WO2015133772A1 - 신규 대장암의 바이오마커 및 그를 표적으로 하는 항암제 - Google Patents

신규 대장암의 바이오마커 및 그를 표적으로 하는 항암제 Download PDF

Info

Publication number
WO2015133772A1
WO2015133772A1 PCT/KR2015/001962 KR2015001962W WO2015133772A1 WO 2015133772 A1 WO2015133772 A1 WO 2015133772A1 KR 2015001962 W KR2015001962 W KR 2015001962W WO 2015133772 A1 WO2015133772 A1 WO 2015133772A1
Authority
WO
WIPO (PCT)
Prior art keywords
colorectal cancer
notum
nucleic acid
gene
fragment
Prior art date
Application number
PCT/KR2015/001962
Other languages
English (en)
French (fr)
Inventor
이태훈
윤종혁
김재윤
Original Assignee
주식회사 노바셀테크놀로지
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by 주식회사 노바셀테크놀로지 filed Critical 주식회사 노바셀테크놀로지
Publication of WO2015133772A1 publication Critical patent/WO2015133772A1/ko

Links

Images

Classifications

    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/40—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against enzymes
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00—Antineoplastic agents
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
    • C12Q1/00—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
    • C12Q1/68—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving nucleic acids
    • C12Q1/6876—Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes
    • C12Q1/6883—Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes for diseases caused by alterations of genetic material
    • C12Q1/6886—Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes for diseases caused by alterations of genetic material for cancer
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
    • C12Q2600/00—Oligonucleotides characterized by their use
    • C12Q2600/158—Expression markers

