WO2015086686A2 - Protease resistant peptides - Google Patents
Protease resistant peptides Download PDFInfo
- Publication number
- WO2015086686A2 WO2015086686A2 PCT/EP2014/077240 EP2014077240W WO2015086686A2 WO 2015086686 A2 WO2015086686 A2 WO 2015086686A2 EP 2014077240 W EP2014077240 W EP 2014077240W WO 2015086686 A2 WO2015086686 A2 WO 2015086686A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- peptide
- alpha
- phe
- methyl
- synthetic
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/575—Hormones
- C07K14/62—Insulins
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/22—Hormones
- A61K38/26—Glucagons
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/0012—Galenical forms characterised by the site of application
- A61K9/0053—Mouth and digestive tract, i.e. intraoral and peroral administration
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
- A61P3/10—Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K1/00—General methods for the preparation of peptides, i.e. processes for the organic chemical preparation of peptides or proteins of any length
- C07K1/107—General methods for the preparation of peptides, i.e. processes for the organic chemical preparation of peptides or proteins of any length by chemical modification of precursor peptides
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/575—Hormones
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/575—Hormones
- C07K14/605—Glucagons
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
- C12Q1/00—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
- C12Q1/34—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving hydrolase
- C12Q1/37—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving hydrolase involving peptidase or proteinase
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/435—Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
- G01N2333/575—Hormones
- G01N2333/605—Glucagons
Definitions
- the present invention provides protease-resistant peptides, methods of making such peptides, as well as compositions comprising protease-resistant peptides and methods of treatment utilizing such peptides. Incorporation of alpha- methyl- functionalized amino acids directly into the main chain during standard peptide synthesis via the methodologies described herein.
- sequence specific modifications i.e. those affecting the primary structure of the peptide itself
- globally effective modifications i.e. those which alter certain overall physicochemical characteristics of the peptide. Introduced strategically, such modifications may reduce the effects of natural physiological processes which would otherwise eliminate or inactivate a peptide whose action is desired, e.g. enzymatic degradation and/or clearance by renal ultrafiltration.
- Sequence specific modifications include incorporation of proteolysis-resistant unusual amino acids, or more involved modifications including cyclization between naturally occurring side-chain functions, e.g. disulfide formation (Cys-Cys), or lactamization (Lys-Glu or Lys-Asp). Additional modifications include cyclization between unnatural amino acid surrogates within the peptide backbone e.g. olefin metathesis stapling.
- Global modifications include processes such as peptide lipidation e.g. palmitoylation and/or PEGylation. Palmitoylation has the effect of creating a circulating reservoir of peptide which weakly associates with naturally abundant albumin in blood serum. Peptide associated with albumin effectively escapes renal ultrafiltration since the size of the associated complex is above the glomerular filtration cutoff. As the peptide dissociates from the surface of the albumin it is again free to interact with endogenous receptors. PEGylation has the effect of physically shielding the peptide from proteolysis and imparts significant hydrophilicity which upon hydration greatly increases the hydrodynamic radius of the therapeutic molecule to overcome renal clearance. However, neither lipidation nor PEGylation have a significant impact on the susceptibility of the main peptide chain towards proteolysis.
- synthetic peptides comprising at least one substitution of an alpha-methyl functionalized amino acid for a native amino acid residue.
- the synthetic peptide maintains substantially the same receptor potency and selectivity as a corresponding synthetic peptide that does not comprise any substitutions.
- the at least one alpha-methyl functionalized amino acid corresponds to the substituted native amino acid residue.
- the at least one alpha- methyl functionalized amino acid includes alpha-methyl Histidine, alpha-methyl Alanine, alpha-methyl Isoleucine, alpha-methyl Arginine, alpha-methyl Leucine, alpha-methyl Asparagine, alpha-methyl Lysine, alpha-methyl Aspartic acid, alpha-methyl Methionine, alpha-methyl Cysteine, alpha-methyl Phenylalanine, alpha-methyl Glutamic acid, alpha- methyl Threonine, alpha-methyl Glutamine, alpha-methyl Tryptophan, alpha-methyl Glycine, alpha-methyl Valine, alpha-methyl Ornithine, alpha-methyl Proline, alpha- methyl Selenocysteine, alpha-methyl Serine and/or alpha-methyl Tyrosine.
- the synthetic peptide is substantially resistant to proteolytic degradation, including for example, DPP-IV, neprilysin, chymotrypsin, plasmin, thrombin, kallikrein, elastase, trypsin and/or pepsin degradation.
- proteolytic degradation including for example, DPP-IV, neprilysin, chymotrypsin, plasmin, thrombin, kallikrein, elastase, trypsin and/or pepsin degradation.
- the native amino acid residue is a site susceptible to proteolytic cleavage.
- the peptide is an incretin class peptide, including but not limited to, a glucagon-like peptide 1 (GLP-1), a glucose-dependent insulinotropic peptide (GIP), an exenatide peptide plus glucagon, secretins, tenomodulin, oxyntomodulin and vasoactive intestinal peptide (VIP).
- GLP-1 glucagon-like peptide 1
- GIP glucose-dependent insulinotropic peptide
- VIP vasoactive intestinal peptide
- the peptide is insulin.
- a GLP-1 peptide is provided, suitably comprising at least three substitutions of alpha-methyl functionalized amino acids for native amino acid residues, wherein the synthetic GLP-1 peptide maintains substantially the same receptor potency and selectivity as a corresponding synthetic GLP-1 peptide that does not comprise the substitutions.
- at least three, or at least four, alpha-methyl functionalized amino acids are alpha-methyl phenylalanine.
- the alpha-methyl functionalized amino acids are alpha-methyl phenylalanine substituted at positions Phe6, Try 13, Phe22 and Trp25.
- the GLP-1 peptides further comprise an aminoisobutyric acid substitution at position 2 (Aib2), a serine modification at position 5 (Ser5), an alpha- methyl lysine substituted at positions 20 (a-MeLys20) and 28 (a-MeLys28), a valine modification position 26 (Val26), and/or a carboxy-terminal lipidation or PEGylation.
- the synthetic peptide maintains substantially the same receptor potency and selectivity as a corresponding synthetic peptide that does not comprise the substitution, and wherein the synthetic peptide is substantially resistant to proteolytic degradation.
- methods of preparing a proteolytically stable peptide comprising exposing a peptide to one or more proteases, identifying at least one native amino acid residue which is a site susceptible to proteolytic cleavage, and substituting an alpha-methyl functionalized amino acid for the identified amino acid residue.
- the synthetic peptide maintains substantially the same receptor potency and selectivity as a corresponding synthetic peptide that does not comprise the substitution, and wherein the synthetic peptide is substantially resistant to proteolytic degradation.
- a synthetic GLP-1 peptide comprising the following amino acid sequence is provided:
- R 1 is Hy, Ac or /?Glu
- R 2 is -NH 2 or -OH
- XI is Ala, Aib, Pro or Gly
- X2 is Thr, Pro or Ser
- X3 is Aib, Bip, ⁇ , ⁇ -Dip, F5-Phe, Phe, PhG, Nle, homoPhe, homoTyr, N-MePhe, a-MePhe, a-Me-2F-Phe, Tyr, Trp, Tyr-OMe, 4I-Phe, 2F-Phe, 3F-Phe, 4F-Phe, 1-NaI, 2- Nal, Pro or di ⁇ -MePhe;
- X4 is Aib, Ala, Asp, Arg, Bip, Cha, ⁇ , ⁇ -Dip, Gin, F5-Phe, PhG, Nle, homoPhe, homoTyr, a-MePhe, a-Me-2F-Phe, Phe, Thr, Trp, Tyr-OMe, 4I-Phe, 2F-Phe, 3F-Phe, 4F- Phe, Tyr, 1-NaI, 2-NaI, Pro, di ⁇ -MePhe, a-MeTyr or di ⁇ -MeTyr;
- X5 is Aib, Lys, D-pro, Pro or a-MeLys or di-P,P-MeLys;
- X6 is Aib, Asp, Arg, Bip, Cha, Leu, Lys, 2C1-Phe, 3C1-Phe, 4C1-Phe, PhG, homoPhe, 2Me-Phe, 3Me-Phe, 4Me-Phe, 2CF 3 -Phe, 3CF 3 -Phe, 4CF 3 -Phe, ⁇ -Phe, ⁇ - MePhe, D-phe, 4I-Phe, 3I-Phe, 2F-Phe, ⁇ , ⁇ -Dip, ⁇ -Ala, Nle, Leu, F5-Phe, homoTyr, a- MePhe, a-Me-2F-Phe, Ser, Tyr, Trp, Tyr-OMe, 3F-Phe, 4F-Phe, Pro, 1-NaI, 2-NaI or di- ⁇ , ⁇ -MePhe; a-MeTyr, di-p,p-MeTyr,
- X7 is Aib, Arg, Bip, Cha, ⁇ , ⁇ -Dip, F5-Phe, PhG, Phe, Tyr, homoPhe, homoTyr, a- MePhe, a-Me-2F-Phe, 2Me-Phe, 3Me-Phe, 4Me-Phe, Nle, Tyr-OMe, 4I-Phe, 1-NaI, 2- Nal, 2F-Phe, 3F-Phe, 4F-Phe, Pro, N-MeTrp, a-MeTrp, di-p,p-MeTrp, di-p,p-Me-Phe; a- MeTyr or di-p,p-MeTyr;
- X8 is Aib, Ala, Arg, Asp, Glu, Nle, Pro, Ser, N-MeLeu, a-MeLeu, Val or a-
- X9 is Aib, Glu, Lys, Pro, a-MeVal or a-MeLeu;
- X10 is Aib, Glu, Lys, Pro or a-MeLys
- XI 1 is Aib, Glu, Pro or Ser.
