| US20110008347A1 (en) | 2006-12-01 | 2011-01-13 | Agency For Science ,Technology And Research | Cancer-related protein kinases |
| US20100150918A1 (en) | 2007-04-03 | 2010-06-17 | Micromet Ag | Cross-species-specific binding domain |
| US20120135033A1 (en) | 2008-05-19 | 2012-05-31 | Anu Wallecha | Multiple delivery system for heterologous antigens |
| US20120128584A1 (en) | 2008-06-30 | 2012-05-24 | Oncotherapy Science, Inc. | Anti-cdh3 antibodies labeled with radioisotope label and uses thereof |
| US20130034566A1 (en) | 2009-12-28 | 2013-02-07 | Onco Therapy Science, Inc. | Anti-cdh3 antibodies and uses thereof |
Non-Patent Citations (29)
| Title |
|---|
| "ASC Symposium Series 580", article "Carbohydrate Modifications in Antisense Research" |
| "Remington's Pharmaceutical Sciences", 1990, MACK PUBLISHING CO. |
| BANGHAM ET AL., J. MOL. BIOL., vol. 23, 1965, pages 238 - 252 |
| BEAUCAGE ET AL., TETRAHEDRON, vol. 49, no. 10, 1993, pages 1925 |
| BRIU ET AL., J. AM. CHEM. SOC., vol. 111, 1989, pages 2321 |
| CARLSSON ET AL., NATURE, vol. 380, 1996, pages 207 |
| DENPCY ET AL., PROC. NATL. ACAD. SCI. USA, vol. 92, 1995, pages 6097 |
| EGHOLM, J. AM. CHEM. SOC., vol. 114, 1992, pages 1895 |
| G. GREGORIADIS: "Drug Carriers in Biology and Medicine", 1979, ACADEMIC PRESS, article "Liposomes", pages: 2 |
| JEFFS ET AL., J. BIOMOLECULAR NMR, vol. 34, 1994, pages 17 |
| JEIN, TIPS, vol. 19, 1998, pages 155 - 157 |
| JENKINS ET AL., CHEM. SOC. REV., 1995, pages 169 - 176 |
| KIEDROWSHI ET AL., ANGEW. CHEM. INTL. ED. ENGLISH, vol. 30, 1991, pages 423 |
| KOSHKIN ET AL., J. AM. CHEM. SOC., 1998 |
| LETSINGER ET AL., J. AM. CHEM. SOC., vol. 110, 1988, pages 4470 |
| LETSINGER ET AL., NUCL. ACIDS RES., vol. 14, 1986, pages 3487 |
| LETSINGER ET AL., NUCLEOSIDE & NUCLEOTIDE, vol. 13, 1994, pages 1597 |
| LETSINGER, J. ORG. CHEM., vol. 35, 1970, pages 3800 |
| MAG ET AL., NUCLEIC ACIDS RES., vol. 19, 1991, pages 1437 |
| MEIER ET AL., CHEM. INT. ED. ENGL., vol. 31, 1992, pages 1008 |
| MESMAEKER ET AL., BIOORGANIC & MEDICINAL CHEM. LETT., vol. 4, 1994, pages 395 |
| NIELSEN, NATURE, vol. 365, 1993, pages 566 |
| PAUWELS ET AL., CHEMICA SCRIPTA, vol. 26, 1986, pages 141 |
| SAWAI ET AL., CHEM. LETT., 1984, pages 805 |
| SEON ET AL., CURR DRUG DELIV, vol. 8, no. 1, January 2011 (2011-01-01) |
| SPRINZL ET AL., EUR. J. BIOCHEM., vol. 81, 1977, pages 579 |
| SZOKA ET AL., PROC. NATL. ACAD. SCI. USA, vol. 75, 1978, pages 4194 - 4198 |
| TETRAHEDRON LETT., vol. 37, 1996, pages 743 |
| VIEHL ET AL., BREAST CANCER RES TREAT, vol. 109, 2008, pages 305 |
Cited By (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US10293035B2 (en) | 2014-03-28 | 2019-05-21 | University Of Washington Through Its Center For Commercialization | Breast and ovarian cancer vaccines |