Definitions

  • the present invention relates to a biomarker, and more particularly to a novel biomarker for diagnosing and prognostic colon cancer and an anticancer agent targeting the same.
  • colorectal cancer is performed by rectal digital examination, fecal occ ⁇ lt blood test and colonography in patients with colon-related symptoms. Is done.
  • the earliest detection methods currently available involve testing or endoscopic procedures for fecal blood. However, significant tumor size must typically be present before fecal blood can be detected.
  • the susceptibility of guaiacbased fecal testing is 26%, which means that 74% of patients with malignant lesions remain undetected (Ahlquist et al., Gastroenterol. Clin. North Am. 26: 41-55 , 1997).
  • CEA is increased in 95% of tissues obtained from patients with colorectal cancer, gastric cancer, pancreatic cancer and the majority of breast carcinomas, lung carcinomas and head and neck carcinomas (Goldenberg et al., J. Natl. Cancer Inst. (Bethesda) 57: 11-22,1976). Elevated CEA levels have also been reported in patients with non-malignant diseases such as cirrhosis, alcoholic pancreatitis, and smoking, with the majority of patients with colorectal cancer showing normal CEA levels in serum, especially during the early stages of the disease (Carriquiry et al. , Dis.Colon Rectum 42: 921-929, 1999; Herrera et al., Ann. Surg. 183: 5-9, 1976; Wanebo et al., N. Engl. J. Med. 299: 48-451, 1978 ). Therefore, CEA cannot diagnose specific colorectal cancer.
  • the present invention is to solve a number of problems, including the above problems, a biomarker for the diagnosis and prognosis of colorectal cancer for early diagnosis of colorectal cancer and a pharmaceutical for treating colorectal cancer targeting the biomarker It is an object to provide a composition.
  • these problems are exemplary, and the scope of the present invention is not limited thereby.
  • a pharmaceutical composition for treating colorectal cancer which contains a NOTUM inhibitor that inhibits the function of the NOTUM protein or the expression of the gene encoding the NOTUM protein as an active ingredient.
  • a nucleic acid molecule encoding a NOTUM protein, a complementary nucleic acid molecule complementary to the nucleic acid molecule, the nucleic acid molecule or a fragment of the complementary nucleic acid molecule or an aptamer specifically binding to the NOTUM protein,
  • a composition for diagnosing colorectal cancer comprising an antibody or a functional fragment of the antibody.
  • a nucleic acid molecule encoding a NOTUM protein a complementary nucleic acid molecule complementary to the nucleic acid molecule, a fragment of the nucleic acid molecule or complementary nucleic acid molecule, or an aptamer, an antibody specifically binding to the NOTUM protein
  • a composition for determining the prognosis of the colorectal cancer comprising a functional fragment of the antibody is provided.
  • a method of detecting colorectal cancer markers including analyzing the expression level of a NOTUM gene in a biological sample of a subject separated in vitro.
  • a method for detecting a colorectal cancer marker includes analyzing the expression level of a NOTUM gene in a biological sample of a subject separated in vitro to provide information necessary for determining a colorectal cancer prognosis.
  • a method for diagnosing colorectal cancer in a subject including analyzing an expression level of a NOTUM gene present in a biological sample of a subject separated in vitro.
  • a method for determining the prognosis of colorectal cancer in a colorectal cancer patient comprising analyzing the expression level of the NOTUM gene present in a biological sample of the colorectal cancer patient separated in vitro.
  • 1 is a graph showing the result of confirming the increase of the NOTUM gene through Q-PCR according to an embodiment of the present invention.
  • Figure 2 is a Western blotting result image showing the intracellular (cell lysate), secretion amount (CM) of the NOTUM protein according to an embodiment of the present invention.
  • Figure 3 is a graph showing the colorectal cancer cell growth regulation function of NOTUM through the expression suppression according to an embodiment of the present invention.
  • Figure 4 is a graph showing the cell growth regulation function of secreted NOTUM through neutralization according to an embodiment of the present invention.
  • Fab is a fragment of the antigen-binding antibody-binding (fragment antigen-binding) fragments generated by cleaving the antibody molecule with papain, a protease, two of V H -C H1 and V L -C L As dimers of peptides, other fragments produced by papain are referred to as fragment crystalisable (FC).
  • F (ab ′) 2 refers to a fragment containing an antigen binding site among fragments generated by cleaving an antibody with pepsin, a protease, and forms a tetramer in which two Fabs are linked by disulfide bonds. Indicates. Another fragment produced by pepsin is called pFc '.
  • Fab ' is an antibody fragment having a similar structure to the Fab, produced by reducing the F (ab') 2 , with a slightly longer length of the heavy chain portion than the Fab.
  • scFv refers to a recombinant chain fragment that is prepared as a single chain fragment variable in a single chain using variable linkers (V H and V L ) in the Fab of the antibody. do.
  • sdAb single doamain antibody
  • sdAb single doamain antibody
  • V H H is a variable region fragment of the heavy chain of IgG consisting only of dimers of heavy chains found in camels, the smallest ( ⁇ 15 kD) of antibody fragments that specifically bind to the antigen. and it has, Nanobody by four Ablynix ?? It was developed under the trade name.
  • Fv fragment variable
  • V H and V L heavy and light chain variable domains
  • Fab fragment variable domains
  • the antibody is produced by proteolysis under specific conditions or by inserting a gene encoding VH and VL into one expression vector.
  • a “diabody” is a divalent double that is made to shorten the linker length between V H and V L of the scFv (5 aa) so that the two scFvs form dimers with each other.
  • Recombinant antibody fragments having specificity are known to have higher antigen specificity than conventional scFv.
  • aptamer refers to an oligonucleotide or peptidic molecule that specifically binds to a target molecule. Aptamers are discovered by selecting sequences that specifically bind to specific target molecules from a random sequence pool. This process is called SELEX (systematic evolution of ligands by exponential enrichment).
  • siRNA short interfering RNA
  • siRNA short interfering RNA
  • siRNA short hairpin RNA
  • miRNA also called “microRNA”
  • miRNA is a small, non-coding RNA molecule known to play an important role in the transcription and post-transcriptional regulation of gene expression, and in humans more than 1,000 miRNAs in the genome. Is known to exist.
  • a pharmaceutical composition for treating colorectal cancer which contains a NOTUM inhibitor that inhibits the function of the NOTUM protein or an inhibitor of NOTUM gene expression that inhibits the expression of a gene encoding the NOTUM protein as an active ingredient.
  • the colorectal cancer may be non-malignant colorectal cancer, primary colorectal cancer, metastatic colorectal cancer or malignant colorectal cancer of stage III or IV.
  • the NOTUM inhibitor is an aptamer, a small compound, an antibody, a functional fragment of the antibody, an anticent oligonucleotide that specifically binds to a gene encoding the NOTUM protein.
  • miRNA, siRNA or shRNA and the functional fragment may be Fab, F (ab ') 2, Fab', Fv, scFv, sdAb, nanobody, or diabody.
  • the pharmaceutical composition is preferably administered parenterally, but can also be administered orally, in the case of parenteral administration may be administered by intravenous injection, subcutaneous injection, intramuscular injection, intraperitoneal injection.
  • Suitable dosages of the pharmaceutical compositions vary depending on factors such as formulation method, mode of administration, patient's age, weight, sex, morbidity, food, time of administration, route of administration, rate of excretion, and reaction sensitivity. The skilled practitioner can readily determine and prescribe a dosage effective for the desired treatment or prophylaxis. According to a preferred embodiment of the invention, a suitable daily dosage is between 100 ⁇ g / kg and 1 mg / kg body weight. Administration may be once a day or may be divided several times over several weeks.
  • the pharmaceutical composition according to the embodiment of the present invention uses a pharmaceutically acceptable carrier and / or excipient according to a method that can be easily carried out by those skilled in the art to which the present invention belongs.
  • the formulation may be in the form of a solution, suspension or emulsion in an oil or an aqueous medium, or may be in the form of extracts, powders, granules, tablets or capsules, and may further include a dispersant or stabilizer.
  • excipients include lactose, sucrose, white sugar, glucose, corn starch, starch, talc, sorbet, crystalline cellulose, dextrin, kaolin, calcium carbonate, silicon dioxide and the like.
  • binder include polyvinyl alcohol, polyvinyl ether, ethyl cellulose, methyl cellulose, gum arabic, tragacanth, gelatin, shellac, hydroxypropyl cellulose, hydroxypropyl methyl cellulose, calcium citrate, Dextrin, pectin, and the like.
  • the lubricant include magnesium stearate, talc, polyethylene glycol, silica, hardened vegetable oil, and the like.
  • coloring agent if it is normally permitted to add to a pharmaceutical, all can be used. These tablets and granules can be appropriately coated according to sugar, gelatin coating and other needs. Moreover, preservatives, antioxidants, etc. can be added as needed.
  • a nucleic acid molecule encoding a NOTUM protein, a complementary nucleic acid molecule complementary to the nucleic acid molecule, a fragment of the nucleic acid molecule, a fragment of the complementary nucleic acid molecule, or an app specifically binding to the NOTUM protein
  • a composition for diagnosing colorectal cancer comprising a tammer, an antibody, or a functional fragment of the antibody.
  • the colorectal cancer may be primary colorectal cancer, metastatic colorectal cancer or malignant colorectal cancer of stage III or IV.
  • the fragment of the nucleic acid molecule or the fragment of the complementary nucleic acid molecule may be a probe (probe) or primer pair (primer pair).
  • the functional fragment may be Fab, F (ab ') 2 , Fab', scFv, Fv, sdAb, V H H, diabodies or nanobodies.
  • compositions for the determination of colorectal cancer prognosis comprising an aptamer, an antibody, or a functional fragment of the antibody.
  • the NOTUM protein may be a Stanniocaclin 1 protein or a NOTUM 2 protein.
  • the nucleic acid molecule fragment or the complementary nucleic acid molecule fragment may be a probe or a primer pair.
  • the functional fragment of the antibody may be Fab, F (ab ') 2 , Fab', scFv, Fv, sdAb, V H H, diabody or nanobody.
  • a method for detecting a colorectal cancer marker comprising analyzing the expression level of the NOTUM gene in a biological sample of a subject separated in vitro do.
  • the method for detecting a colorectal cancer marker when the expression level of the NOTUM gene of the subject is compared with the expression level of the NOTUM gene of the normal subject, when the expression level of the subject's NOTUM gene is significantly higher than the expression level of the NOTUM gene of the normal subject.
  • the method may further include determining that there is a high probability of having colorectal cancer.
  • the detection method of the colorectal cancer marker can be improved in sensitivity and specificity by using in combination with a marker detection method for diagnosing colorectal cancer.
  • analyzing the expression level of the NOTUM gene may be performed by analyzing the level of mRNA encoding the NOTUM protein or analyzing the level of the NOTUM protein.
  • the level of mRNA may be performed by Northern blot analysis, RT-PCR, or nucleic acid microarray analysis, and the level analysis of the NOTUM protein may be performed by immunochromatography, mass spectrometry, Western blot analysis, enzyme-linked immunosorbent assay (ELISA). ), Or by protein microarray analysis.
  • colon cancer prognostic marker comprising analyzing the expression level of NOTUM gene in a biological sample of colorectal cancer patients separated in vitro A detection method of is provided.
  • the detection method of the colorectal cancer prognostic marker, the expression level of the NOTUM gene of the colorectal cancer patient compared to the expression level of the NOTUM gene of normal or non-malignant colorectal cancer patient, the expression level of the NOTUM gene of the colorectal cancer patient If it is significantly higher than the expression level of the NOTUM gene in normal or non-malignant colorectal cancer patients may further comprise the step of determining that the prognosis of colorectal cancer is not good.
  • the detection method of the colorectal cancer prognostic marker can be improved in sensitivity and specificity by using in combination with other marker detection methods for colorectal cancer prognostic determination.
  • the expression level analysis of the NOTUM gene may be performed by analyzing the level of mRNA encoding the NOTUM protein or analyzing the level of the NOTUM protein.
  • the level of mRNA may be performed by Northern blot analysis, RT-PCR, or nucleic acid microarray analysis, and the level analysis of the NOTUM protein may be performed by immunochromatography, mass spectrometry, Western blot analysis, enzyme-linked immunosorbent assay (ELISA). ), Or by protein microarray analysis.
  • a method for diagnosing colon cancer of a subject including analyzing an expression level of a NOTUM gene present in a biological sample of a subject separated in vitro.
  • the colorectal cancer may be primary colorectal cancer, metastatic colorectal cancer, or malignant colorectal cancer of stage III or IV.
  • the method for diagnosing colorectal cancer may include comparing the expression level of the NOTUM gene of the subject with the expression level of the NOTUM gene of the normal subject, when the expression level of the NOTUM gene of the subject is significantly higher than the expression level of the NOTUM gene of the normal subject.
  • the method may further include determining that there is a high probability of having.
  • the colorectal cancer diagnostic method can be used in combination with other colorectal cancer diagnostic methods to improve sensitivity and specificity.
  • analyzing the expression level of the NOTUM gene may be performed by analyzing the level of mRNA encoding the NOTUM protein or analyzing the level of the NOTUM protein.
  • the level of mRNA may be performed by Northern blot analysis, RT-PCR, or nucleic acid microarray analysis, and the level analysis of the NOTUM protein may be performed by immunochromatography, mass spectrometry, Western blot analysis, enzyme-linked immunosorbent assay (ELISA). ), Or by protein microarray analysis.
  • a method for determining the prognosis of colorectal cancer in a colorectal cancer patient comprising analyzing the expression level of the NOTUM gene present in a biological sample of the colorectal cancer patient separated in vitro.
  • the colorectal cancer prognosis method the expression level of the NOTUM gene of the colorectal cancer patient compared to the expression level of the NOTUM gene of normal or non-malignant colorectal cancer patient, the expression level of NOTUM gene of the colorectal cancer patient is normal or non If the expression level of the NOTUM gene of patients with malignant colorectal cancer is significantly higher, the prognosis of colorectal cancer may be further included.
  • the colorectal cancer prognostic method may be used in combination with other colorectal cancer prognostic methods to improve sensitivity and specificity.
  • the expression level analysis of the NOTUM gene may be performed by analyzing the level of mRNA encoding NOTUM protein or analyzing the level of NOTUM protein.
  • the level of mRNA may be performed by Northern blot analysis, RT-PCR, or nucleic acid microarray analysis, and the level analysis of the NOTUM protein may be performed by immunochromatography, mass spectrometry, Western blot analysis, enzyme-linked immunosorbent assay (ELISA). ), Or by protein microarray analysis.
  • a method for treating colorectal cancer comprising administering to a colon cancer patient a pharmaceutically effective amount of a NOTUM inhibitor that inhibits the function of NOTUM protein or the expression of the gene encoding the NOTUM protein.
  • the colorectal cancer may be primary colorectal cancer, metastatic colorectal cancer or malignant colorectal cancer of stage III or IV.
  • the NOTUM inhibitor is an aptamer, a small compound, an antibody, a functional fragment of the antibody, an anticent oligonucleotide that specifically binds to a gene encoding the NOTUM protein.
  • miRNA, siRNA or shRNA and the functional fragment may be Fab, F (ab ') 2 , Fab', scFv, Fv, sdAb, V H H, diabody or nanobody.
  • Example 1 Mass spectrometry of secretory proteins of colorectal cancer cells
  • the present inventors performed Q-PCR (quantitative PCR) to examine the gene expression of NOTUM in the same colorectal cancer cells in order to verify the mass spectrometry results of NOTUM and confirm the potential for colon cancer biomarkers.
  • Primary colorectal cancer cells (SW480) and metastatic colorectal cancer cells (SW620) were divided into 60 mm plates, replaced with fresh medium after 24 hours, and cultured continuously until 90-100% of the colorectal cancer cells were saturated on the plates. Then, when colorectal cancer cells were 90-100% saturated, total RNA was extracted using an easy BLUE RNA extraction kit (Intron Biotechnology, Inc.), followed by 2 ⁇ g of total RNA and oligo (dT) primers.
  • CDNA was synthesized by reaction.
  • the master mixture used for cDNA synthesis was prepared by mixing 10x reaction buffer solution, 5 mM MgCl 2 , 2.5 mM dNTP mixture, RNase inhibitor, M-MLV reverse transcriptase.
  • Q-PCR used the synthesized cDNA as a template to amplify the NOTUM and RPLPO genes by PCR using the primers described in Table 1.
  • Q-PCR was tested in c1000 thermo cyclin 96-well plates (Bio-Rad, USA).
  • CM cell lysate and secretion amount
  • a thymidine incorporation assay was performed.
  • Primary colorectal cancer cells (SW480) and metastatic colorectal cancer cells (SW620) were dispensed in 6-well plates and cultured for 24 hours, and then transfected with Si-NOTUM and control siRNA produced by GenePharma (Table 2). After 4 hours, the cells were changed to fresh medium and incubated for 72 hours.
  • a mixture of fetal bovine serum is a radioisotope of thymidine (3 H-thymidine) labeled (tritium) to free medium to each well after the culture was incubated for 6 hours.
  • Si-RNA name Si-RNA sequence SEQ ID NO: Si-NOTUM-F 5'-CCCTACTGGTGGAACGCAA-3 ' 6 Si-NOTUM-R 5'-TTGCGTTCCACCAGTAGGG-3 ' 7 control Si-RNA-F 5'-UUCUCCGAACGUGUCACGUTT-3 ' 8 control Si-RNA-R 5'-ACGUGACACGUUCGGAGAATT-3 ' 9
  • the present invention can be used for the diagnosis of colorectal cancer and the development of a therapeutic agent for colorectal cancer.
  • SEQ ID NO: 1 is a partial sequence of a NOTUM protein according to an embodiment of the present invention.
  • SEQ ID Nos: 2 and 3 are nucleic acid sequences of primer pairs used for analysis of the expression level of the NOTUM gene.
  • SEQ ID NOs: 4 and 5 are nucleic acid sequences of primer pairs used for analysis of the expression level of the RPLPO gene used as a control.
  • SEQ ID NOs: 6 and 7 are the nucleic acid sequences of the sense strand sequence and the antisense strand of NOTUM specific siRNA used for knockdown of the NOTUM gene, respectively.
  • SEQ ID NOs: 8 and 9 are nucleic acid sequences of the sense strand sequence and the antisense strand of the control siRNA, respectively.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Genetics & Genomics (AREA)
  • Immunology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Molecular Biology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Pathology (AREA)
  • Biochemistry (AREA)
  • Epidemiology (AREA)
  • Analytical Chemistry (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Zoology (AREA)
  • Biophysics (AREA)
  • Wood Science & Technology (AREA)
  • Biotechnology (AREA)
  • Microbiology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Physics & Mathematics (AREA)
  • Oncology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Engineering & Computer Science (AREA)
  • Hospice & Palliative Care (AREA)
  • Mycology (AREA)
  • Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)