- X12 is Aib, Gly, Glu, Lys, Pro, a-MeArg or a-MeLys.
- FIG 1. shows exemplary sites for amino acid substitution in glucagon-like peptide
- FIGs. 2A-2C show neprilysin degradation of a GLP-1 comparator.
- FIGs. 3A-3D show stability of synthetic GLP-1 proteins in accordance with embodiments described herein exposed to neprily
- FIGs. 4A-4D show stability of synthetic GLP-1 proteins in accordance with embodiments described herein after 240 hours exposed to neprilysin.
- FIGs. 5A-5C show chymotrypsin degradation of a GLP-1 comparator.
- FIGs. 6A-6D show stability of synthetic GLP-1 proteins in accordance with embodiments described herein exposed to chymotrypsin.
- FIGs. 7A-7D show stability of synthetic GLP-1 proteins in accordance with embodiments described herein exposed to chymotrypsin.
- FIGs. 8A-8C show trypsin degradation of a GLP-1 comparator.
- FIGs. 9A-9C show stability of synthetic GLP-1 proteins in accordance with embodiments described herein exposed to trypsin.
- FIGs. 1 OA- IOC show stability of synthetic GLP-1 proteins in accordance with embodiments described herein exposed to trypsin.
- FIGs. 1 lA-1 IB show serum degradation of a GLP-1 comparator.
- FIGs. 12A-12B show stability of synthetic GLP-1 proteins in accordance with embodiments described herein exposed to serum.
- FIGs. 13A-13D show stability of lipidated comparator and lipidated synthetic
- GLP-1 protein in accordance with embodiments described herein exposed to gastric fluid.
- FIGs. 14A-14E show stability studies of a commercially available GLP-1 protein and a synthetic GLP-1 protein in accordance with embodiments described herein exposed to gastric fluid.
- FIGs. 15A-15E show a zoomed spectrum demonstrating stability studies of a commercially available GLP-1 peptide and a synthetic GLP-1 peptide in accordance with embodiments described herein exposed to gastric fluid.
- polypeptide peptide
- protein protein fragment
- amino acid polymers in which one or more amino acid residue is an artificial chemical mimetic of a corresponding naturally occurring amino acid, as well as to naturally occurring amino acid polymers and non-naturally occurring amino acid polymers.
- amino acid refers to naturally occurring and synthetic amino acids, as well as amino acid analogs and amino acid mimetics that function similarly to the naturally occurring amino acids.
- Naturally occurring amino acids are those encoded by the genetic code, as well as those amino acids that are later modified, e.g., hydroxyproline, gamma-carboxyglutamate, and O-phosphoserine.
- Amino acid analogs refer to compounds that have the same basic chemical structure as a naturally occurring amino acid, e.g., an alpha carbon that is bound to a hydrogen, a carboxyl group, an amino group, and an R group, e.g., homoserine, norleucine, methionine sulfoxide, methionine methyl sulfonium. Such analogs can have modified R groups (e.g., norleucine) or modified peptide backbones, but retain the same basic chemical structure as a naturally occurring amino acid.
- Amino acid mimetics refer to chemical compounds that have a structure that is different from the general chemical structure of an amino acid, but that function similarly to a naturally occurring amino acid.
- amino acid and “amino acid residue” are used interchangeably throughout.
- alpha-methyl amino acids are strategically incorporated during synthesis of a synthetic peptide at a desired site(s).
- the modified amino acids allow the peptide to retain the native side-chain functionality, which is frequently crucial to the receptor potency of the peptide.
- compositions and methods that address the natural enzymatic liability of peptides.
- susceptible sites e.g., scissile bonds
- site-specific incorporation of an alpha-methyl-functionalized amino acid By shielding susceptible sites (e.g., scissile bonds) with a site- specific incorporation of an alpha-methyl-functionalized amino acid, peptides are provided that demonstrate increased resistance to enzymatic degradation, while still maintaining substantially the same receptor potency and selectivity as a wild-type peptide.
- a synthetic peptide comprising at least one substitution of an alpha-methyl functionalized amino acid for a native amino acid residue is provided. In other embodiments, a synthetic peptide comprising at least two substitutions of alpha- methyl functionalized amino acids for native amino acid residues is provided.
- synthetic peptide refers to a polymer of amino acid residues that has been generated by chemically coupling a carboxyl group or C-terminus of one amino acid to an amino group or N-terminus of another. Chemical peptide synthesis starts at the C- terminal end of the peptide and ends at the N- terminus. Various methods for peptide synthesis to generate synthetic peptides are well known in the art.
- alpha-methyl functionalized amino acids refer to amino acids in which the first (alpha) carbon atom of the amino acid includes a methyl group (CH 3 ) substituent bound to the alpha carbon.
- Alpha-methyl functionalized amino acids include any of the twenty-one amino acids that include such a functionalization.
- alpha-methyl functionalized amino acids can be substituted, i.e., can replace, any native amino acid in a peptide.
- the "native" amino acid refers to the amino acid that is present in the natural or wild-type peptide, which is to be substituted.
- Substitution refers to the replacement of a native amino acid with an alpha- functionalized amino acid.
- the native amino acid can be readily replaced by an alpha functionalized amino acid.
- the synthetic peptides described herein can be of any length, i.e., any number of amino acids in length, suitably the synthetic peptides are on the order of about 5 amino acids to about 200 amino acids in length, suitably about 10 amino acids to about 150 amino acids in length, about 20 amino acids to about 100 amino acids in length, about 30 amino acids to about 75 amino acids in length, or about 20 amino acids, about 30 amino acids, about 40 amino acids, about 50 amino acids, about 60 amino acids, about 70 amino acids, about 80 amino acids, about 90 amino acids or about 100 amino acids in length.
- the synthetic peptides described herein that contain one or more alpha-functionalized amino acids substituted for native amino acids maintain substantially the same receptor potency and selectivity as a corresponding synthetic peptide that does not comprise the substitutions.
- the synthetic peptides contain two or more alpha-functionalzed amino acids substituted for the native amino acids.
- receptor potency refers to the inverse of the half maximum (50%) effective concentration (EC 50 ) of the peptide.
- the EC 50 refers to the concentration of peptide that induces a biological response halfway between the baseline response and maximum response, after a specified exposure time, for a selected target of the peptide.
- peptides exhibiting a small value for EC 50 have a corresponding high receptor potency
- peptides exhibiting a large value for EC 50 have a corresponding low receptor potency - the more peptide required to induce a response related to a receptor, the less potent the peptide is for that receptor.
- Methods for determining the receptor potency and EC 50 are known in the art and suitably involve determining stimulation of one or more cellular receptor responses.
- suitable cell lines expressing GLP-1 receptor (GLP-1R), glucagon receptor (GCGR) or glucose-dependent insulinotropic peptide (gastric inhibitory polypeptide) receptor (GIPR) are generated by standard methods. Peptide activation of these various receptors results in downstream production of a cAMP second messenger which can be measured in a functional activity assay. From these measurements, EC 50 values are readily determined.
- the synthetic peptides which comprise one or more substitutions of alpha-functionalized amino acids maintain “substantially the same” receptor potency as a corresponding synthetic peptide that does not comprise the substitutions.
- substantially the same when referring to receptor potency, means that the substituted peptides exhibit suitably about 75% of the receptor potency when the substituted peptides are compared to the receptor potency of peptides that do not contain any substitutions, and rather, contain the original, unmodified, wild-type sequence, or other suitable comparator sequence (i.e. a control).
- the substituted peptides exhibit suitably about 80% of the receptor potency, or about 85% of the receptor potency, or about 90% of the receptor potency, or about 91% of the receptor potency, or about 92% of the receptor potency, or about 93% of the receptor potency, or about 94% of the receptor potency, or about 95% of the receptor potency, or about 96% of the receptor potency, or about 97% of the receptor potency, or about 98% of the receptor potency, or about 99% of the receptor potency, or about 99.1% of the receptor potency, or about 99.2% of the receptor potency, or about 99.3% of the receptor potency, or about 99.4% of the receptor potency, or about 99.5% of the receptor potency, or about 99.6% of the receptor potency, or about 99.7% of the receptor potency, or about 99.8% of the receptor potency, or about 99.9% of the receptor potency, or suitably about 100% of the receptor potency, when the substituted peptides are compared to
- the synthetic peptides which comprise one or more substitutions of alpha-functionalized amino acids also suitably maintain "substantially the same selectivity" as a corresponding synthetic peptide that does not comprise the substitutions.
