WO2014095804A1 - In-vitro verfahren und kit zur diagnose von akutem koronarsyndrom - Google Patents
In-vitro verfahren und kit zur diagnose von akutem koronarsyndrom Download PDFInfo
- Publication number
- WO2014095804A1 WO2014095804A1 PCT/EP2013/076824 EP2013076824W WO2014095804A1 WO 2014095804 A1 WO2014095804 A1 WO 2014095804A1 EP 2013076824 W EP2013076824 W EP 2013076824W WO 2014095804 A1 WO2014095804 A1 WO 2014095804A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- troponin
- epitope
- protein
- enzyme
- antibody
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
- G01N33/6893—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids related to diseases not provided for elsewhere
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/435—Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
- G01N2333/46—Assays involving biological materials from specific organisms or of a specific nature from animals; from humans from vertebrates
- G01N2333/47—Assays involving proteins of known structure or function as defined in the subgroups
- G01N2333/4701—Details
- G01N2333/4712—Muscle proteins, e.g. myosin, actin, protein
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2800/00—Detection or diagnosis of diseases
- G01N2800/32—Cardiovascular disorders
- G01N2800/324—Coronary artery diseases, e.g. angina pectoris, myocardial infarction
Definitions
- the invention relates to an in vitro method and a kit for the diagnosis of acute coronary syndrome as well as various uses of at least one enzyme-specifically cleaved non-epitope fragment of at least one cardiac troponin protein.
- cardiovascular diseases are of great medical importance. Life-threatening cardiovascular diseases are grouped under the term acute coronary syndrome. These include, for example, the myocardial infarction (heart attack).
- ischemic myocardial infarction part of the heart muscle infol ⁇ ge of ischemia die that lasts longer than 20 minutes.
- the ischemia is usually triggered by a blood clot in a coronary artery.
- the dying heart muscle cells release certain proteins that can be detected in the blood of the patient. These include cardiac troponin proteins.
- cardiac troponin proteins include cardiac troponin proteins.
- Troponin proteins have specific post-translational modes ⁇ fications.
- the 71 N-terminal amino acids of troponin T and the 17 C-terminal amino acids of troponin I are cleaved in the patient's serum.
- a change in the phosphorylation status of the serine residues 23/24 of troponin I is also known.
- immunoassays are commonly used to determine the concentration of troponin I and troponin T in the patient's blood circulation.
- the immunoassays are very sensitive, that is a patient with acute coronary syndrome is high Probability recognized as such.
- the problem is there ⁇ against the safe identification of patients with nonspecific clinical findings and nonspecific ECG changes that have no acute coronary syndrome despite acute chest pain. Since these patients also have elevated troponin levels in the blood, they are incorrectly diagnosed as patients with acute Koronarsyn ⁇ drom means of immunoassays.
- Such misdiagnosis that occur due to the low specificity of immunoassays for the diagnosis of acute tem coronary syndrome, ask in clinical practice is a problem. Without a proper diagnosis, many patients can not be treated optimally, so that their Hei ⁇ development opportunities decline.
- the invention is therefore based on the object to provide a method and a kit that made a specific diagnosis of acute coronary syndrome ⁇ light.
- the object is achieved by an in-vitro method comprising the Merkma ⁇ len according to claim 1 and a kit having the features according to claim. 8
- the invention in-vitro method for diagnosis of AKU ⁇ tem coronary syndrome comprising the steps of: providing a solid support with at least one antibody, a cardiac troponin protein from a sample is specifically bound to the minimum column of the troponin protein with a Enzyme in at least one bound to the antibody epitope fragment and at least one non-epitope fragment, reading the non-epitope fragment specifically cleaved by the enzyme, and diagnosing the acute coronary syndrome at ⁇ hand of the presence and / or absence of the enzyme-specific non Epitope fragments.
- acute coronary syndrome refers to a life-threatening cardiovascular disease, for example one
- a solid carrier is provided with at least one antibody to which at least one cardiac troponin protein from a sample is specifically bound.
- the antibody is immobilized on the support and specifically binds to one or more kar ⁇ Diale troponin proteins.
- cardiac troponin protein refers to a
- Troponin protein that is released when damage to the heart occurs in the blood.
- the cardiac troponin proteins include troponin I, troponin T and troponin C, with cardiac troponin I and cardiac troponin T specifically expressed in the heart muscle.