Abstract

본 발명은 새로운 대장암의 바이오 마커 및 이의 용도에 관한 것으로서, 더욱 상세하게는 NOTUM 유전자를 코딩하는 뉴클레오티드 서열, 상기 뉴클레오티드 서열에 상보적인 서열, 상기 뉴클레오티드의 단편 또는 상기 뉴클레오티드 서열에 코딩되는 단백질에 특이적으로 결합하는 항체를 포함하는 대장암 진단 또는 예후 분석용 키트 및 상기 유전자를 코딩하는 뉴클레오티드 서열의 발현을 검출하는 방법을 통해 대장암 마커를 검출하는 방법에 관한 것이다.

Description

신규 대장암의 바이오마커 및 그를 표적으로 하는 항암제
본 발명은 바이오마커에 관한 것으로서, 보다 구체적으로는 신규 대장암 진단용 및 예후 판정용 바이오마커 및 그를 표적으로 하는 항암제에 관한 것이다.
최근의 연구 결과에 의하면, 식이 습관의 변화로 한국에서도 대장암의 발생률과 그에 따른 사망률이 현저하게 증가하고 있으며, 대장암의 발생률은 1995년 이후 2002년까지 420% 증가하여 암 중 발생률 1위를 나타내고 있다(2003 건강보험통계연보, 국민건강보험공단 발간). 또한 미국 및 유럽에서는 암 관련 사망의 두 번째 요인으로 작용한다(American Cancer Society statics for 2009).
대장암의 진단은 대장과 관련된 증세를 보이는 환자에게 직장 수지검사(rectal digital examination), 분변 잠혈검사(fecal occμlt blood test) 및 대장조영술에 의해 수행되고 있으며, 필요에 따라 결장경검사를 통한 조직검사가 행해진다. 현재 이용 가능한 가장 조기의 검출방법은 분변혈에 대한 시험 또는 내시경 과정을 수반한다. 그러나, 분변 혈이 검출되기 전까지 전형적으로는 상당한 종양 크기가 존재해야만 한다. 잠혈 기준(guaiacbased)의 분변 검사의 감수성은 26%로 이는 악성 병변이 있는 74%의 환자가 검출되지 않은 채로 있게 됨을 의미한다(Ahlquist et al., Gastroenterol. Clin. North Am. 26: 41-55, 1997). 전암성 및 암성 병변의 시각화는 조기 검출에 대한 최선의 접근법이지만, 결장내시경은 상당한 비용 뿐만 아니라 환자에게 고통과 위험을 초래할 수 있다는 문제점이 있다(Silvis et al., JAMA 235: 928-930, 1976; Geenen et al., Am. J. Dig. Dis. 20:231-235, 1975; Anderson et al., J. Natl. Cancer Institute 94: 1126-1133, 2002). 상기와 같은 종래의 방법들은 진단의 정확도가 낮을 뿐만 아니라, 대장암이 발병하기 이전의 환자들에 대한 조기 진단이 불가능하며, 피검체들에게 불편을 주는 문제점이 있다. 이러한 기존 진단방법의 단점을 보완하기 위한 방법으로 환자의 혈장에서 종양 표지자(marker)의 농도를 측정하여 대장암을 진단하려는 시도가 있었다(Clinton et al., Biomed. Sci. Instrum. 39: 408-414, 2003; Rui et al., Proteomics 3: 433-439, 2003; Soletormos et al., Dan. Med. Bμll. 48: 229-255, 2001). 현재, 태아성암항원(CEA, Carcinoembryonic antigen), 종양-연관 당단백질을 근거로 한 진단적 혈장 시험만이 대장암 분야에서의 진단 보조에 이용가능하다. CEA는 대장암, 위암, 췌장암 및 대다수의 유방 암종, 폐 암종 및 두경부 암종을 가진 환자로부터 수득된 조직의 95%에서 증가한다(Goldenberg et al., J. Natl. Cancer Inst.(Bethesda) 57: 11-22,1976). 상승된 CEA 수준은 간경변증, 알코올성 췌장염, 흡연 등에 의한 비-악성 질환을 가진 환자에서도 보고되었으며 대장암이 있는 대다수 환자가 혈청에서, 특히 질환의 조기 단계 동안에는 정상적인 CEA 수준을 나타내었다(Carriquiry et al., Dis. Colon Rectum 42: 921-929, 1999; Herrera et al., Ann. Surg. 183: 5-9, 1976; Wanebo et al., N. Engl. J. Med.299: 48-451, 1978). 따라서 CEA는 대장암 특이적인 진단을 하지 못하는 상황이다.
그러나 본 발명은 상기와 같은 문제점을 포함하여 여러 문제점들을 해결하기 위한 것으로서, 대장암의 조기 진단을 위한 대장암 진단 및 예후 판정을 위한 바이오마커 및 상기 바이오 마커를 표적으로 한 대장암 치료용 약학적 조성물을 제공하는 것을 목적으로 한다. 그러나 이러한 과제는 예시적인 것으로, 이에 의해 본 발명의 범위가 한정되는 것은 아니다.
본 발명의 일 관점에 따르면, NOTUM 단백질의 기능 또는 NOTUM 단백질을 암호화하는 유전자의 발현을 억제하는 NOTUM 저해제를 유효성분으로 함유하는 대장암 치료용 약학적 조성물이 제공된다.
본 발명의 다른 일 관점에 따르면, NOTUM 단백질을 코딩하는 핵산분자, 상기 핵산분자에 상보적인 상보 핵산분자, 상기 핵산분자 또는 상기 상보 핵산분자의 단편 또는 상기 NOTUM 단백질에 특이적으로 결합하는 앱타머, 항체 또는 상기 항체의 기능적 단편을 포함하는 대장암 진단용 조성물이 제공된다.
본 발명의 다른 일 관점에 따르면, NOTUM 단백질을 코딩하는 핵산분자, 상기 핵산분자에 상보적인 상보 핵산분자, 상기 핵산분자 또는 상보 핵산분자의 단편 또는 상기 NOTUM 단백질에 특이적으로 결합하는 앱타머, 항체 또는 상기 항체의 기능적 단편을 포함하는 대장암 예후 판정용 조성물이 제공된다.
대장암 진단에 필요한 정보를 제공하기 위하여 체외로 분리된 피험자의 생물학적 시료에 있는 NOTUM 유전자의 발현수준을 분석하는 단계를 포함하는 대장암 마커의 검출방법이 제공된다.
대장암 예후 판정에 필요한 정보를 제공하기 위하여 체외로 분리된 피험자의 생물학적 시료에 있는 NOTUM 유전자의 발현수준을 분석하는 단계를 포함하는 대장암 마커의 검출방법이 제공된다.
아울러, 본 발명의 일관점에 따르면, 체외로 분리된 피험자의 생물학적 시료에 존재하는 NOTUM 유전자의 발현수준을 분석하는 단계를 포함하는, 피험자의 대장암 진단방법이 제공된다.
본 발명의 다른 일관점에 따르면, 체외로 분리된 대장암 환자의 생물학적 시료에 존재하는 NOTUM 유전자의 발현수준을 분석하는 단계를 포함하는, 대장암 환자의 대장암 예후 판정방법이 제공된다.
상기한 바와 같이 이루어진 본 발명의 일 실시예에 따르면, NOTUM을 이용한 대장암 진단 바이오마커를 제공하며 아울러, 대장암 환자의 혈액에서 암활성을 촉진하는 NOTUM을 제거하거나 활성을 억제하는 물질을 통해, 새로운 대장암 치료제의 개발에 사용될 수 있다. 물론 이러한 효과에 의해 본 발명의 범위가 한정되는 것은 아니다.
도 1은 본 발명의 일실시예에 따라 Q-PCR을 통한 NOTUM 유전자의 증가 확인 결과를 나타낸 그래프이다.
도 2는 본 발명의 일실시예에 따라 NOTUM 단백질의 세포내(cell lysate), 분비양(CM)을 나타내는 웨스턴블롯팅 결과 이미지이다.
도 3은 본 발명의 일실시예에 따라 발현억제를 통한 NOTUM의 대장암 세포생장 조절 기능을 나타내는 그래프이다.
도 4는 본 발명의 일실시예에 따라 중화를 통한 분비된 NOTUM의 세포 생장 조절 기능을 나타내는 그래프이다.
용어의 정의:
이하 본 문서에서 사용되는 용어를 정의한다:
본 문서에서 사용되는 용어 "Fab"는 항원-결합 항체단편(fragment antigen-binding)으로서 항체 분자를 단백질 분해효소인 파파인으로 절단하여 생성되는 단편으로 VH-CH1 및 VL-CL의 두 펩타이드의 이량체로, 파파인에 의해 생성된 다른 단편은 Fc(fragment crystalisable)라 지칭한다.
본 문서에서 사용되는 용어 "F(ab')2"는 항체를 단백질 분해효소인 펩신으로 절단하여 생성되는 단편 중 항원 결합 부위를 포함하는 단편으로 상기 Fab 두 개가 이황화결합으로 연결된 4량체의 형태를 나타낸다. 펩신에 의해 생성된 다른 단편은 pFc'으로 지칭한다.
본 문서에서 사용되는 용어 "Fab'"는 상기 Fab와 유사한 구소를 갖는 항체단편으로서 상기 F(ab')2를 환원시켜 생성되며, Fab에 비해 중쇄 부분의 길이가 약간 더 길다.