| US11160853B2 (en) | 2014-03-28 | 2021-11-02 | University Of Washington Through Its Center For Commercializaton | Breast and ovarian cancer vaccines |
| US11185578B1 (en) | 2014-03-28 | 2021-11-30 | University Of Washington Through Its Center For Commercialization | Breast and ovarian cancer vaccines |
| US12042531B2 (en) | 2014-03-28 | 2024-07-23 | University Of Washington Through Its Center For Commercialization | Breast and ovarian cancer vaccines |
| JP2023155245A (ja) * | 2017-12-13 | 2023-10-20 | イノビオ ファーマシューティカルズ,インコーポレイティド | サバイビンを標的とするがんワクチンおよびその使用 |
| JP7659599B2 (ja) | 2017-12-13 | 2025-04-09 | イノビオ ファーマシューティカルズ,インコーポレイティド | サバイビンを標的とするがんワクチンおよびその使用 |
Also Published As
| Publication number | Publication date |
|---|---|
| JP2020015755A (ja) | 2020-01-30 |
| US12042531B2 (en) | 2024-07-23 |
| CN120514834A (zh) | 2025-08-22 |
| WO2015149016A3 (en) | 2016-01-28 |
| ES2868305T3 (es) | 2021-10-21 |
| US20210346480A1 (en) | 2021-11-11 |
| US11185578B1 (en) | 2021-11-30 |
| EP3122375A2 (en) | 2017-02-01 |
| CN113403338A (zh) | 2021-09-17 |
| JP2022001065A (ja) | 2022-01-06 |
| JP6836400B2 (ja) | 2021-03-03 |
| US10293035B2 (en) | 2019-05-21 |
| JP7301408B2 (ja) | 2023-07-03 |
| US20220040275A1 (en) | 2022-02-10 |
| DK3122375T3 (da) | 2021-05-25 |
| JP2023123582A (ja) | 2023-09-05 |
| JP2025094154A (ja) | 2025-06-24 |
| CN106456735A (zh) | 2017-02-22 |
| EP3122375B1 (en) | 2021-03-03 |
| JP7659333B2 (ja) | 2025-04-09 |
| US20170182137A1 (en) | 2017-06-29 |
| JP2017516462A (ja) | 2017-06-22 |
| EP3122375A4 (en) | 2018-04-18 |
| US20200054725A1 (en) | 2020-02-20 |
| CN106456735B (zh) | 2021-06-29 |
| US11160853B2 (en) | 2021-11-02 |
| CN113403338B (zh) | 2025-07-15 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US12042531B2 (en) | Breast and ovarian cancer vaccines | |
| JP2021038261A (ja) | がんワクチン組成物およびその使用方法 | |
| JP2016512549A (ja) | ブルトン型チロシンキナーゼ阻害剤及びcyp3a4阻害剤の組み合わせ | |
| US20230165858A1 (en) | Combinations of menin inhibitors and cyp3a4 inhibitors and methods of use thereof | |
| US11602554B2 (en) | P53-targeting vaccines and pd-1 pathway inhibitors and methods of use thereof | |
| AU2022271791A1 (en) | Combinations for treatment of cancer | |
| US20160209414A1 (en) | Compositions and methods for the diagnosis and treatment of breast cancer | |
| AU2022305095A1 (en) | Inhibitors of bruton's tyrosine kinase and methods of their use | |
| HK40058005A (en) | Breast and ovarian cancer vaccines |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 15768124 Country of ref document: EP Kind code of ref document: A2 |
|
| ENP | Entry into the national phase |
Ref document number: 2016559329 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 15300208 Country of ref document: US |
|
| REEP | Request for entry into the european phase |
Ref document number: 2015768124 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2015768124 Country of ref document: EP |