- the term "troponin protein” includes all isoforms of the troponin protein, that is so-well unmodified and post-translationally modifi ⁇ ed forms of troponin protein.
- post-translational modification means any Modifikati ⁇ on a protein, which takes place after its translation at the ribosomes instead of post-translational modifications are examples of playing the phosphorylation and / or oxidation of.
- the binding of the antibody to the cardiac troponin protein is based on a specific non-covalent interaction of the antibody with certain amino acid portions of the troponin protein, the so-called epitopes.
- epitopes refers to a short amino acid portion of a protein of about 5 to about 20 amino acids that acts as a specific binding site for an antibody.
- sample refers to a sample of, for example, blood or serum of a patient which is preferably suspected to have acute coronary syndrome.
- the troponin protein is mixed with an enzyme into at least one epitope fragment bound to the antibody and at least one non-epitope fragment. columns.
- an enzyme By binding to the antibody, any cleavage sites of the enzyme that are within the epitopes are inaccessible and protected from enzymatic cleavage.
- the troponin protein is therefore only on the
- epitope fragment refers to a fragment of troponin protein having at least one epitope of troponin protein to which the anti ⁇ body is attached. Therefore, the epitope fragment of troponin protein remains in the enzymatic cleavage of the
- non-epitope fragment refers to a fragment of troponin protein which has no binding site for the antibody on ⁇ and is thereby dissolved in the cleavage of troponin protein with an enzyme from the carrier.
- the number of epitope fragments depends on the used anti ⁇ body. For example, if the antibody binds only one epitope of the troponin protein, cleavage by the enzyme may leave a single epitope fragment on the carrier.
- the antibody can also be two or more epitopes of the
- Bind troponin protein so that by the enzymatic cleavage of the troponin protein two or more than two
- the enzyme cleaves the troponin protein in about 10 to about
- the non-epitope fragment which is specifically cleaved by the enzyme is read out in a next step.
- the term "read” refers to any type of characterization of the non-epitope fragment.
- the non-epitope fragment can, for example, by the Bestim ⁇ mung its length, its mass and / or its
- Amino acid sequence can be characterized.
- common methods of peptide analysis can be used.
- chromatographic techniques such as reverse phase high performance liquid chromatography (RP-HPLC) can be used to determine the hydrophobicity of the non-epitope fragment and / or Edman degradation to identify the
- the reading out of the non-epitope fragment advantageously takes place by means of mass spectrometry.
- the inventive method further comprises the Diagnosti ⁇ decorate of acute coronary syndrome by the presence and / or absence of the enzyme-specific non-epitope fragment. Due to the post-translational modification of the troponin protein in the blood circulation, which occurs specifically in myocardial ischemia, certain non-epitope fragments arise only in the presence of the forms of the troponin protein, which are caused by non-coronary syndromes, or only in the presence of acute coronary syndrome. The non-epitope fragments thus have a krankheitsspezifi ⁇ ULTRASONIC pattern, which is acute coronary syndrome di ⁇ can be agnosti worth.
- the non-epitope fragment that results from cleavage of the enzyme at that interface will only be in the troponin forms Protein, which are caused by non-coronary syndromes, while lacking in the presence of the acute coronary syndrome.
- the post-translational cleavage of certain amino acid sections of the troponin proteins in acute coronary syndrome further leads to the fact that cleavage at a particular interface causes Epitope fragments arise whose length differs between the non-coronary syndrome and the coronary syndrome-modified form of the troponin protein. Based on the reading of such non-epitope fragments acute coronary syndrome may also diagnosed ⁇ to.
- the method according to the invention is very specific, so that patients with acute coronary syndrome can be distinguished from patients with other causes for increased troponin levels in the blood. This allows a specific diagnosis of acute coronary syndrome and thus the safe identification of affected patients. By ensuring that individuals who are not suffering from acute coronary syndrome despite elevated levels of troponin in the blood are also identified as such, misdiagnosis and associated mistreatment of these patients is avoided.
- the solid support is a chromatography column, for example a Sepharose column.
- step b) is at a temperature of from about 40 ° C to about 55 ° C, preferably from about 50 ° C to about 53 ° C, and / or for about 2 minutes to about 10 minutes, preferably about 3 minutes to about 5 minutes.