본 문서에서 사용되는 용어 "scFv"는 단일쇄 가변영역 단편(single chain fragment variable)로서 항체의 Fab 중 가변영역(VH 및 VL)을 링커를 이용하여 단일쇄로 제조한 재조합 항체 단편을 의미한다.
본 문서에서 사용되는 용어 "sdAb(single doamain antibody)"는 나노바디(nanobody)라고 지칭되며, 항체의 단일 가변영역 단편으로 구성된 항체 단편이다. 주로 중쇄로부터 유래한 sdAb가 사용되나, 경쇄로부터 유래한 단일 가변영역 단편 역시 항원에 대하여 특이적 결합이 되는 것으로 보고되고 있다.
본문서에서 사용되는 용어 "VHH"는 낙타류에서 발견된 중쇄의 이량체로만 구성된 IgG의 중쇄의 가변영역 단편으로서 항원에 대한 특이적 결합을 하는 항체 단편 중 가장 작은 크기(~15 kD)을 가지고 있으며, Ablynix사에 의해 Nanobody??라는 상표명으로 개발된 바 있다.
본 문서에서 사용되는 "Fv(fragment variable)"는 항체의 중쇄 및 경쇄의 가변영영(VH 및 VL)만으로 구성된 이량체성 항체 단편으로 크기가 상기 sdAb와 Fab의 중간 정도(약 ~ 25 kD)로서 항체를 특별한 조건에서 단백질 가수분해시켜 생성하거나 VH 및 VL을 암호화하는 유전자를 하나의 발현벡터에 삽입하여 발현시킴으로써 제조한다.
본 문서에서 사용되는 "다이아바디(diabody)"는 scFv의 VH 및 VL 사이의 링커 길이를 짧게하여(5 a.a) 두 개의 scFv가 서로 이량체를 형성하도록 제조된 이가성(divalent)의 이중특이성(bispesific)을 갖는 재조합 항체 단편으로 통상의 scFv 보다 항원 특이성이 더 높은 것으로 알려져 있다.
본 문서에서 사용되는 용어 "앱타머(aptamer)"는 표적 분자(target molecμle)에 특이적으로 결합하는 올리고뉴클레오티드 또는 펩타이 분자를 의미한다. 앱타머는 무작위 서열 풀로부터 특정 표적분자에 특이적으로 결합되는 서열을 선별하는 과정을 통해 발굴된다. 상기와 같은 과정을 SELEX(systematic evolution of ligands by exponential enrichment)라 지칭한다.
본 문서에서 사용되는 용어 "siRNA(short interfering RNA)"는 20-25 bp 크기의 이중가닥 RNA 분자로서 RNA 간섭 경로(RNA interfering pathway)에 의해 해당 siRNA에 특이적인 유전자의 발현을 간섭하는 역할을 수행한다.
본 문서에서 사용되는 용어 "shRNA(short hairpin RNA)"는 단일가닥 RNA로서 수소결합에 의해 이중가닥 부분을 형성하는 줄기(stem) 부분과 고리 형태를 띄는 루프(loop) 부분으로 구분되며 결국 Dicer 등의 단백질에 의해 프로세싱되어 siRNA로 변환되어 siRNA와 동일한 기능을 수행한다.
본 문서에서 사용되는 용어 "miRNA"는 "microRNA"라고도 불리우며, 작은 비암호화 RNA 분자로서 유전자 발현의 전사 및 전사후 조절에 있어서 중요한 역할을 수행하는 것으로 알려져 있고, 인간의 경우 게놈 내에 1,000개가 넘는 miRNA가 존재하는 것으로 알려지고 있다.
발명의 상세한 설명:
이하 본 발명을 보다 상세히 설명하기로 한다.
본 발명의 일 관점에 따르면, NOTUM 단백질의 기능을 억제하는 NOTUM 억제제 또는 NOTUM 단백질을 암호화하는 유전자의 발현을 억제하는 NOTUM 유전자 발현 저해제를 유효성분으로 함유하는 대장암 치료용 약학적 조성물이 제공된다.
상기 약학적 조성물에 있어서, 상기 대장암은 비악성 대장암, 원발성 대장암, 전이성 대장암 또는 Ⅲ기 또는 Ⅳ기의 악성 대장암일 수 있다.
상기 약학적 조성물에 있어서, 상기 NOTUM 저해제는 NOTUM 단백질에 특이적으로 결합하는 앱타머, 소형 화합물, 항체, 상기 항체의 기능성 단편, 상기 NOTUM 단백질을 암호화하는 유전자에 특이적으로 결합하는 안티센트 올리고뉴클레오티드, miRNA, siRNA 또는 shRNA일 수 있고, 상기 기능성 단편은 Fab, F(ab')2, Fab', Fv, scFv, sdAb, 나노바디, 또는 다이아바디일 수 있다.
상기 약학 조성물은 비경구로 투여되는 것이 바람직하나 경구투여도 가능하며, 비경구 투여인 경우에는 정맥내 주입, 피하 주입, 근육 주입, 복강 주입 등으로 투여할 수 있다.
상기 약제학적 조성물의 적합한 투여량은 제제화 방법, 투여 방식, 환자의 연령, 체중, 성, 병적 상태, 음식, 투여 시간, 투여 경로, 배설 속도 및 반응 감응성과 같은 요인들에 의해 다양하며, 보통으로 숙련된 의사는 소망하는 치료 또는 예방에 효과적인 투여량을 용이하게 결정 및 처방할 수 있다. 본 발명의 바람직한 구현예에 따르면, 적합한 1일 투여량은, 100 μg/kg 내지 1 mg/kg(체중)이다. 투여는 하루에 한번 투여할 수도 있고, 몇 주간 수회 나누어 투여할 수 있다.
또한, 상기 본 발명의 일 실시예에 따른 약제학적 조성물은 당해 발명이 속하는 기술분야에서 통상의 지식을 가진 자가 용이하게 실시할 수 있는 방법에 따라, 약제학적으로 허용되는 담체 및/또는 부형제를 이용하여 제제화함으로써 단위 용량 형태로 제조되거나 또는 다용량 용기 내에 내입시켜 제조될 수 있다. 이때 제형은 오일 또는 수성 매질중의 용액, 현탁액 또는 유화액 형태이거나 엑스제, 분말제, 과립제, 정제 또는 캅셀제 형태일 수도 있으며, 분산제 또는 안정화제를 추가적으로 포함할 수 있다. 부형제로서는 예를 들면 유당, 자당, 백당, 포도당, 옥수수 전분(corn starch), 전분, 탈크, 소르비트, 결정 셀룰로오스, 덱스트린, 카올린, 탄산칼슘, 이산화규소 등을 들 수 있다. 결합제로서는 예를 들면 폴리비닐알코올, 폴리비닐에테르, 에틸셀룰로오스, 메틸셀룰로오스, 아라비아고무, 트래거캔스(tragacanth), 젤라틴, 셀락(shellac), 히드록시프로필셀룰로오스, 히드록시프로필메틸셀룰로오스, 구연산칼슘, 덱스트린, 펙틴(pectin) 등을 들 수 있다. 활택제로서는 예를 들면 스테아린산마그네슘, 탈크, 폴리에틸렌글리콜, 실리카, 경화식물유 등을 들 수 있다. 착색제로서는 통상 의약품에 첨가하는 것이 허가되어 있는 것이라면 모두 사용할 수 있다. 이들의 정제, 과립제에는 당의(糖衣), 젤라틴코팅, 기타 필요에 따라 적절히 코팅할 수 있다. 또한, 필요에 따라 방부제, 항산화제 등을 첨가할 수 있다.
발명의 다른 일 관점에 따르면, NOTUM 단백질을 코딩하는 핵산분자, 상기 핵산분자에 상보적인 상보 핵산분자, 상기 핵산분자의 단편, 상기 상보 핵산분자의 단편, 또는 상기 NOTUM 단백질에 특이적으로 결합하는 앱타머, 항체 또는 상기 항체의 기능적 단편을 포함하는 대장암 진단용 조성물이 제공된다. 상기 대장암은 원발성 대장암, 전이성 대장암 또는 Ⅲ기 또는 Ⅳ기의 악성 대장암일 수 있다.
상기 진단용 조성물에 있어서, 상기 핵산분자의 단편 또는 상기 상보 핵산분자의 단편은 프로브(probe) 또는 프라이머쌍(primer pair)일 수 있다.
상기 진단용 조성물에 있어서, 상기 기능성 단편은 Fab, F(ab')2, Fab', scFv, Fv, sdAb, VHH, 다이아바디 또는 나노바디일 수 있다.
본 발명의 다른 일 관점에 따르면, NOTUM 단백질을 코딩하는 핵산분자, 상기 핵산분자에 상보적인 상보 핵산분자, 상기 핵산분자의 단편, 상기 상보 핵산분자의 단편, 또는 상기 NOTUM 단백질에 특이적으로 결합하는 앱타머, 항체 또는 상기 항체의 기능적 단편을 포함하는 대장암 예후 판정용 조성물이 제공된다.
상기 대장암 예후 판정용 조성물에 있어서, 상기 NOTUM 단백질은 Stanniocaclin 1 단백질 또는 NOTUM 2 단백질일 수 있다.
상기 대장암 예후 판정용 조성물에 있어서, 상기 핵산분자 단편 또는 상기 상보 핵산분자의 단편은 프로브(probe) 또는 프라이머쌍(primer pair)일 수 있다.
상기 대장암 예후 판정용 조성물에 있어서, 상기 항체의 기능성 단편은 Fab, F(ab')2, Fab', scFv, Fv, sdAb, VHH, 다이아바디 또는 나노바디일 수 있다.
본 발명의 다른 일 관점에 따르면, 대장암의 진단을 위한 정보제공을 위하여, 체외로 분리된 피험자의 생물학적 시료에 있는 NOTUM 유전자의 발현수준을 분석하는 단계를 포함하는 대장암 마커의 검출방법이 제공된다.