- selectivity refers to the ability of a peptide to bind its target (i.e., the agonist to which it is designed to bind) while not binding to other non- target proteins.
- the substituted peptides exhibit "substantially the same selectivity" and thus exhibit about 75% of the selectivity when the substituted peptides are compared to the receptor potency of peptides that do not contain any substitutions, and rather, contain the original, unmodified, wild-type sequence, or other suitable comparator sequence (i.e. a control).
- the substituted peptides exhibit suitably about 80% of the selectivity, or about 85% of the selectivity, or about 90% of the selectivity, or about 91% of the selectivity, or about 92% of the selectivity, or about 93% of the selectivity, or about 94% of the selectivity, or about 95% of the selectivity, or about 96% of the selectivity, or about 97% of the selectivity, or about 98% of the selectivity, or about 99% of the selectivity, or about 99.1% of the selectivity, or about 99.2% of the selectivity, or about 99.3% of the selectivity, or about 99.4% of the selectivity, or about 99.5% of the selectivity, or about 99.6% of the selectivity, or about 99.7% of the selectivity, or about 99.8% of the selectivity, or about 99.9% of the selectivity, or suitably about 100% of the selectivity, when the substituted peptides are compared to the selectivity of peptides that do not contain any substitutions, and rather, contain the original
- the alpha-methyl functionalized amino acids correspond to the substituted native amino acids in the wild-type protein. That is the amino acid in the original, wild-type peptide sequence is substituted with an alpha-methyl functionalized amino acid that has the same side chain.
- Phe, Trp, Tyr, etc. are substituted with cc-MePhe, cc-MeTrp, cc-MeTyr, respectively, etc.
- the alpha- methyl functionalized amino acids correspond to the same class as the substituted native amino acids.
- aliphatic alpha- methyl functionalized amino acids are substituted for aliphatic native amino acids; hydroxyl alpha-methyl functionalized amino acids are substituted for hydroxyl native amino acids; sulfur-containing alpha- methyl functionalized amino acids are substituted for sulfur-containing native amino acids; cyclic alpha-methyl functionalized amino acids are substituted for cyclic native amino acids; aromatic alpha-methyl functionalized amino acids are substituted for aromatic native amino acids; basic alpha- methyl functionalized amino acids are substituted for basic native amino acids; and/or acidic alpha-methyl functionalized amino acids are substituted for acidic native amino acids.
- the alpha- methyl functionalized amino acids do not correspond to the substituted native amino acids.
- alpha-methyl functionalized amino acids include, for example, Bachem AG, Switzerland.
- At least one alpha-methyl functionalized amino acid in the synthetic peptides described herein is alpha-methyl phenylalanine.
- At least one alpha- methyl functionalized amino acid in the synthetic peptides described herein is selected from alpha-methyl functionalized Histidine, alpha-methyl functionalized Alanine, alpha-methyl functionalized Isoleucine, alpha-methyl functionalized Arginine, alpha-methyl functionalized Leucine, alpha-methyl functionalized Asparagine, alpha-methyl functionalized Lysine, alpha-methyl functionalized Aspartic acid, alpha-methyl functionalized Methionine, alpha-methyl functionalized Cysteine, alpha-methyl functionalized Phenylalanine, alpha-methyl functionalized Glutamic acid, alpha-methyl functionalized Threonine, alpha-methyl functionalized Glutamine, alpha-methyl functionalized Tryptophan, alpha-methyl functionalized Glycine, alpha-methyl functionalized Valine, alpha-methyl functionalized Ornithine, alpha-methyl functionalized Proline, alpha-methyl functionalized Selenocysteine, alpha-methyl functionalized
- the synthetic peptides described herein are substantially resistant to proteolytic degradation.
- proteolytic degradation means the breakdown of peptides into smaller peptides or even amino acids, generally caused by the hydrolysis of a peptide bond by enzymes.
- the synthetic peptides provided throughout that are "substantially resistant" to proteolytic degradation indicates that at least about 50% of the synthetic peptide remains intact following exposure to an enzyme in conditions that the enzyme is generally active (i.e., suitable pH, temperature, other environmental conditions) for a defined period of time.
- the synthetic peptides provided herein are substantially resistant to proteolytic degradation for a period of at least 4 hours, more suitably at least 8 hours, at least 12 hours, at least 24 hours, at least 36 hours, at least 48 hours, at least 72 hours, at least 96 hours, at least 120 hours, at least 144 hours, at least 168 hours, at least 192 hours, at least 216 hours, at least 240 hours, or about 36 hours to about 240 hours, about 48 hours to 240 hours, about 72 hours to about 240 hours, about 96 hours to about 240 hours, about 120 hours to about 240 hours, about 144 hours to about 240 hours, about 168 hours to about 240 hours, about 192 hours to about 240 hours, or about 216 hours to about 240 hours.
- At least about 80% of the synthetic peptide remains intact following exposure to an enzyme in conditions that the enzyme is generally active for a defined period of time, or more suitably at least about 60%, at least about 70%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, at least about 99.1%, at least about 99.2%, at least about 99.3%, at least about 99.4%, at least about 99.5%, at least about 99.6%, at least about 99.7%, at least about 99.8%, at least about 99.9%, or at least about 100% of the synthetic peptide remains intact following exposure to an enzyme in conditions that the enzyme is generally active for a defined period of time.
- the synthetic peptides provided are suitably substantially resistant to proteolytic degradation by one or more enzymes found in a mammalian body, suitably the human body.
- the synthetic peptides are suitably resistant to proteolytic degradation by one or more of dipeptidyl peptidase-IV (DPP-IV), neprilysin, chymotrypsin, plasmin, thrombin, kallikrein, trypsin, elastase and pepsin.
- DPP-IV dipeptidyl peptidase-IV
- neprilysin neprilysin
- chymotrypsin plasmin
- thrombin kallikrein
- trypsin trypsin
- elastase kallikrein
- pepsin kallikrein
- the synthetic peptides are resistant to proteolytic degradation by to two or more, three or more, four or more, five or more, six or more, seven
- the synthetic peptides described herein can also substantially resistant to proteolytic degradation by other enzymes known in the art.
- the synthetic peptides described herein are substantially resistant to proteolytic degradation by digestive (gastric) enzymes and/or enzymes in the blood/serum.
- the synthetic peptides described herein are substantially resistant to proteolytic degradation by DPP-IV and neprilysin. In embodiments, the synthetic peptides described herein are substantially resistant to proteolytic degradation by pepsin, trypsin, chymotrypsin, and elastase. In embodiments, the synthetic peptides described herein are substantially resistant to proteolytic degradation by plasmin, thrombin and kallikrein. In embodiments, the synthetic peptides described herein are substantially resistant to proteolytic degradation by pepsin, trypsin and chymotrypsin. In embodiments, the synthetic peptides described herein are substantially resistant to proteolytic degradation by pepsin and trypsin.
- substitution of alpha-functionalized amino acids for native amino acids suitably occurs at native amino acid residues that are sites susceptible to proteolytic cleavage. That is, the amino acid residues that are substituted are determined to be sites where proteolytic enzymes are active in cleaving peptide bonds in the natural (i.e., wild-type) peptides. Methods for determining sites of proteolytic cleavage are well known in the art and described herein.
- Any class of peptide can be prepared according to the methods provided herein to yield synthetic peptides having the recited characteristics.
- the synthetic peptides are incretin class peptides.
- Exemplary synthetic incretin class peptides that can be prepared as described herein include, but are not limited to, glucagon-like peptide 1 (GLP-1), a glucose-dependent insulinotropic peptide (GIP), an exenatide peptide, plus glucagon, secretins, tenomodulin, oxyntomodulin or vasoactive intestinal peptide (VIP).
- GLP-1 glucagon-like peptide 1
- GIP glucose-dependent insulinotropic peptide
- VIP vasoactive intestinal peptide
- the synthetic peptide described herein is a GLP-1 peptide. In further embodiments, the synthetic peptide described herein is insulin.
- HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR (SEQ ID NO: l).
- synthetic GLP-1 peptides comprising at least three substitutions of alpha-methyl functionalized amino acids for native amino acid residues.
- the synthetic GLP-1 peptide maintains substantially the same receptor potency and selectivity as a corresponding synthetic GLP-1 peptide that does not comprise the substitutions.
- the at least three alpha-methyl functionalized amino acids are substituted for the corresponding native amino acid residues. That is, as described herein, the amino acid in the native protein is substituted with the same, corresponding alpha- methyl functionalized amino acid.
- the three alpha-methyl functionalized amino acids are alpha-methyl phenylalanine.
- the native amino acids that are being substituted for by the alpha-methyl functionalized phenylalanine are themselves phenylalanine.
- the synthetic peptides described herein simply by replacing a native aromatic amino acid with an alpha-methyl functionalized amino acid from the same class, i.e., an aromatic amino acid, the synthetic peptides described herein have been found to exhibit the desired characteristics of maintained receptor potency and selectivity as well as increased stability.
- the synthetic peptides described herein can further comprise modification by lipidation, including carboxyl- or amino- terminal lipidation, or main-chain lipidation.