- the columns of the troponin protein with a En ⁇ zyme can be carried out particularly quickly, for example by the fact that micro-columns are used, on which the enzyme is distributed on a large surface. Surprisingly, it was found that the troponin protein can be cleaved particularly efficiently when it ⁇ creased temperature by an enzyme.
- An elevated temperature means that the temperature is higher than about 37 ° C.
- cleavage of the troponin protein may be at about 40 ° C or at about 53 ° C.
- the temperature is preferably chosen depending on the thermostability and the activity of the enzyme used. Due to the elevated temperature, the enzymatic cleavage of the troponin protein and thus also the process accelerated overall.
- the columns of the troponin protein ⁇ it is preferably followed in about 3 minutes, about 5 minutes or ⁇ et wa 8 minutes. Due to the cleavage of the troponin protein in only about 2 minutes to about 10 minutes, the method according to the invention is particularly suitable for use in a clinical environment, since it allows a rapid and specific diagnosis of acute coronary syndrome. Thus, vital therapeutic measures can be initiated early, where ⁇ improve the chances of recovery of patients.
- the epitope fragment is quantified after step b).
- the epitope fragment can be released from the antibody for quantitation by, for example, treating the carrier with trifluoroacetic acid.
- the quantification of the epitope fragment the Kon ⁇ concentration of all forms of the troponin protein is determined in the sample.
- This concentration of troponin is a valuable clinical parameter, which, in addition to diagnostic purposes, is also important for the assessment of the risk with which the disease progresses or leads to further complications.
- troponin concentration is related to the size of myocardial infarction and survival after infarction.
- quantification of the epitope fragment can contribute to the diagnosis of acute coronary syndrome.
- the quantification of the epitope fragment can be carried out by conventional methods of the
- the troponin protein is troponin I and / or troponin T.
- Troponin I and troponin T are specific markers in the blood or serum of patients with a myocardial injury. Both troponin proteins have specific posttranslational modifications that occur in myocardial infarction. Therefore, troponin I and / or troponin T are particularly suitable for use in the method of the invention.
- the readout of the non-epitope fragment which is specifically cleaved by the enzyme takes place by means of mass spectrometry.
- Mass spectrometry is a highly sensitive method for characterizing proteins and peptides, which can be used to determine the mass of each non-epitope fragment. If the interfaces of the enzyme used in the troponin protein are known, the mass can be assigned to the enzyme-specific non-epitope fragment. In addition, the mass of the non-epitope fragment allows an inference to its amino acid sequence. Thereby, the presence and / or absence of enzyme-specific non-epitope fragments can be determined with high accuracy. The readout of the non-epitope fragments can be carried out, for example, with MALDI-MS (matrix-assisted laser desorption / ionization
- Mass spectrometry and / or ESI-MS (electron spray ionization mass spectrometry) are performed.
- the steps a) to c) of the method according to the invention are carried out by means of affinity mass spectrometry.
- Mass spectrometry combined to read the enzyme-specifically cleaved non-epitope fragment.
- the affinity mass spectrometry is easy to standardize and enables an efficient implementation of the erfindungsge ⁇ MAESSEN method.
- the non-epitope fragment specifically cleaved by the enzyme is quantified after step b).
- the quantification of the non-epitope fragment gives the concentration of the respective post-translationally-modified mo ⁇ form of the troponin protein in the sample.
- the quantification can be done, for example, by means of
- Mass spectrometry are performed. From the concentra ⁇ on the single modified troponin forms information about disease progression and / or severity of acute coronary syndrome can be derived. Thus, the Quantification of the non-epitope fragment is a valuable clinical parameter for fine diagnosis of acute coronary syndrome. In a particularly preferred embodiment, the quantification of the non-epitope fragment is done using the same method that will read the non-epitope fragment. Thereby, the non-epitope fragment can be identified on ef ⁇ -efficient and cost-effective manner and quantified.
- the antibody is a monoclonal antibody.
- polyclonal antibodies due to their production, represent a mixture of antibodies which bind to different epitopes of the troponin protein
- a monoclonal antibody optimally recognizes a specific epitope of the troponin protein.
- the monoklona ⁇ le antibody is advantageously chosen so that it does not bind to amino acid portions of the troponin protein may occur in de- NEN posttranslational modifications. This ensures that all isoforms of the troponin protein bind to the antibody, especially
- a first and a second antibody having different specificities are used.