아울러 상기 대장암 마커의 검출방법은, 상기 피험자의 NOTUM 유전자의 발현수준을 정상인의 NOTUM 유전자의 발현수준과 비교하여, 피험자의 NOTUM 유전자의 발현수준이 정상인의 NOTUM 유전자의 발현수준보다 유의하게 높을 경우 대장암에 걸렸을 확률이 높은 것으로 판정하는 단계를 추가로 포함할 수 있다. 아울러, 상기 대장암 마커의 검출방법은 다른 대장암 진단을 위한 마커 검출방법과 병용함으로써 민감도와 특이성을 향상시킬 수 있다. 상기 대장암 마커의 검출방법에 있어서, 상기 NOTUM 유전자의 발현수준 분석하는 단계는 NOTUM 단백질을 암호화하는 mRNA의 수준을 분석하거나 NOTUM 단백질의 수준을 분석함으로써 수행될 수 있다. 상기 mRNA의 수준은 노던 블랏 분석, RT-PCR, 또는 핵산 마이크로어레이 분석에 의해 수행될 수 있고, 상기 NOTUM 단백질의 수준 분석은 면역크로마토그래피, 질량분석, 웨스턴 블랏 분석, 효소결합면역흡수 분석(ELISA), 또는 단백질 마이크로어레이 분석에 의해 수행될 수 있다.
본 발명의 다른 일 관점에 따르면, 대장암 예후 판정에 필요한 정보를 제공하기 위하여, 체외로 분리된 대장암 환자의 생물학적 시료에 있는 NOTUM 유전자의 발현수준을 분석하는 단계를 포함하는 대장암 예후판정마커의 검출방법이 제공된다.
아울러 상기 대장암 예후판정 마커의 검출방법은, 상기 대장암 환자의 NOTUM 유전자의 발현수준을 정상인 또는 비악성 대장암 환자의 NOTUM 유전자의 발현수준과 비교하여, 대장암 환자의 NOTUM 유전자의 발현수준이 정상인 또는 비악성 대장암 환자의 NOTUM 유전자의 발현수준보다 유의하게 높을 경우 대장암의 예후가 좋지 않은 것으로 판정하는 단계를 추가로 포함할 수 있다. 아울러, 상기 대장암 예후판정 마커의 검출방법은 다른 대장암 예후판정을 위한 마커 검출방법과 병용함으로써 민감도와 특이성을 향상시킬 수 있다. 상기 대장암 예후판정 마커의 검출방법에 있어서, 상기 NOTUM 유전자의 발현수준 분석하는 단계는 NOTUM 단백질을 암호화하는 mRNA의 수준을 분석하거나 NOTUM 단백질의 수준을 분석함으로써 수행될 수 있다. 상기 mRNA의 수준은 노던 블랏 분석, RT-PCR, 또는 핵산 마이크로어레이 분석에 의해 수행될 수 있고, 상기 NOTUM 단백질의 수준 분석은 면역크로마토그래피, 질량분석, 웨스턴 블랏 분석, 효소결합면역흡수 분석(ELISA), 또는 단백질 마이크로어레이 분석에 의해 수행될 수 있다.
아울러 본 발명의 일관점에 따르면, 체외로 분리된 피험자의 생물학적 시료에 존재하는 NOTUM 유전자의 발현수준을 분석하는 단계를 포함하는, 상기 피험자의 대장암 진단방법이 제공된다.
상기 대장암 진단방법에 있어서, 상기 대장암은 원발성 대장암, 전이성 대장암 또는 Ⅲ기 또는 Ⅳ기의 악성 대장암일 수 있다.
아울러 상기 대장암 진단방법은, 상기 피험자의 NOTUM 유전자의 발현수준을 정상인의 NOTUM 유전자의 발현수준과 비교하여, 피험자의 NOTUM 유전자의 발현수준이 정상인의 NOTUM 유전자의 발현수준보다 유의하게 높을 경우 대장암에 걸렸을 확률이 높은 것으로 판정하는 단계를 추가로 포함할 수 있다. 아울러, 상기 대장암 진단방법은 다른 대장암 진단방법과 병용함으로써 민감도와 특이성을 향상시킬 수 있다. 상기 대장암 진단방법에 있어서, 상기 NOTUM 유전자의 발현수준 분석하는 단계는 NOTUM 단백질을 암호화하는 mRNA의 수준을 분석하거나 NOTUM 단백질의 수준을 분석함으로써 수행될 수 있다. 상기 mRNA의 수준은 노던 블랏 분석, RT-PCR, 또는 핵산 마이크로어레이 분석에 의해 수행될 수 있고, 상기 NOTUM 단백질의 수준 분석은 면역크로마토그래피, 질량분석, 웨스턴 블랏 분석, 효소결합면역흡수 분석(ELISA), 또는 단백질 마이크로어레이 분석에 의해 수행될 수 있다.
본 발명의 다른 일 관점에 따르면, 체외로 분리된 대장암 환자의 생물학적 시료에 존재하는 NOTUM 유전자의 발현수준을 분석하는 단계를 포함하는, 대장암 환자의 대장암 예후 판정방법이 제공된다.
아울러 상기 대장암 예후판정 방법은, 상기 대장암 환자의 NOTUM 유전자의 발현수준을 정상인 또는 비악성 대장암 환자의 NOTUM 유전자의 발현수준과 비교하여, 대장암 환자의 NOTUM 유전자의 발현수준이 정상인 또는 비악성 대장암 환자의 NOTUM 유전자의 발현수준보다 유의하게 높을 경우 대장암의 예후가 좋지 않은 것으로 판정하는 단계를 추가로 포함할 수 있다. 아울러, 상기 대장암 예후판정 방법은 다른 대장암 예후판정 방법과 병용함으로써 민감도와 특이성을 향상시킬 수 있다. 상기 대장암 예후판정 방법에 있어서, 상기 NOTUM 유전자의 발현수준 분석하는 단계는 NOTUM 단백질을 암호화하는 mRNA의 수준을 분석하거나 NOTUM 단백질의 수준을 분석함으로써 수행될 수 있다. 상기 mRNA의 수준은 노던 블랏 분석, RT-PCR, 또는 핵산 마이크로어레이 분석에 의해 수행될 수 있고, 상기 NOTUM 단백질의 수준 분석은 면역크로마토그래피, 질량분석, 웨스턴 블랏 분석, 효소결합면역흡수 분석(ELISA), 또는 단백질 마이크로어레이 분석에 의해 수행될 수 있다.
본 발명의 다른 일 관점에 따르면, 대장암 환자에 약학적으로 유효한 양의 NOTUM 단백질의 기능 또는 상기 NOTUM 단백질을 암호화하는 유전자의 발현을 저해하는 NOTUM 저해제를 투여하는 단계를 포함하는 대장암의 치료방법이 제공된다.
상기 대장암 치료방법에 있어서, 상기 대장암은 원발성 대장암, 전이성 대장암 또는 Ⅲ기 또는 Ⅳ기의 악성 대장암일 수 있다.
상기 약학적 조성물에 있어서, 상기 NOTUM 저해제는 NOTUM 단백질에 특이적으로 결합하는 앱타머, 소형 화합물, 항체, 상기 항체의 기능성 단편, 상기 NOTUM 단백질을 암호화하는 유전자에 특이적으로 결합하는 안티센트 올리고뉴클레오티드, miRNA, siRNA 또는 shRNA일 수 있고, 상기 기능성 단편은 Fab, F(ab')2, Fab', scFv, Fv, sdAb, VHH, 다이아바디 또는 나노바디일 수 있다.
실시예 1: 대장암세포의 분비단백질체의 질량 분석
대장암세포주(Colon cancer cell line)인 원발성 대장암세포(SW480)와 전이성 대장암 세포(SW620)를 10% 우태아혈청(Gibco, 미국), 1% 항생제(antibiotics)가 첨가된 RPMI1640(Lonza, 미국)를 이용하여 5% CO2, 37℃ 조건의 배양기에서 배양하였다. 각각의 세포를 배양 후, 배양액만을 얻어 6000 rpm의 속도로 60분 동안 원심분리기(Amicon Ultracel-3K)를 이용해 농축하였다. 그런 다음 농축된 배양액을 트립신(protein:trypsin=50:1, g/g)을 처리하여 37℃에 24시간 동안 반응시킨 후 펩타이드화하여 정량적 LC-MS/MS 분석하였다. 상기의 시료처리과정을 거쳐서 조각화된 펩타이드들을 고성능액체크로마토그래피(HPLC)와 QSTAR quadrupole-TOF mass spectrometer (Applied Biosystems, 미국) 질량분석기가 연결된 nano-LC MS 시스템으로 분석한 후에 분석 결과로부터 단백질을 동정하기 위해, 마스코트(MASCOT, ://www.matrixscience.com) 등의 검색엔진을 이용하였다. 마스코트 검색엔진은 UniProt 데이터베이스로부터 파생된 예측된 스펙트럼의 데이터베이스에 대한 각 질량스펙트럼 조사와 비교하기 위해 사용되었다. 1% FDR에서 상기 원발성 대장암과 전이성 대장암 사이에서 분비량 변화를 추정하기 위해, 본 발명자는 변경된 단편 이온(fragment ion) 강도 측정에 기초하여 정규화된 스펙트럼 인덱스를 사용하였다. 본 발명자는 변화를 입증하기 위하여 라벨-프리정량(label free quantification)방법을 적용하였다. 상기 LC-MS/MS 분석을 통해 NOTUM이 원발성 대장암세포(SW480)에 비해 전이성 대장암세포(SW620)에서 4.8배 이상 증가하는 것을 확인하였다(표 1).
표 1 분비단백질체 질량분석을 통한 NOTUM 동정결과 및 정량적 변화
Unique peptide MASCOT score Accession number ID Gene Protein name Folds (Log2) Coverage (%) Sequences