- Methods of preparing synthetic peptides with such a lipidation are known in the art. It has been determined that, in combination with the embodiments described herein where native amino acids are substituted for by alpha-methyl functionalized amino acids, that C-terminal lipidation provides additional stability, particularly during exposure to serum and gastric fluid.
- the synthetic GLP-1 peptides provided herein comprise four alpha- methyl functionalized amino acids.
- the four alpha- methyl functionalized amino acids are substituted for corresponding amino acids.
- the four alpha-methyl functionalized amino acids are substituted at positions Phe6, Tryl3, Phe22 and Trp25, and in further embodiments, the four alpha- methyl functionalized amino acids are alpha-methyl phenylalanine substituted at positions Phe6, Tryl3, Phe22 and Trp25.
- the synthetic GLP-1 peptides provided herein comprise six alpha-methyl functionalized amino acids.
- the six alpha-methyl functionalized amino acids are substituted for corresponding amino acids.
- the six alpha-methyl functionalized amino acids are substituted at positions Phe6, Tryl3, Lys20, Phe22, Trp25 and Lys28, and in further embodiments, the six alpha- methyl functionalized amino acids are four alpha-methyl phenylalanines substituted at positions Phe6, Tryl3, Phe22 and Trp25, and two alpha-methyl lysines substituted at positions Lys20 and Lys28.
- the GLP-1 synthetic peptides described herein suitably further comprise an aminoisobutyric acid substitution at position 2 (Aib2).
- the GLP-1 synthetic peptides described herein suitably further comprise a Serine substitution for Threonine at position 5 (Thr5Ser; T5S).
- the GLP-1 synthetic peptides described herein suitably further comprise a Valine substitution for Leucine at position 26 (Leu26Val; L26V).
- synthetic GLP-1 peptides described herein are substantially resistant to proteolytic degradation, including but not limited to, degradation by one or more of DPP-IV, neprilysin, chymotrypsin, plasmin, thrombin, kallikrein, trypsin, elastase and pepsin.
- GLP-1 peptides comprising the following amino acid sequence, in order:
- R 1 His-Xl-Glu-Gly-X2-X3-Thr-Ser-Asp-Val-Ser-Ser-X4-Leu-Glu-Gly-Gln-Ala- Ala-X5-Glu-X6-Ile-Ala-X7-X8-X9-X10-Xl l-X12-R 2 (SEQ ID NO:2),
- R 1 is Hy, Ac or /?Glu
- XI is Ala, Aib, Pro or Gly
- X2 is Thr, Pro or Ser
- X3 is Aib, Bip, ⁇ , ⁇ -Dip, F5-Phe, Phe, PhG, Nle, homoPhe, homoTyr, N-MePhe, a-MePhe, a-Me-2F-Phe, Tyr, Trp, Tyr-OMe, 4I-Phe, 2F-Phe, 3F-Phe, 4F-Phe, 1-NaI, 2- Nal, Pro or di ⁇ -Me-Phe;
- X4 is Aib, Ala, Asp, Arg, Bip, Cha, ⁇ , ⁇ -Dip, Gin, F5-Phe, PhG, Nle, homoPhe, homoTyr, a-MePhe, a-Me-2F-Phe, Phe, Thr, Trp, Tyr-OMe, 4I-Phe, 2F-Phe, 3F-Phe, 4F- Phe, Tyr, 1-NaI, 2-NaI, Pro or di ⁇ -Me-Phe;
- X5 is Aib, Lys, D-pro, Pro or a-MeLys;
- X6 is Aib, Asp, Arg, Bip, Cha, Leu, Lys, 2C1-Phe, 3C1-Phe, 4C1-Phe, PhG, homoPhe, 2Me-Phe, 3Me-Phe, 4Me-Phe, 2CF 3 -Phe, 3CF 3 -Phe, 4CF 3 -Phe, ⁇ -Phe, ⁇ - MePhe, D-phe, 4I-Phe, 3I-Phe, 2F-Phe, ⁇ , ⁇ -Dip, ⁇ -Ala, Nle, Leu, F5-Phe, homoTyr, a- MePhe, a-Me-2F-Phe, Ser, Tyr, Trp, Tyr-OMe, 3F-Phe, 4F-Phe, Pro, 1-NaI, 2-NaI or di- ⁇ , ⁇ -Me-Phe;
- X7 is Aib, Arg, Bip, Cha, ⁇ , ⁇ -Dip, F5-Phe, PhG, Phe, Tyr, homoPhe, homoTyr, a- MePhe, a-Me-2F-Phe, 2Me-Phe, 3Me-Phe, 4Me-Phe, Nle, Tyr-OMe, 4I-Phe, 1-NaI, 2- Nal, 2F-Phe, 3F-Phe, 4F-Phe, Pro, N-MeTrp, a-MeTrp or di ⁇ -Me-Phe;
- X8 is Aib, Ala, Arg, Asp, Glu, Nle, Pro, Ser, N-MeLeu, a-MeLeu or Val;
- X9 is Aib, Glu, Lys, a-MeVal or Pro
- X10 is Aib, Glu, a-MeLys or Pro
- XI 1 is Aib, Glu, Pro or Ser.
- X12 is Aib, Gly, Glu, Pro or a-MeArg.
- the GLP-1 peptides consist of the amino acid sequence set forth in SEQ ID NO: 1
- the methods suitably comprise identifying at least one native amino acid residue in the peptide for substitution. In other embodiments, the methods suitably comprise identifying at least two native amino acid residues in the peptide for substitution. Alpha-methyl functionalized amino acids are then substituted for the identified native amino acid residues.
- the synthetic peptides prepared by the methods provided herein suitably maintain substantially the same receptor potency and selectivity as a corresponding synthetic peptide that does not comprise the substitutions.
- the synthetic peptides prepared according to the methods described herein are also substantially resistant to proteolytic degradation.
- substituted alpha-methyl functionalized amino acids correspond to the substituted native amino acid residues, and in additional embodiments, the substituted alpha-methyl functionalized amino acids correspond to the same class as the substituted native amino acid residues.
- the substituted alpha-methyl functionalized amino acids are alpha-methyl phenylalanine.
- alpha-methyl phenylalanine is substituted for corresponding native amino acids, though in further embodiments of the methods, the alpha-methyl phenylalanine do not have to correspond to the same native amino acids for which the substitution is occurring.
- the synthetic peptides prepared according to the methods described herein are substantially resistant to one or more of DPP-IV, neprilysin, chymotrypsin, plasmin, thrombin, kallikrein, trypsin, elastase and pepsin degradation.
- synthetic peptides are prepared as C-terminal carboxamides on
- identifying at least one native amino acid residue in the peptide for substitution suitably comprises identifying amino acids at sites susceptible to enzymatic cleavage.
- exemplary methods of identifying amino acids at sites susceptible to enzymatic cleavage are well known in the art.
- methods of identifying amino acids at sites susceptible to enzymatic cleavage suitably comprise exposing a natural peptide (i.e., a wild-type peptide) to a single enzyme under conditions in which the enzyme is active (e.g., suitable pH, buffer conditions, temperature, etc.) for a predetermined amount of time and measuring the enzymatic degradation products of the peptide.
- exemplary methods for measuring the enzymatic degradation products include, for example, reverse-phase liquid chromatography- mass spectrometry.
- peptide solutions are added to solutions of a desired protease.
- the peptide and enzyme are the co-incubated, suitably at about 37 °C. Aliquots of the incubated peptide-enzyme mixture are withdrawn periodically, quenched to arrest proteolytic activity, and analyzed by liquid chromatography-mass spectrometry (LC/MS). Analytes are suitably detected by both UV absorption (e.g., at 210 nm) and by ionization using a mass detector (ESI+ mode). Peptidic species (fragments) deriving from enzymatic cleavage of peptides are analyzed post-process, and their molecular masses are used to identify the precise cleavage position (highlighting the scissile bond in each case).
- the methods described herein are suitably used to prepare any class of peptide having the recited characteristics.
- the methods are used to prepare are incretin class peptides.
- Exemplary synthetic incretin class peptides that can be prepared as described herein include, but are not limited to, glucagon-like peptide 1 (GLP-1), a glucose-dependent insulinotropic peptide (GIP), an exenatide peptide, plus glucagon, secretins, tenomodulin and oxyntomodulin.
- the methods are used to prepare synthetic GLP-1 peptides. In further embodiments, the methods are used to prepare synthetic insulin. [0099] In further embodiments, methods of preparing a proteolytically stable peptide are provided. Suitably, such methods comprise exposing a peptide to one or more proteases, identifying at least two native amino acid residues which are sites susceptible to proteolytic cleavage, and substituting alpha-methyl functionalized amino acids for the identified amino acid residues.
- Such methods provide a synthetic peptide that maintains substantially the same receptor potency and selectivity as a corresponding synthetic peptide that does not comprise the substitution(s).
- the methods also provide a synthetic peptide that is substantially resistant to proteolytic degradation.
- the substituted alpha-methyl functionalized amino acids correspond to the substituted native amino acid residues, and in additional embodiments, the substituted alpha-methyl functionalized amino acids correspond to the same class as the substituted native amino acid residues.