- two different cardiac troponin proteins from the sample are bound to the carrier, which together are used in a single procedure to diagnose acute coronary syndrome. This increases the specificity of the diagnosis.
- the first antibody specifically binds troponin I and the second antibody specifically binds troponin T. This binds both troponin I and troponin T proteins to the carrier.
- Troponin proteins show in the presence of acute coronary syn- ischemic-related posttranslational modifications. Reading out the non-epitope fragments of both
- Troponin T as well as Troponin I therefore makes it possible to diagnose the acute coronary syndrome with a high specificity.
- patterns used in reading multiple non-epitope fragments from at least two different troponin proteins such as
- Troponin I and troponin T are assigned to an underlying disease.
- the troponin fingerprint for the assignment of the underlying disease with the concentration of the individual modified troponin forms is combined, which is ge ⁇ gained by quantifying the non-epitope fragments.
- troponin pattern or -Fingerprints the diagnosis of acute coronary syndrome to the identifi cation ⁇ the actual underlying condition is extended.
- the specificity of the diagnosis is increased and simplifies hard ⁇ position to an appropriate treatment strategy.
- the enzyme is a
- protease is selected to be the
- a protease is advantageously used, the interface of the ⁇ le or interfaces are known in the troponin protein, such as trypsin or chymotrypsin. This facilitates subsequent readout of the non-epitope fragment specifically cleaved by the enzyme. Trypsin at ⁇ play cleaves proteins after the amino acids lysine and arginine.
- the enzyme may cleave any troponin protein bound to the carrier at any accessible, that is not through the antibody binding. protected, interface splits. However, most enzymes do not cleave every troponin protein at every possible interface. Rather, it happens that in some of the proteins the enzyme omits single or multiple accessible interfaces. The extent of this omission of
- Interfaces mainly depend on the enzyme activity and can be influenced by the conditions of the troponin cleavage such as duration, pH and / or temperature.
- the enzyme omits one or more interfaces in a part of the troponin proteins to occur ⁇ addition to those fragments which proteins are formed on two adjacent interfaces by cleavage of troponin, also longer epitope and non-epitope fragments.
- the more interfaces the enzyme omits the larger the number of possible non-epitope fragments.
- the complexity of the readout step increases.
- the detection of certain non-epitope fragments can be complicated by a high number of non-epitope fragments.
- Troponin cleavage is therefore preferably chosen so that the enzyme omits at most two consecutive cleavage sites. Thereby, the non-epitope fragments can be efficiently read out, and the presence and / or absence of non-epitope fragments can be easily detected.
- the enzyme is chymotrypsin.
- Chymotrypsin cleaves proteins according to the amino acids tyrosine, tryptophan, phenylalanine, leucine and methionine.
- chymotrypsin arise more non-epitope fragments that are not caused only by the coronary not or otherwise modified form of the troponin protein vorlie ⁇ gene and thus lacking in acute coronary syndrome.
- non-epitope fragments are generated which only occur in ischemic post-translationally modified troponin isoforms.
- Another object of the invention relates to a kit for the diagnosis of acute coronary syndrome
- a kit for the diagnosis of acute coronary syndrome comprising a solid support with at least a first antibody and at least one second antibody, wherein the antibodies each specifically bind different cardiac troponin proteins. So ⁇ two different cardiac troponin proteins are bound to the carrier, which are used together for the diagnosis of acute coronary syndrome. This achieves a high specificity of the diagnosis.
- the first antibody specifically binds troponin I
- the second antibody specifically binds troponin T.
- Another object of the invention is the use of at least one enzyme-specifically cleaved non-epitope fragment of at least one cardiac troponin protein for diagnosis of acute coronary syndrome.
- the non-epitope fragment is advantageously selected to be a non-epitope fragment that results only upon enzymatic cleavage of an ischemic post-translationally modified form of the troponin protein.
- Acute coronary syndrome is ti appraise diagnos ⁇ by the presence of this non-epitope fragment.
- Another object of the invention relates to a use of at least one enzyme-specifically cleaved non-epitope fragment of at least one cardiac
- Troponin protein for the detection of at least one
- the post-translational modification of the troponin protein is a cleavage of N-terminal or C-terminal amino acid segments, as they are occur in troponin proteins in the blood of myocardial infarction patients.