16 1093 Q6P988 NOTUM_HUMAN NOTUM Protein notum homolog 4.86277 6.9 GLADSGWFLDNKQYRHTDCVDTITCAPTEAIRR (서열번호 1)
실시예 2: NOTUM의 유전자발현
본 발명자들은 NOTUM의 질량분석결과를 검증하고 대장암 바이오마커 가능성을 확인하기 위하여, 동일한 대장암세포에서 NOTUM의 유전자 발현을 Q-PCR(정량적 PCR)을 수행하여 조사하였다. 원발성 대장암세포(SW480)와 전이성 대장암세포(SW620)를 60 mm 플레이트에 분주하고, 24시간 후 새로운 배지로 바꿔 준 다음 플레이트에 대장암세포가 90~100% 포화될 때까지 계속 배양하였다. 그런 다음, 대장암 세포가 90~100% 포화됐을 때, 전체 RNA를 easy BLUE RNA 추출 키트((주)인트론바이오테크놀로지, 한국)를 이용하여 추출한 후, 2 μg의 전체 RNA와 oligo(dT) 프라이머를 혼합하여 72℃에서 10분간 반응시키고 얼음에 잠시 둔 다음 총 부피가 20 ㎕가 되도록 master mixture를 첨가하여 실온에서 42℃에서 1시간 동안 반응시킨 후, 95℃에서 5분, 4℃에서 5분간 반응시켜 cDNA를 합성하였다. 상기 cDNA 합성에 사용한 master mixture는 10x 반응완충용액, 5 mM MgCl2, 2.5 mM dNTP mixture, RNase억제제, M-MLV역전사효소를 혼합하여 제조하였다. Q-PCR은 상기 합성된 cDNA를 주형으로 삼아 NOTUM 및 RPLPO 유전자를 표 1에 기재된 프라이머들을 이용하여 PCR방법으로 증폭하였다. Q-PCR는 c1000 thermo cyclin 96-웰 플레이트에서 실험하였다(Bio-Rad, 미국). 20 ㎕ 반응부피가 되도록 하여 10 ㎕의 SYBR Green Master Mix(TaKaRa), NOTUM 프라이머(10 pM: 1㎕)를 reaction mixture에 첨가하고 95℃ 에서 5분간 초기 예열 후, 95℃에서 30초 및 63℃에서 30초, 72℃에서 30초 동안 40 회전으로 진행하였다. 이때 RPLPO를 대조군 유전자로 이용하였다. 도 1에서와 같이 NOTUM 유전자가 원발성 대장암세포(SW480)에 비해 전이성 대장암세포(SW620)에서 증가되어 있음을 확인하였다.
표 2 유전자 증폭에 사용된 프라이머
프라이머명 염기서열 서열번호
NOTUM-F 5'-ATCGCCACACAGACTGCGTCGA-3' 2
NOTUM-R 5'-AACAGCCACTGCACCACGAACA-3' 3
RPLPO-F 5'-CTTCCCACTTGCTGAAAAGG-3' 4
RPLPO-R 5'-TCCGACTCCTCCGACTCTT-3' 5
실시예 3: NOTUM의 웨스턴 블롯팅을 통한 단백질 측정
NOTUM 단백질의 세포내 양(cell lysate)과 분비양(CM)을 확인하기 위해, 원발성 대장암세포(SW480)와 전이성 대장암 세포(SW620)를 60 mm 플레이트에 분주하고, 24시간 배양한 후 새로운 배지로 갈아준 다음 플레이트에 세포가 90~100% 포화될 때까지 계속 배양하였다. 세포가 90~100% 포화됐을 때 분비단백질체와 세포를 회수하였다. 웨스턴 블롯팅은 하기의 방법으로 수행하였다. 먼저 회수된 세포를 용해 완충액(lysis buffer)에 넣고 정량하여 총 시료의 양이 10 μg이 되게 한 후, 5X SDS-sample 완충액을 섞고 95℃에서 5분 동안 둔 후 전기영동을 한 후, 니트로셀룰로오스 막에 흡착시켰다. 항-NOTUM 1차 항체(Cat#ab55839, Abcam, 미국), 및 항-액틴 1차 항체(Santa Cruz, 미국)를 5% 탈지유를 포함하는 TBST 완충액(0.05% Tween 20이 포함된 Tris buffered saline, pH 7.6)에 희석시켜 16시간 동안 반응시킨 후, TBST로 10분간 6차례 세척하였다. 그런 다음, 항-마우스 래빗 퍼옥시다제-결합 2차 항체(KPL, 미국)를 처리하고 실온에서 1시간 반응시킨 후 다시 TBST로 10분간 6차례 세척하였고, ECL 용액(Amersham, 미국)으로 발색하여 필름으로 확인하였다. 도 2에 나타난 바와 같이, NOTUM의 세포내 양(cell lysate)과 분비양(CM)이 전이성 대장암 세포에서 증가되어 있는 것을 확인하였다.
실시예 4: 발현억제(knockdown)을 통한 NOTUM의 세포생장 조절 기능 확인
NOTUM의 대장암세포 세포생장 조절과의 관련성을 조사하기 위해, 티미딘 삽입 분석법(Thymidine incorporation assay)을 실시하였다. 원발성 대장암세포(SW480)와 전이성 대장암세포(SW620)를 6웰 플레이트에 분주하고 24시간 배양한 후, GenePharma사에서 제작한 Si-NOTUM 및 control siRNA를 형질감염(transfection)시켰다(표 2). 4시간 뒤에 새 배지로 갈아 준 다음 72시간 배양하였다. 배양 후 각 웰에 우태아혈청이 없는 배지에 방사성 동위원소(삼중수소)로 표지된 티미딘(3H-thymidine)을 섞은 배지를 넣고 6시간 배양하였다. 인산완충용액(PBS)로 2회 세척한 후에 10% 트라이클로로아세트산(Trichloroacetic acid, TCA)를 넣고 4℃에서 30분 이상 둔 뒤, 다시 PBS로 1번 씻어내고 1 M의 NaOH를 0.6 ml 넣어 37℃에서 25분 두었다. 마지막으로 0.5 ml을 취하여 액체섬광계수기로 방사능 값을 측정하였다. 도 3에서 나타난 바와 같이, NOTUM의 발현억제(knockdown)에 의해 원발성 대장암세포(SW480)의 생장이 유의미하게 감소하였음을 확인하였고(도 3의 A), 전이성 대장암세포(SW620)에서도 생장이 억제되는 경향을 확인하였다(도 3의 B).
표 3 본 발명에 사용된 Si-RNA
Si-RNA명 Si-RNA서열 서열번호
Si-NOTUM-F 5'-CCCTACTGGTGGAACGCAA-3' 6
Si-NOTUM-R 5'-TTGCGTTCCACCAGTAGGG-3' 7
control Si-RNA-F 5'-UUCUCCGAACGUGUCACGUTT-3' 8
control Si-RNA-R 5'-ACGUGACACGUUCGGAGAATT-3' 9
실시예 5: NOTUM의 세포 생장 조절 확인
상기 실시예 4의 결과에 이어 NOTUM 단백질이 실제 대장암 성장과 관련되어 있는지 여부를 확인하기 위해, 대장암 세포에 NOTUM 단백질에 특이적인 항체를 처리하여, 이들 세포의 생장을 관찰하였다. 구체적으로 원발성 대장암세포(SW480)와 전이성 대장암세포(SW620)를 96웰 플레이트에 웰당 5x103의 세포수로 분주하고 24시간 배양한 후, 웰당 400 ng의 Ab-NOTUM(Cat# ab55839)을 처리하여 48시간 배양하였다. 대조군은 Ab-rabbit-IgG를 사용하였다. 그런 다음, 100 μl의 MTT 용액을 넣고 3시간 후 용액을 제거한 후, 다시 DMSO를 100 μl 넣고 5분 후에 ELISA 판독기를 이용하여 450 nm에서 측정하였다. 그 결과, 도 4에 도시된 바와 같이, NOTUM을 항체를 이용하여 중화시킬 경우, 대장암 세포의 성장을 유의하게 억제하며, 특히 전이성 대장암 세포주인 SW620에 대한 생장저해가 더 두드러졌다. 이는, 본 발명의 일 실시예에 대장암 표지인자인 NOTUM이 악성 대장암의 치료를 위한 표적물질로도 매우 효과적임을 시사하는 것이다.
본 발명은 상기 실시예를 참고로 설명되었으나 이는 예시적인 것에 불과하며, 당해 기술분야에서 통상의 지식을 가진 자라면 이로부터 다양한 변형 및 균등한 다른 실시예가 가능하다는 점을 이해할 것이다. 따라서 본 발명의 진정한 기술적 보호 범위는 첨부된 특허청구범위의 기술적 사상에 의하여 정해져야 할 것이다.
본 발명의 일 실시예에 따르면, 대장암의 진단 및 대장암의 치료제의 개발에 사용될 스 있다.
서열번호 1은 본 발명의 일 실시예에 따른 NOTUM 단백질의 부분서열이다.
서열번호 2 및 3은 NOTUM 유전자의 발현 정도의 분석에 사용되는 프라이머쌍의 핵산서열이다.
서열번호 4 및 5는 대조군으로 사용된 RPLPO 유전자의의 발현 정도의 분석에 사용되는 프라이머쌍의 핵산서열이다.
서열번호 6 및 7은 각각 NOTUM 유전자의 넉다운을 위해 사용된 NOTUM 특이적 siRNA의 센스가닥 서열 및 안티센스가닥의 핵산서열이다.
서열번호 8 및 9는 각각 대조군 siRNA의 센스가닥 서열 및 안티센스가닥의 핵산서열이다.