- the substituted alpha-methyl functionalized amino acids are selected from alpha-methyl functionalized Histidine, alpha-methyl functionalized Alanine, alpha-methyl functionalized Isoleucine, alpha-methyl functionalized Arginine, alpha-methyl functionalized Leucine, alpha-methyl functionalized Asparagine, alpha-methyl functionalized Lysine, alpha-methyl functionalized Aspartic acid, alpha-methyl functionalized Methionine, alpha-methyl functionalized Cysteine, alpha-methyl functionalized Phenylalanine, alpha-methyl functionalized Glutamic acid, alpha-methyl functionalized Threonine, alpha-methyl functionalized Glutamine, alpha-methyl functionalized Tryptophan, alpha-methyl functionalized Glycine, alpha-methyl functionalized Valine, alpha-methyl functionalized Ornithine, alpha-methyl functionalized Proline, alpha-methyl functionalized Selenocysteine, alpha-methyl functionalized Serine and alpha-methyl functionalized Tyros
- the substituted alpha-methyl functionalized amino acids are alpha-methyl phenylalanine and/or alpha-methyl lysine.
- alpha-methyl phenylalanine and/or alpha-methyl lysine are substituted for corresponding native amino acids, though in further embodiments of the methods, the alpha-methyl phenylalanine and/or alpha-methyl lysine do not have to correspond to the same native amino acids for which the substitution is occurring.
- the synthetic peptides prepared according to the methods described herein are substantially resistant to one or more of DPP-IV, neprilysin, chymotrypsin, plasmin, thrombin, kallikrein, trypsin, elastase and pepsin degradation.
- the methods described herein are suitably used to prepare any class of peptide having the recited characteristics.
- the methods are used to prepare are incretin class peptides.
- Exemplary synthetic incretin class peptides that can be prepared as described herein include, but are not limited to, glucagon-like peptide 1 (GLP-1), a glucose-dependent insulinotropic peptide (GIP), an exenatide peptide, plus glucagon, secretins, tenomodulin and oxyntomodulin.
- the methods are used to prepare synthetic GLP-1 peptides. In further embodiments, the methods are used to prepare synthetic insulin.
- formulations comprising a synthetic peptide described herein.
- formulations comprise a synthetic peptide as described herein and a carrier.
- Such formulations can be readily administered in the various methods described throughout.
- the formulation comprises a pharmaceutically acceptable carrier.
- pharmaceutically acceptable carrier means one or more non-toxic materials that do not interfere with the effectiveness of the biological activity of the synthetic peptides. Such preparations may routinely contain salts, buffering agents, preservatives, compatible carriers, and optionally other therapeutic agents. Formulations may also routinely contain compatible solid or liquid fillers, diluents or encapsulating substances which are suitable for administration into a human.
- carrier denotes an organic or inorganic ingredient, natural or synthetic, with which the synthetic peptide is combined to facilitate the application.
- Formulations as described herein may be formulated for a particular dosage.
- Dosage regimens may be adjusted to provide the optimum desired response. For example, a single bolus may be administered, several divided doses may be administered over time or the dose may be proportionally reduced or increased as indicated by the therapeutic situation. It is especially advantageous to formulate parenteral compositions in dosage unit forms for ease of administration and uniformity of dosage.
- Dosage unit forms as used herein refers to physically discrete units suited as unitary dosages for the subjects to be treated; each unit contains a predetermined quantity of a synthetic peptide calculated to produce the desired therapeutic effect in association with the required pharmaceutical carrier.
- the specification for the dosage unit forms are dictated by, and directly dependent on, (a) the unique characteristics of the synthetic peptide and the particular therapeutic effect to be achieved, and (b) the limitations inherent in the art of compounding such a synthetic peptide.
- Formulations described herein can be formulated for particular routes of administration, such as oral, nasal, pulmonary, topical (including buccal and sublingual), rectal, vaginal and/or parenteral administration.
- routes of administration such as oral, nasal, pulmonary, topical (including buccal and sublingual), rectal, vaginal and/or parenteral administration.
- the formulations may conveniently be presented in unit dosage form and may be prepared by any methods known in the art of pharmacy.
- the amount of synthetic peptide which can be combined with a carrier material to produce a single dosage form will vary depending upon the subject being treated, and the particular mode of administration.
- the amount of synthetic peptide which can be combined with a carrier material to produce a single dosage form will generally be that amount of the composition which produces a therapeutic effect.
- Also provided herein are methods of treating a patient comprising administering a synthetic peptide, e.g., the formulations, described herein to a patient in need thereof.
- subjects that can be administered the synthetic peptides in the various methods described herein are mammals, such as for example, humans, dogs, cats, primates, cattle, sheep, horses, pigs, etc.
- Exemplary methods by which the synthetic peptides can be administered to the subject in any of the various methods described herein include, but are not limited to, intravenous (IV), intratumoral (IT), intralesional (IL), aerosal, percutaneous, oral, endoscopic, topical, intramuscular (IM), intradermal (ID), intraocular (IO), intraperitoneal (IP), transdermal (TD), intranasal (IN), intracereberal (IC), intraorgan (e.g. intrahepatic), slow release implant, or subcutaneous administration, or via administration using an osmotic or mechanical pump.
- IV intravenous
- IT intratumoral
- IL intralesional
- aerosal percutaneous
- oral endoscopic
- topical intramuscular
- ID intradermal
- ID intraocular
- IO intraperitoneal
- IP intraperitoneal
- TD transdermal
- TD intranasal
- IC intracereberal
- intraorgan e.g. intrahepatic
- the synthetic peptides are administered as soon as possible after a suitable diagnosis, e.g., within hours or days.
- a suitable diagnosis e.g., within hours or days.
- the duration and amount of synthetic peptide to be administered are readily determined by those of ordinary skill in the art and generally depend on the type of peptide and disease or disorder being treated.
- the methods of treatment comprise treating a patient diagnosed with diabetes comprising administering a therapeutically effective amount of a suitable synthetic peptide as described herein, suitably a synthetic GLP-1 peptide as described herein.
- the term "therapeutically effective amount” refers to the amount of a synthetic peptide, or formulation, that is sufficient to reduce the severity of a disease or disorder (or one or more symptoms thereof), ameliorate one or more symptoms of such a disease or disorder, prevent the advancement of such a disease or disorder, cause regression of such a disease or disorder, or enhance or improve the therapeutic effect(s) of another therapy.
- the therapeutically effective amount cannot be specified in advance and can be determined by a caregiver, for example, by a physician or other healthcare provider, using various means, for example, dose titration. Appropriate therapeutically effective amounts can also be determined by routine experimentation using, for example, animal models.
- methods are provided of treating a patient diagnosed with diabetes comprising administering a therapeutically effective amount of synthetic insulin to a patient.
- the methods of administration of the synthetic peptides or formulations described herein are delivered orally.
- the synthetic peptides are substantially resistant to proteolytic degradation, i.e., degradation by enzymes in the stomach following oral administration.
- N-a-Fmoc-L-amino acids were obtained from Bachem AG, Switzerland. Unusuaal amino acids were obtained from Iris Biotech AG, Germany or prepared by Pharmaron, China.
- NOVASYN ® TGR TeentaGel Rink
- NOVASYN ® TGA TeentaGel Wang
- All peptides were prepared by automated synthesis (PTI Prelude) using the Fmoc/Tiu protocol.
- Asparagine (Asn) and glutamine (Gin) were incorporated as their sidechain trityl (Trt) derivatives.
- Trp Tryptophan
- Thr threonine
- Tyr tyrosine
- Serine (Ser) threonine
- Thr threonine
- Tr tyrosine
- Glu glutamate
- Arginine (Arg) was incorporated as the sidechain Pbf derivative. Synthesis reagents were obtained from Sigma- Aldrich, Dorset, United Kingdom. Solvents were obtained from Merck, Darmstadt, Germany at the highest grade available and used without further purification.
- Crude peptides were chromatographed using an Agilent Polaris C8-A stationary phase (21.2 x 250 mm, 5 micron) eluting with a linear solvent gradient from 10% to 70% MeCN (0.1% TFA v/v) in water (0.1% TFA v/v) over 30 minutes using a Varian SD-1 Prep Star binary pump system, monitoring by UV absorption at 210 nm.
- the desired peptide-containing fractions were pooled, frozen (dry-ice/acetone) and lyophilized.
- Mass Lynx 3100 platform Analytes were chromatographed by elution on a Waters X- Bridge CI 8 stationary phase (4.6 x 100 mm, 3 micron) using a linear binary gradient of 10-90% MeCN (0.1% TFA v/v) in water (0.1% TFA v/v) over 10 minutes at 1.5 mL min 1 at ambient temperature. Analytes were detected by both UV absorption at 210 nm and ionization using a Waters 3100 mass detector (ESI + mode), verifying molecular masses against calculated theoretical values. Analytical RP-HPLC spectra were recorded using an Agilent 1260 Infinity system.