- the non-epitope fragment can be used, but also for the identification and characterization not only ⁇ After setting a known post-translational modification of the protein troponin are used by new post-translational modifications of the troponin protein.
- Figure 1 shows a solid support 1, the one of
- Sepharose column is formed, and are immobilized on the surface ⁇ mono clonal antibodies.
- a sample 4 is contacted with the Sepharose column.
- the sample 4 is the serum of a patient with suspected acute coronary syndrome ⁇ and contains besides the ordinary serum proteins cardiac troponin proteins 3.
- Antibody 2 on the column bind specifically cardiac troponin I.
- the cardiac troponin contained in the serum bind with proteins I- contact with the column to the antibodies 2.
- the column is subsequently ⁇ ped with phosphate buffered saline (PBS), to 5 to remove unbound proteins from the column.
- PBS phosphate buffered saline
- the column is contacted with chymotrypsin. Chymotrypsin cleavage is allowed for 5 minutes
- Cysteine and methionine are present in reduced form and in the troponin cleavage at most two interfaces are omitted from the enzyme.
- the masses of non-epitope fragments are given in [M + H] + .
- the masses of the non-epitope fragments are ⁇ leads, which arise in the presence of the unmodified form of the respective troponin protein.
- the masses of non-epitope fragments are set out in the second column of the tables, which are detected when there is a post-translationally modifi ed ⁇ shape of each troponin protein and in the presence of acute coronary syndrome.
- the amino acid sequences of the non-epitope fragments are given, which arise either only in the unmodified form or only in the modified form of the troponin protein.
- Interfaces refer to the position of the amino acids in the unmodified form of the particular troponin protein, starting from the N-terminal end of the protein.
- troponin I In ischemia, a C-terminally modified form of troponin I occurs, which is shortened by 17 amino acids at the C-terminal end.
- the antibodies of the anti-troponin (Los Angeles, CA, USA 2nd generation assay, Siemens Diagnostic Products Corporation) was I anti ⁇ body from the Siemens IMMULITE 2500 cTnI kit used. The binding site of the antibody is located in the section from amino acid 24 to 40 of the troponin I protein. This epitope of the troponin I protein is protected from cleavage by chymotrypsin and / or trypsin by binding to the antibody. From preparatory work it is known that the N-terminal methionine of troponin I in the
- Mass spectrometric analysis is not detected.
- the amino acid sequence of the C-terminal posttranslational modi fied ⁇ form of troponin I is SEQ ID NO: 2.
- the chymotrypsin-specific cleavage after amino acid 190 results in the modified form of troponin I, a non-epitope fragment of two amino acids RK with the mass 303.2139 [M + H] + .
- the unmodified form arises with simultaneous cleavage after amino acid 197, which in the a non-epitope fragment of seven amino acids having the sequence RKNIDAL (SEQ ID NO: 13) and a mass of 829.4890 [M + H] + .
- ent ⁇ stands in the modified form of troponin I a non-epitope fragment of the sequence KQVKKEDTEKENREVGDWRK (SEQ ID NO: 7) with the mass 2,502.3059 [M + H] + .
- EVGDWRKNIDALSGMEGR (SEQ ID NO: 14) (2.032, 9868 [M + H] + ).
- Cleavage by trypsin at cleavage sites located in the section of troponin I which is absent in the modified form results in further non-epitope fragments that arise only in the unmodified form of the protein.
- Beispie- le for such fragments are KKFES (SEQ ID NO: 20) (638.3508 [M + H] + ) and KFES (SEQ ID NO: 21) (510, 2558 [M + H] + ).
- troponin T an N-terminal posttranslational modi ⁇ fication is described, which occurs in myocardial ischemia.
- the modified form results from the cleavage of the N-terminal amino acids 1 to 71 of troponin T.
- the antibodies used were the M7 antibody and the M11.7 antibody (both Roche Diagnostics, Penzberg, Germany).
- the Bin ⁇ binding sites of the antibodies are at M7 antibodies in the portion from amino acid 125-131 and in M11.7 antibodies in the stretch of amino acid 136-147 of the troponin T protein. These epitopes of the troponin T protein are protected from cleavage by trypsin by their binding to the antibodies.
- the amino acid sequence of the in ⁇ terminally posttranslational modified form of troponin T is shown under SEQ ID NO: 23.