Claims (16)

  1. NOTUM 단백질 기능 또는 상기 NOTUM 단백질을 암호화하는 유전자의 발현을 억제하는 NOTUM 저해제를 유효성분으로 함유하는 대장암 치료용 약학적 조성물.
  2. 제1항에 있어서,
    상기 대장암은 비악성 대장암, 원발성 대장암, 전이성 대장암 또는 Ⅲ기 또는 Ⅳ기의 악성 대장암인, 대장암 치료용 약학적 조성물.
  3. 제1항에 있어서,
    상기 NOTUM 저해제는 NOTUM 단백질에 특이적으로 결합하는 앱타머, 소형 화합물, 항체, 상기 항체의 기능성 단편, 상기 NOTUM 단백질을 암호화하는 유전자에 특이적으로 결합하는 안티센트 올리고뉴클레오티드, miRNA, siRNA 또는 shRNA인, 대장암 치료용 약학적 조성물.
  4. 제3항에 있어서,
    상기 기능성 단편은 Fab, F(ab')2, Fab', scFv, Fv, sdAb, VHH, 다이아바디 또는 나노바디인, 대장암 치료용 약학적 조성물.
  5. NOTUM 단백질을 코딩하는 핵산분자, 상기 핵산분자에 상보적인 상보 핵산분자, 상기 핵산분자의 단편, 상기 상보 핵산분자의 단편, 또는 상기 NOTUM 단백질에 특이적으로 결합하는 앱타머, 항체 또는 상기 항체의 기능성 단편을 포함하는, 대장암 진단용 조성물.
  6. 제5항에 있어서,
    상기 대장암은 원발성 대장암, 전이성 대장암 또는 Ⅲ기 또는 Ⅳ기의 악성 대장암인, 대장암 진단용 조성물.
  7. 제5항에 있어서,
    상기 핵산분자의 단편 또는 상기 상보 핵산분자의 단편은 프로브(probe) 또는 프라이머쌍(primer pair)인, 대장암 진단용 조성물.
  8. 제5항에 있어서,
    상기 항체의 기능성 단편은 Fab, F(ab')2, Fab', scFv, Fv, sdAb, VHH, 다이아바디 또는 나노바디인, 대장암 진단용 조성물.
  9. NOTUM 단백질을 코딩하는 핵산분자, 상기 핵산분자에 상보적인 상보 핵산분자, 상기 핵산분자의 단편, 상기 상보 핵산분자의 단편, 또는 상기 NOTUM 단백질에 특이적으로 결합하는 앱타머, 항체 또는 상기 항체의 기능성 단편을 포함하는, 대장암 예후 판정용 조성물.
  10. 제9항에 있어서,
    상기 핵산분자 단편 또는 상기 상보 핵산분자의 단편은 프로브(probe) 또는 프라이머쌍(primer pair)인, 대장암 예후 판정용 조성물.
  11. 제9항에 있어서,
    상기 항체의 기능성 단편은 Fab, F(ab')2, Fab', scFv, Fv, sdAb, VHH, 다이아바디 또는 나노바디인, 대장암 예후 판정용 조성물.
  12. 대장암 진단에 필요한 정보를 제공하기 위하여 체외로 분리된 피험자의 생물학적 시료에 있는 NOTUM 유전자의 발현수준을 분석하는 단계를 포함하는, 대장암 마커의 검출방법.
  13. 제12항에 있어서,
    상기 대장암은 원발성 대장암, 전이성 대장암 또는 Ⅲ기 또는 Ⅳ기의 악성 대장암인, 대장암 마커의 검출방법.
  14. 제12항에 있어서,
    상기 NOTUM 유전자 유전자의 발현수준 분석하는 단계는 NOTUM 단백질을 암호화하는 mRNA의 수준을 분석하거나 NOTUM 단백질의 수준을 분석함으로써 수행되는, 대장암 마커의 검출방법.
  15. 대장암 예후 판정에 필요한 정보를 제공하기 위하여 체외로 분리된 대장암 환자의 생물학적 시료에 있는 NOTUM 유전자의 발현수준을 분석하는 단계를 포함하는, 대장암 예후판정 마커의 검출방법.
  16. 제15항에 있어서,
    상기 NOTUM 유전자의 발현수준 분석하는 단계는 NOTUM 단백질을 암호화하는 mRNA의 수준을 분석하거나 NOTUM 단백질의 수준을 분석함으로써 수행하는, 대장암 예후판정 마커의 검출방법.
PCT/KR2015/001962 2014-03-06 2015-02-27 신규 대장암의 바이오마커 및 그를 표적으로 하는 항암제 WO2015133772A1 (ko)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
KR1020140026429A KR20150105505A (ko) 2014-03-06 2014-03-06 신규 대장암의 바이오마커 및 그를 표적으로 하는 항암제
KR10-2014-0026429 2014-03-06