- Neutral endopeptidase (Neprilysin): 1.0 ⁇ g rhNEP was reconstituted in 900 ⁇ of an assay buffer comprising: 50 mM Tris, 50mM NaCl, 50mM NaHC0 3 , adjusting to pH 8.3 using NaOH (l.O M).
- Pepsin 1.0 mg of lyophilized pepsin from porcine gastric mucosa was reconstituted in 900 ⁇ , of the following assay buffer: 10 mM HCl affording a 0.4% (w/v) solution at pH 2.0.
- Trypsin A solution of 1 mg/mL lyophilized trypsin from porcine pancreas was reconstituted in the following assay buffer: 50 mM Tris, 10 mM CaCl 2 , 150 mM NaCl, 1 mM HCl, adjusting to pH 7.8.
- Chymotrypsin 1.0 ⁇ g rhCTRC was reconstituted in 900 ⁇ of the following assay buffer: 50 mM Tris, 10 mM CaCl 2 , 150 mM NaCl, 1 mM HCl, adjusting to pH 7.8.
- Peptides for evaluation were prepared to a concentration of 1.0 mg/mL solutions in either pure water, sterile saline for injection (0.9% w/v NaCl/water) or IX PBS (Dulbecco). ⁇ (100 ⁇ g/mL peptide) of these solutions was added to 900 ⁇ of each protease solution. Additional experiments were performed examining protein degradation during exposure to serum and gastric fluid. For serum studies, peptides were incubated with 50% female Sprague-Dawley strain rat serum (SD rat serum). For gastric fluid studies, peptides were incubated 1: 1 (volume:volume), fresh rat gastric fluid.
- the biological activities/receptor potencies of the synthetic GLP-1 peptides described herein are suitably tested for biological activity, e.g., stimulation of one or more cellular receptor responses.
- Stable cell lines expressing human, mouse, rat, or dog GLP-1 receptor (GLP-1R), glucagon receptor (GCGR) or glucose-dependent insulinotropic peptide (gastric inhibitory polypeptide) receptor (GIPR) are generated in HEK293 cells or CHO cells by standard methods. Peptide activation of these various receptors results in downstream accumulation of cAMP second messenger which can be measured in a functional activity assay.
- Low protein binding 384-well plates (Greiner # 781280) are used to perform eleven 1 in 5 serial dilutions of test samples which are made in assay buffer. All sample dilutions are made in duplicate.
- a frozen cryo-vial of cells expressing the receptor of interest is thawed rapidly in a water-bath, transferred to pre- warmed assay buffer and spun at 240xg for 5 minutes.
- Cells are re-suspended in assay buffer at a batch-dependent optimized concentration (e.g. hGCGR cells at 2xl0 5 cells/ml, hGLP-lR and hGIPR cells at lxlO 5 cells /ml).
- a 5 ⁇ replica is stamped onto a black shallow- well u- bottom 384-well plate (Corning # 3676). To this, 5 ⁇ cell suspension is added and the plates incubated at room temperature for 30 minutes.
- cAMP levels are measured using a commercially available cAMP dynamic 2
- anti-cAMP cryptate donor fluorophore
- cAMP-d2 acceptor fluorophore
- 5 ⁇ anti-cAMP cryptate is added to all wells of the assay plate
- 5 ⁇ cAMP-d2 is added to all wells except non-specific binding (NSB) wells, to which conjugate and lysis buffer are added.
- Plates are incubated at room temperature for one hour and then read on an Envision (Perkin Elmer) using excitation wavelength of 320nm and emission wavelengths of 620nm & 665nm. EC 50 values of the synthetic peptides determined in cAMP assays are then determined.
- CHO cells with stable recombinant expression of the human, mouse or rat GCGR or GLP-1 receptor are cultured in assay buffer as above).
- Cryopreserved cell stocks are prepared in lx cell freezing medium-DMSO serum free (Sigma Aldrich) at either 1x10 or 2x10 /vial and stored at -80°C. Cells are rapidly thawed at 37°C and then diluted into assay buffer (buffer as above) containing serum albumin at 4.4, 3.2 and 3.2% for human, rat, and mouse serum albumin respectively.
- Peptides are serially diluted in 100% DMSO and then diluted 100 fold into assay buffer as above containing serum albumin at stated final concentration.
- Diluted peptides are then transferred into 384 black shallow well microtitre assay plates.
- Cells are added to the assay plates and incubated for 30 min at room temperature.
- the assay is stopped and cAMP levels measured using the HTRF® dynamic d2 cAMP assay kit available from CisBio Bioassays, as per the manufacturer's guidelines. Plates are read on Perkin Elmer ENVISION® fluorescence plate readers.
- Human and rat serum albumin are purchased from Sigma Aldrich and mouse serum albumin from Equitech Bio Ltd.
- EC 50 values determined are dependent on both the potency of the peptides tested at the GLP-1 and glucagon receptors in the recombinant cell lines and on the affinity of the peptide for serum albumin, which determines the amount of free peptide. Association with serum albumin increases the EC 50 value obtained.
- the fraction of free peptide at plasma concentrations of albumin and the EC 50 at 0% serum albumin (SA) can be calculated based on the variation in cAMP generation with the SA concentration. To compare the balance of activities at the GLP-1R and GCGR between different peptides and across different conditions, these can be correlated, where the ECso's are related to those of comparator peptides.
- the biological activities/receptor potencies of the synthetic GLP-1 peptides described herein are suitably tested for biological activity, e.g., stimulation of one or more cellular receptor responses.
- Stable cell lines expressing human, mouse, rat, or dog GLP-1 receptor (GLP-1R), glucagon receptor (GCGR) or glucose-dependent insulinotropic peptide (gastric inhibitory polypeptide) receptor (GIPR) are generated in HEK293s or CHO cells by standard methods. Peptide activation of these various receptors results in downstream production of cAMP second messenger which can be measured in a functional activity assay.
- Assay Medium 10% FBS in DMEM (Gibco # 41966), containing 0.5mM IBMX (Sigma # 17018).
- Low protein binding 384- well plates (Greiner # 781280) are used to perform eleven 1 in 5 serial dilutions of test samples which are made in assay medium. All sample dilutions are made in duplicate.
- a frozen cryo-vial of cells expressing the receptor of interest is thawed rapidly in a water-bath, transferred to pre- warmed assay media and spun at 240xg for 5 minutes.
- Cells are re-suspended in assay media at an optimized concentration (e.g. hGCGR cells at lxlO 5 cells/ml, hGLP-lR and hGIPR cells at 0.5xl0 5 cells /ml).
- hGCGR cells at lxlO 5 cells/ml
- hGLP-lR hGLP-lR
- hGIPR cells at 0.5xl0 5 cells /ml.
- cAMP levels are measured using a commercially available cAMP dynamic 2
- anti-cAMP cryptate donor fluorophore
- cAMP-d2 acceptor fluorophore
- 5 ⁇ anti-cAMP cryptate is added to all wells of the assay plate
- 5 ⁇ cAMP-d2 is added to all wells except non-specific binding (NSB) wells, to which conjugate and lysis buffer are added.
- Plates are incubated at room temperature for one hour and then read on an Envision (Perkin Elmer) using excitation wavelength of 320nm and emission wavelengths of 620nm & 665nm. EC 50 values of the synthetic peptides determined in cAMP assays are then determined.
- CHO cells with stable recombinant expression of the human, mouse or rat GlucR or GLP- 1 receptor are cultured in DMEM 10% FBS and geneticin (100 ⁇ g/ml).
- Cryopreserved cells stocks are prepared in lx cell freezing medium-DMSO serum free (Sigma Aldrich) at 2x10 '/vial and stored at -80°C. Cells are rapidly thawed at 37 °C and then diluted into assay buffer (DMEM) containing serum albumin at 4.4, 3.2 and 3.2% for human, rat, and mouse serum albumin respectively.
- DMEM assay buffer
- Peptides are serially diluted in DMSO and then diluted 100 fold into DMEM containing serum albumin at stated final concentration.
- Diluted peptides are then transferred into 384 black shallow well microtitre assay plates.
- Cells are added to the assay plates and incubated for 30 min at room temperature.
- the assay is stopped and cAMP levels measured using the HTRF® dynamic d2 cAMP assay kit available from CisBio Bioassays, as per the manufacturers guidelines. Plates are read on Perkin Elmer ENVISION® fluorescence plate readers.
- Human and rat serum albumin are purchased from Sigma Aldrich and mouse serum albumin from Equitech Bio Ltd.
- EC 50 values determined are dependent on both the intrinsic potency of the peptides tested at the GLP- 1 and glucagon receptors in the recombinant cell lines and on the affinity of the peptide for serum albumin, which determines the amount of free peptide. Association with serum albumin increases the EC 50 value obtained.
- the fraction of free peptide at plasma concentrations of albumin and the EC 50 at 0% HSA can be calculated based on the variation in cAMP generation with the HSA concentration. To compare the balance of activities at the GLP-1R and GlucR between different peptides and across different conditions, these can be correlated, where the ECso's are related to those of comparator peptides.