- the chymotrypsin-specific cleavage after amino acid 74 results in the modified form of troponin T, a short non-epitope fragment of three amino acids of the sequence PNL with the mass 343.1976 [M + H] + . And the mass 474.2381 [M + H] +: In the unmodified form of the troponin T-protein, a longer non-epitopic fragment having the sequence MPNL (38 SEQ ID NO), however, arises in gleichzei ⁇ tiger cleavage after amino acid 70 , If there is no cleavage by chymotrypsin after amino acid 74, but after amino acid 87, then arises the modified form of troponin T the non-epitope fragment of the sequence PNLVPPKI PDGERVDF (SEQ ID NO: 33)
Landscapes
- Life Sciences & Earth Sciences (AREA)
- Health & Medical Sciences (AREA)
- Engineering & Computer Science (AREA)
- Molecular Biology (AREA)
- Chemical & Material Sciences (AREA)
- Biomedical Technology (AREA)
- Urology & Nephrology (AREA)
- Hematology (AREA)
- Immunology (AREA)
- Biotechnology (AREA)
- Microbiology (AREA)
- Cell Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Food Science & Technology (AREA)
- Medicinal Chemistry (AREA)
- Physics & Mathematics (AREA)
- Analytical Chemistry (AREA)
- Biochemistry (AREA)
- General Health & Medical Sciences (AREA)
- General Physics & Mathematics (AREA)
- Pathology (AREA)
- Peptides Or Proteins (AREA)
Abstract
In-vitro Verfahren und Kit zur Diagnose von akutem Koronarsyndrom Es wird ein in-vitro Verfahren zur Diagnose von akutem Koronarsyndrom beschrieben. Das Verfahren umfasst Bereitstellen eines festen Trägers (1) mit mindestens einem Antikörper (2), an den mindestens ein kardiales Troponin-Protein (3) aus einer Probe (4) spezifisch gebunden ist, Spalten des TroponinProteins (3) mit einem Enzym in mindestens ein an den Antikörper (2) gebundenes Epitop-Fragment (6) und mindestens ein Nicht-Epitop-Fragment (7), Auslesen des durch das Enzym spezifisch gespaltenen Nicht-Epitop-Fragments (7), und das akute Koronarsyndrom wird anhand des Vorliegens und/oder Fehlens des enzymspezifischen Nicht-Epitop-Fragments (7) diagnostiziert. Ferner werden ein Kit zur Diagnose von akutem Koronarsyndrom und Verwendungen von mindestens einem durch ein Enzym spezifisch gespaltenen Nicht-Epitop-Fragment (7) mindestens eines kardialen Troponin-Proteins (3) beschrieben.
Description
Beschreibung
In-vitro Verfahren und Kit zur Diagnose von akutem Koronarsyndrom
Die Erfindung betrifft ein in-vitro Verfahren und ein Kit zur Diagnose von akutem Koronarsyndrom sowie verschiedene Verwendungen von mindestens einem durch ein Enzym spezifisch gespaltenen Nicht-Epitop-Fragment mindestens eines kardialen Troponin-Proteins .
Als eine der häufigsten Todesursachen in der westlichen Welt sind Herz-Kreislauf-Erkrankungen von großer medizinischer Bedeutung. Lebensbedrohliche Herz-Kreislauf-Erkrankungen werden unter dem Begriff akutes Koronarsyndrom zusammengefasst . Dazu zählt beispielsweise der Myokardinfarkt (Herzinfarkt) .
Bei einem Myokardinfarkt sterben Teile des Herzmuskels infol¬ ge von Ischämie ab, die länger als 20 Minuten anhält. Die Ischämie wird in der Regel durch ein Blutgerinnsel in einem Herzkranzgefäß ausgelöst. Die absterbenden Herzmuskelzellen setzen bestimmte Proteine frei, die im Blut der Patienten nachgewiesen werden können. Dazu gehören kardiale Troponin- Proteine. Die in der BlutZirkulation von ischämischen Myo- kardinfarktpatienten mit akutem Koronarsyndrom auftretenden
Troponin-Proteine weisen spezifische posttranslationale Modi¬ fikationen auf. Beispielsweise sind die 71 N-terminalen Aminosäuren von Troponin T und die 17 C-terminalen Aminosäuren von Troponin I im Serum der Patienten abgespalten. Als spezi- fische Modifikation von Troponin I im Serum von Myokardin- farktpatienten ist auch eine Veränderung des Phosphorylie- rungsstatus der Serinreste 23/24 von Troponin I bekannt.