Publications (1)

Publication Number Publication Date
WO2015133772A1 true WO2015133772A1 (ko) 2015-09-11

Family

ID=54055523

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2015/001962 WO2015133772A1 (ko) 2014-03-06 2015-02-27 신규 대장암의 바이오마커 및 그를 표적으로 하는 항암제

Country Status (2)

Country Link
KR (1) KR20150105505A (ko)
WO (1) WO2015133772A1 (ko)

Families Citing this family (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR102157813B1 (ko) * 2019-01-29 2020-09-18 재단법인 아산사회복지재단 Ccsp-2에 특이적으로 결합하는 단일클론항체 및 이의 용도

Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2012027723A1 (en) * 2010-08-27 2012-03-01 Stem Centrx, Inc Notum protein modulators and methods of use
WO2013033629A2 (en) * 2011-08-31 2013-03-07 Oncocyte Corporation Methods and compositions for the treatment and diagnosis of colorectal cancer

Patent Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2012027723A1 (en) * 2010-08-27 2012-03-01 Stem Centrx, Inc Notum protein modulators and methods of use
WO2013033629A2 (en) * 2011-08-31 2013-03-07 Oncocyte Corporation Methods and compositions for the treatment and diagnosis of colorectal cancer

Non-Patent Citations (2)

* Cited by examiner, † Cited by third party
Title
AYERS, K. L. ET AL.: "The long-range activity of Hedgehog is regulated in the apical extracellular space by the glypican Dally and the hydrolase Notum.", DEV. CELL, vol. 18, no. 4, 20 April 2010 (2010-04-20), pages 605 - 620, XP055222824, ISSN: 1534-5807 *
TORISU, Y. ET AL.: "Human homolog of NOTUM, overexpressed in hepatocellular carcinoma , is regulated transcriptionally by beta-catenin/TCF", CANCER SCI., vol. 99, no. 6, 21 April 2008 (2008-04-21), pages 1139 - 1146, XP002662071, ISSN: 1347-9032 *

Also Published As

Publication number Publication date
KR20150105505A (ko) 2015-09-17

Similar Documents

Publication Publication Date Title
Wiley et al. GPR68, a proton-sensing GPCR, mediates interaction of cancer-associated fibroblasts and cancer cells
Jafari et al. Adipocyte-derived exosomes may promote breast cancer progression in type 2 diabetes
US20140221244A1 (en) Methods and Compositions for the Treatment and Diagnosis of Colorectal Cancer
US20140206574A1 (en) Methods and Compositons for the Treatment and Diagnosis of Cancer
Chen et al. Integrated analysis of mouse and human gastric neoplasms identifies conserved microRNA networks in gastric carcinogenesis
Liao et al. Aberrant high expression of immunoglobulin G in epithelial stem/progenitor-like cells contributes to tumor initiation and metastasis
JP2019030300A (ja) 乳癌の治療および診断のための方法および組成物
Song et al. Tumor suppressor role of miR-363-3p in gastric cancer
Ou et al. Long non-coding RNA HULC as a diagnostic and prognostic marker of pancreatic cancer
WO2017217807A2 (ko) Nckap1을 유효성분으로 포함하는 대장암 진단 또는 대장암 전이 예후 예측용 바이오마커 조성물
Chen et al. A novel invasive-related biomarker in three subtypes of nonfunctioning pituitary adenomas
Wang et al. Deubiquitinase PSMD7 promotes the proliferation, invasion, and cisplatin resistance of gastric cancer cells by stabilizing RAD23B
Elzi et al. FGF19 functions as autocrine growth factor for hepatoblastoma
KR102216590B1 (ko) 췌장 신경내분비종양의 진단을 위한 조성물
Swayden et al. PML hyposumoylation is responsible for the resistance of pancreatic cancer
Zhang et al. Promoter hypermethylation of CHODL contributes to carcinogenesis and indicates poor survival in patients with early-stage colorectal cancer
WO2015133772A1 (ko) 신규 대장암의 바이오마커 및 그를 표적으로 하는 항암제
WO2022270926A1 (ko) 다양한 암의 진단, 전이 또는 예후 예측용 신규한 바이오마커 및 이의 용도
KR102237463B1 (ko) 암 진단 또는 치료 표적으로서 lypd1의 용도
Zhang et al. IGHG1 promotes malignant progression in breast cancer cells through the regulation of AKT and VEGF signaling
WO2009131366A2 (ko) 위암 또는 대장암 진단 마커 및 치료제로서의 ｃdca5
WO2015133771A1 (ko) 신규 신경교종의 바이오마커 및 그의 용도
Yu et al. Prognostic significance of HOXD4 protein expression in human ovarian cancers
KR101166256B1 (ko) 위암 또는 대장암 진단 마커 및 치료제로서의 ｃｄｃａ５
KR20200099721A (ko) Brn3a를 포함하는 갑상선 암 진단 및 치료용 조성물

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 15759290

Country of ref document: EP

Kind code of ref document: A1

NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 15759290

Country of ref document: EP

Kind code of ref document: A1