- Arg 30 Shown below in Table 2 is an exemplary design flow showing iterations for developing a synthetic, glucagon-like peptide 1 (GLP-1) as described herein, where these amino acid sites, as well as others, were substituted. It should be recognized that such a design flow can be readily applied to any desired peptide to produce a protease protected peptide as desired. TABLE 2
- Trp 25 as well as a-MeTrp 25
- Methyl residues maintains EFIAW 25 LV-(a-MeK) 28 -G- full potency/selectivity (a-MeR) 30
- Trp 25 replaced with Phe.
- MeVal 27 overcomes MeF) 1 -LE 15 GQAAK 20 E- cleavage restores potency (a-MeF) 22 -IA-(a-MeF) 25 L- but has poor solubility (a-MeV) 27 -KGR 30
- Aib offers some protection H-(Aib) 2 -EG-(S) 5 -(a- 42 1.02E-07 2.335E- 1.02E-07 to both Lys 28 and Arg 30 MeF) 6 -TSDV 10 SS-(a- 11
- FIGs. 2A-2C show the results of a neprilysin stability study on the standard GLP-
- FIGs. 3A-3D show the results of a neprilysin stability study on the synthetic GLP-
- GLP-1 comparator peptide SEQ ID NO:4, was added after 240 hours. As shown in FIG. 4A, the GLP-1 synthetic peptide of SEQ ID NO: 38 was still stable after 10 days. (See Box 1 in FIGS. 4A-4D.) In FIGS. 4B-4D, addition of the comparator peptide quickly began to degrade after only 1 hour (see Box 2), with significant degradation occurring by 24 hours (see Box 3).
- FIGs. 5A-5C show the results of a chymotrypsin stability study on the standard
- GLP-1 comparator SEQ ID NO:4. Arrows show the position of the original peak, and the degradation at 45 minutes and 2 hours after incubation with the protease. As shown, rapid degradation occurred at the carboxyl-terminus of all hydrophobic residues, with the peptide being completely degraded by 45 minutes.
- FIGs. 6A-6C show the results of a chymotrypsin stability study on the synthetic
- GLP-1 peptide SEQ ID NO: 38.
- the synthetic GLP-1 peptide showed degradation occurring by 48 hours, with cleavage observed solely at the Leu26/Val27.
- FIGs. 7A-7C show the results of a chymotrypsin stability study on the synthetic
- GLP-1 peptide H-(Aib) 2 -EG-(S) 5 -(a-MeF) 6 -TSDV 10 SS-(a-MeF) 13 -LE 15 GQAA-(a- MeK) 20 E-(a-MeF) 22 -IA-(a-MeF) 25 -(V) 26 -V-(a-MeK) 28 -G-(G)30, SEQ ID NO: 51.
- substitution of leucine 26 to valine resulted in the synthetic GLP-1 peptide demonstrating stability for over 60 hours, with no major cleavage products observed.
- FIGs. 8A-8C show the results of a trypsin stability study on the standard GLP-1 comparator, SEQ ID NO:4. Rapid proteolytic degradation occurred at the carboxyl side of Lys 20 , Lys 28 and Arg 30 , by 90 minutes.
- FIGs. 9A-9C show the results of a trypsin stability study on the synthetic GLP-1 peptide, SEQ ID NO: 38. As demonstrated, the synthetic GLP-1 peptide showed degradation occurring by 90 minutes at the carboxyl-side of Lys 20 , Lys 28 and Arg 30.
- FIGs. lOA-lOC show the results of a trypsin stability study on the synthetic GLP-
- FIGs. 11A-11B show the results of a serum stability study on the standard GLP-1 comparator, SEQ ID NO:4. Rapid proteolytic degradation occurred after 60 hours, resulting in a trace of intact peptide, with significant autolysis of serum proteases creating peptide fragments that occlude the spectrum.
- FIGs. 12A-12B show the results of a serum stability study on the synthetic GLP-1 peptide, SEQ ID NO: 38. After 60 hours, approximately 64% of the peptide remains intact, with autolysis of serum proteases creating peptide fragments that occlude the spectrum.
- FIGs. 13A-13D show the results of a gastric fluid stability study on a lipidated comparator GLP-1 peptide, H-(Aib) 2 -EGT 5 FTSDV 10 SSYLE 15 GQAAK 20 EFIAW 25 LVKGR 30 -(K-Palm), SEQ ID NO: 5, and a lipidated, protease protected GLP-1 peptide, H-(Aib) 2 -EG-(S) 5 -(a-MeF) 6 -TSDV 10 SS-(a-MeF) 13 -LE 15 GQAA-(a-MeK) 20 E-(a-MeF) 22 - IA-(a-MeF) 25 -(V) 26 -V-(a-MeK) 28 -G-(G) 30 -K(palm), SEQ ID NO: 52.
- the stability of the lipidated, protease protected GLP-1 protein significantly exceeds that of that lipidated comparator
- FIGs. 14A-14E show the results of a gastric fluid stability study on a commercially available GLP-1 agonist (Liraglutide, Novo Nordisk) as compared to the lipidated, protease-resistant SEQ ID NO: 52.
- the stability of the lipidated, protease- resistant GLP-1 peptide significantly exceeds that of Liraglutide.
- the significant difference in stability is demonstrated even further in FIGs. 15A-15E, showing zoomed spectra, indicating the virtually unchanged spectrum for the protected GLP-1 peptide, SEQ ID NO: 52, over the time course.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- General Health & Medical Sciences (AREA)
- Zoology (AREA)
- Medicinal Chemistry (AREA)
- Molecular Biology (AREA)
- Genetics & Genomics (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Endocrinology (AREA)
- Engineering & Computer Science (AREA)
- Gastroenterology & Hepatology (AREA)
- Diabetes (AREA)
- Toxicology (AREA)
- Wood Science & Technology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Analytical Chemistry (AREA)
- Immunology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Physics & Mathematics (AREA)
- General Engineering & Computer Science (AREA)
- Biotechnology (AREA)
- Microbiology (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Epidemiology (AREA)
- Obesity (AREA)
- Hematology (AREA)
- Emergency Medicine (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Nutrition Science (AREA)
- Physiology (AREA)
- Peptides Or Proteins (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Priority Applications (10)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| KR1020167018887A KR20160098406A (ko) | 2013-12-13 | 2014-12-10 | 프로테아제 내성 펩티드 |
| EP18182275.0A EP3415526A1 (en) | 2013-12-13 | 2014-12-10 | Protease resistant peptides |
| MX2016007407A MX2016007407A (es) | 2013-12-13 | 2014-12-10 | Peptidos resistentes a proteasa. |
| US15/103,607 US20160318987A1 (en) | 2013-12-13 | 2014-12-10 | Protease resistant peptides |
| JP2016538037A JP2017502003A (ja) | 2013-12-13 | 2014-12-10 | プロテアーゼ耐性ペプチド |
| CN201480067307.1A CN105849123A (zh) | 2013-12-13 | 2014-12-10 | 蛋白酶抗性肽 |
| CA2933405A CA2933405A1 (en) | 2013-12-13 | 2014-12-10 | Protease-resistant peptides |
| EP14809857.7A EP3080153A2 (en) | 2013-12-13 | 2014-12-10 | Protease resistant peptides |
| BR112016013157A BR112016013157A2 (pt) | 2013-12-13 | 2014-12-10 | peptídeos resistentes à protease |
| AU2014363547A AU2014363547A1 (en) | 2013-12-13 | 2014-12-10 | Protease resistant peptides |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201361915662P | 2013-12-13 | 2013-12-13 | |
| US61/915,662 | 2013-12-13 |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2015086686A2 true WO2015086686A2 (en) | 2015-06-18 |
| WO2015086686A3 WO2015086686A3 (en) | 2015-10-29 |
Family
ID=52021207
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/EP2014/077240 Ceased WO2015086686A2 (en) | 2013-12-13 | 2014-12-10 | Protease resistant peptides |
Country Status (11)
| Country | Link |
|---|---|
| US (1) | US20160318987A1 (https=) |
| EP (2) | EP3415526A1 (https=) |
| JP (1) | JP2017502003A (https=) |
| KR (1) | KR20160098406A (https=) |
| CN (1) | CN105849123A (https=) |
| AU (1) | AU2014363547A1 (https=) |
| BR (1) | BR112016013157A2 (https=) |
| CA (1) | CA2933405A1 (https=) |
| MX (1) | MX2016007407A (https=) |
| SG (1) | SG10201805039UA (https=) |
| WO (1) | WO2015086686A2 (https=) |
Cited By (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2016198544A1 (en) | 2015-06-10 | 2016-12-15 | Medimmune Limited | Protease-resistant lipidated glp-1 analogs |
| WO2017075505A2 (en) | 2015-10-28 | 2017-05-04 | Tufts University | Novel polypeptides with improved proteolytic stability, and methods of preparing and using same |
| WO2017211922A2 (en) | 2016-06-09 | 2017-12-14 | Medimmune Limited | Protease-resistant mono-lipidated peptides |
| US10278957B2 (en) | 2017-09-11 | 2019-05-07 | Protagonist Therapeutics, Inc. | Opioid agonist peptides and uses thereof |
| WO2019193576A1 (en) | 2018-04-05 | 2019-10-10 | Sun Pharmaceutical Industries Limited | Novel glp-1 analogues |
Families Citing this family (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| JP7736315B2 (ja) * | 2020-03-31 | 2025-09-09 | アンタロス メディカル アクティエボラーグ | イメージング及び治療目的のキレート部分を含む選択的gip受容体アゴニスト |
| US20240067693A1 (en) * | 2020-12-16 | 2024-02-29 | Medimmune Limited | Polypeptides and uses thereof |
| TW202346323A (zh) * | 2022-02-07 | 2023-12-01 | 英商梅迪繆思有限公司 | 具有改善的生物穩定性的glp—1及升糖素雙重激動肽 |
| CN121248731A (zh) * | 2025-09-18 | 2026-01-02 | 内蒙古博睿精创科技有限公司 | 一种长效降糖减重的多靶点多肽化合物及其制备方法和应用 |
Family Cites Families (10)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| DE69922043T2 (de) * | 1998-12-07 | 2005-11-24 | Société de Conseils de Recherches et d'Applications Scientifiques S.A.S. | Glp-1 analoge |
| CN101379075B (zh) * | 2006-02-08 | 2013-05-15 | 隆萨股份公司 | 类胰高血糖素肽的合成 |
| US20100022457A1 (en) * | 2006-05-26 | 2010-01-28 | Bristol-Myers Squibb Company | Sustained release glp-1 receptor modulators |
| US20090318353A1 (en) * | 2006-08-25 | 2009-12-24 | Novo Nordisk A/S | Acylated Exendin-4 Compounds |
| WO2009125424A2 (en) * | 2007-12-11 | 2009-10-15 | Cadila Healthcare Limited | Peptidomimetics with glucagon antagonistic and glp-1 agonistic activities |
| DE602009000324D1 (de) * | 2008-04-18 | 2010-12-23 | Hoffmann La Roche | Alpha-N-Methylierung von Aminosäuren |
| WO2011048614A2 (en) * | 2009-10-22 | 2011-04-28 | Cadila Healthcare Limited | Short chain peptidomimetics based orally active glp-1 agonist and glucagon receptor antagonist |
| US20130143800A1 (en) * | 2011-11-07 | 2013-06-06 | Research Development Foundation | Combination therapies to treat diabetes |
| AR092873A1 (es) * | 2012-09-26 | 2015-05-06 | Cadila Healthcare Ltd | Peptidos como agonistas triples de los receptores de gip, glp-1 y glugagon |
| EP2928562A4 (en) * | 2012-12-06 | 2016-06-22 | Stealth Peptides Int Inc | PEPTIDE THERAPEUTIC PRODUCTS AND METHODS OF USE |
-
2014
- 2014-12-10 SG SG10201805039UA patent/SG10201805039UA/en unknown
- 2014-12-10 WO PCT/EP2014/077240 patent/WO2015086686A2/en not_active Ceased
- 2014-12-10 JP JP2016538037A patent/JP2017502003A/ja active Pending
- 2014-12-10 CN CN201480067307.1A patent/CN105849123A/zh active Pending
- 2014-12-10 CA CA2933405A patent/CA2933405A1/en not_active Abandoned
- 2014-12-10 US US15/103,607 patent/US20160318987A1/en not_active Abandoned
- 2014-12-10 AU AU2014363547A patent/AU2014363547A1/en not_active Abandoned
- 2014-12-10 BR BR112016013157A patent/BR112016013157A2/pt not_active Application Discontinuation
- 2014-12-10 KR KR1020167018887A patent/KR20160098406A/ko not_active Withdrawn
- 2014-12-10 EP EP18182275.0A patent/EP3415526A1/en not_active Withdrawn
- 2014-12-10 EP EP14809857.7A patent/EP3080153A2/en not_active Withdrawn
- 2014-12-10 MX MX2016007407A patent/MX2016007407A/es unknown
Cited By (19)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US10414811B2 (en) | 2015-06-10 | 2019-09-17 | Medimmune Limited | Protease-resistant lipidated GLP-1 analogs |
| EP3865504A1 (en) | 2015-06-10 | 2021-08-18 | MedImmune Limited | Protease-resistant lipidated glp-1 analogs |
| WO2016198544A1 (en) | 2015-06-10 | 2016-12-15 | Medimmune Limited | Protease-resistant lipidated glp-1 analogs |
| AU2016343775B2 (en) * | 2015-10-28 | 2021-07-29 | Tufts Medical Center | Novel polypeptides with improved proteolytic stability, and methods of preparing and using same |
| WO2017075505A2 (en) | 2015-10-28 | 2017-05-04 | Tufts University | Novel polypeptides with improved proteolytic stability, and methods of preparing and using same |
| AU2021258060B2 (en) * | 2015-10-28 | 2024-03-28 | Tufts Medical Center | Novel polypeptides with improved proteolytic stability, and methods of preparing and using same |
| EP3368556A4 (en) * | 2015-10-28 | 2019-12-18 | Tufts University | INNOVATIVE POLYPEPTIDES WITH IMPROVED PROTEOLYTIC STABILITY AND METHOD FOR THE PRODUCTION AND USE THEREOF |
| WO2017211922A2 (en) | 2016-06-09 | 2017-12-14 | Medimmune Limited | Protease-resistant mono-lipidated peptides |
| WO2017211922A3 (en) * | 2016-06-09 | 2018-01-18 | Medimmune Limited | Protease-resistant mono-lipidated peptides |
| US10729676B2 (en) | 2017-09-11 | 2020-08-04 | Protagonist Theraputics, Inc. | Opioid agonist peptides and uses thereof |
| US10278957B2 (en) | 2017-09-11 | 2019-05-07 | Protagonist Therapeutics, Inc. | Opioid agonist peptides and uses thereof |
| WO2019193576A1 (en) | 2018-04-05 | 2019-10-10 | Sun Pharmaceutical Industries Limited | Novel glp-1 analogues |
| US11242373B2 (en) | 2018-04-05 | 2022-02-08 | Sun Pharmaceutical Industries Limited | GLP-1 analogues |
| US11447535B2 (en) | 2018-04-05 | 2022-09-20 | Sun Pharmaceutical Industries Limited | GLP-1 analogues |
| EP4122954A1 (en) | 2018-04-05 | 2023-01-25 | Sun Pharmaceutical Industries Limited | Novel glp-1 analogues |
| US11866477B2 (en) | 2018-04-05 | 2024-01-09 | Sun Pharmaceutical Industries Limited | GLP-1 analogues |
| US11873328B2 (en) | 2018-04-05 | 2024-01-16 | Sun Pharmaceutical Industries Limited | GLP-1 analogues |
| EP4364751A2 (en) | 2018-04-05 | 2024-05-08 | Sun Pharmaceutical Industries Limited | Novel glp-1 analogues |
| US12421289B2 (en) | 2018-04-05 | 2025-09-23 | Sun Pharmaceutical Industries Limited | GLP-1 analogues |
Also Published As
| Publication number | Publication date |
|---|---|
| EP3080153A2 (en) | 2016-10-19 |
| EP3415526A1 (en) | 2018-12-19 |
| CA2933405A1 (en) | 2015-06-18 |
| JP2017502003A (ja) | 2017-01-19 |
| KR20160098406A (ko) | 2016-08-18 |
| BR112016013157A2 (pt) | 2017-09-26 |
| CN105849123A (zh) | 2016-08-10 |
| US20160318987A1 (en) | 2016-11-03 |
| MX2016007407A (es) | 2016-12-12 |
| AU2014363547A1 (en) | 2016-06-30 |
| SG10201805039UA (en) | 2018-07-30 |
| WO2015086686A3 (en) | 2015-10-29 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| EP3415526A1 (en) | Protease resistant peptides | |
| US20210221866A1 (en) | Protease-resistant lipidated glp-1 analogs | |
| JP2016183177A (ja) | 代謝疾患及び肥満の治療のためのグルカゴンアンタゴニスト‐gipアゴニスト複合体及び組成物 | |
| CA3025592A1 (en) | Protease-resistant mono-lipidated peptides | |
| US20250353891A1 (en) | Glp-1 and glucagon dual agonist peptides with improved biological stability | |
| HK1260766A1 (en) | Protease resistant peptides | |
| HK1249120B (en) | Protease-resistant lipidated glp-1 analogs |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 14809857 Country of ref document: EP Kind code of ref document: A2 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: MX/A/2016/007407 Country of ref document: MX |
|
| ENP | Entry into the national phase |
Ref document number: 2016538037 Country of ref document: JP Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2933405 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 15103607 Country of ref document: US |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112016013157 Country of ref document: BR |
|
| REEP | Request for entry into the european phase |
Ref document number: 2014809857 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2014809857 Country of ref document: EP |
|
| ENP | Entry into the national phase |
Ref document number: 2014363547 Country of ref document: AU Date of ref document: 20141210 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 20167018887 Country of ref document: KR Kind code of ref document: A Ref document number: 2016128046 Country of ref document: RU Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 112016013157 Country of ref document: BR Kind code of ref document: A2 Effective date: 20160608 |