Für die Diagnose von akutem Koronarsyndrom werden üblicher- weise Immunoassays verwendet, mit denen die Konzentration von Troponin I und Troponin T in der BlutZirkulation des Patienten bestimmt wird. Die Immunoassays sind sehr sensitiv, das heißt ein Patient mit akutem Koronarsyndrom wird mit hoher
Wahrscheinlichkeit als solcher erkannt. Problematisch ist da¬ gegen die sichere Identifizierung von Patienten mit unspezifischen klinischen Befunden und unspezifischen EKG- Veränderungen, die trotz akuter Brustschmerzen kein akutes Koronarsyndrom aufweisen. Da diese Patienten auch erhöhte Troponin-Werte im Blut aufweisen, werden sie mittels der Immunoassays fehlerhaft als Patienten mit akutem Koronarsyn¬ drom diagnostiziert. Solche Fehldiagnosen, die aufgrund der geringe Spezifität der Immunoassays für die Diagnose von aku- tem Koronarsyndrom auftreten, stellen in der klinischen Praxis ein Problem dar. Ohne eine korrekte Diagnose können viele Patienten nicht optimal behandelt werden, so dass deren Hei¬ lungschancen sinken. Der Erfindung liegt daher die Aufgabe zugrunde, ein Verfahren sowie ein Kit bereit zu stellen, das eine spezifische Diagnose von akutem Koronarsyndrom ermög¬ licht .
Die Aufgabe wird durch ein in-vitro Verfahren mit den Merkma¬ len gemäß Anspruch 1 und ein Kit mit den Merkmalen gemäß An- spruch 8 gelöst.
Das erfindungsgemäße in-vitro Verfahren zur Diagnose von aku¬ tem Koronarsyndrom umfasst die Schritte: Bereitstellen eines festen Trägers mit mindestens einem Antikörper, an den min- destens ein kardiales Troponin-Protein aus einer Probe spezifisch gebunden ist, Spalten des Troponin-Proteins mit einem Enzym in mindestens ein an den Antikörper gebundenes Epitop- Fragment und mindestens ein Nicht-Epitop-Fragment , Auslesen des durch das Enzym spezifisch gespaltenen Nicht-Epitop- Fragments, und Diagnostizieren des akuten Koronarsyndroms an¬ hand des Vorliegens und/oder Fehlens des enzymspezifischen Nicht-Epitop-Fragments .
Der Begriff „akutes Koronarsyndrom" bezeichnet eine lebensbe- drohliche Herz-Kreislauf-Erkrankung, beispielsweise einen
Myokardinfarkt, mit Symptomen, die länger als 20 Minuten an¬ halten .
Für das erfindungsgemäße Verfahren wird zunächst ein fester Träger mit mindestens einem Antikörper bereitgestellt, an den mindestens ein kardiales Troponin-Protein aus einer Probe spezifisch gebunden ist. Der Antikörper ist auf dem Träger immobilisiert und bindet spezifisch an ein oder mehrere kar¬ diale Troponin-Proteine .
Der Begriff „kardiales Troponin-Protein" bezeichnet ein
Troponin-Protein, das bei Auftreten einer Schädigung des Her- zens in das Blut freigesetzt wird. Zu den kardialen Troponin- Proteinen zählen Troponin I, Troponin T und Troponin C, wobei kardiales Troponin I und kardiales Troponin T speziell im Herzmuskel exprimiert werden. Der Begriff „Troponin-Protein" umfasst alle Isoformen des Troponin-Proteins , das heißt so- wohl nicht modifizierte als auch posttranslational modifi¬ zierten Formen des Troponin-Proteins. Der Begriff
„posttranslationale Modifikation" bezeichnet jede Modifikati¬ on eines Proteins, die nach seiner Translation am Ribosomen statt findet. Posttranslationale Modifikationen sind bei- spielsweise die Phosphorylierung und/oder Oxidation von
Aminosäureresten und/oder die Deletion von Aminosäuren oder Aminosäureabschnitten .
Die Bindung des Antikörpers an das kardiale Troponin-Protein beruht auf einer spezifischen nicht-kovalenten Wechselwirkung des Antikörpers mit bestimmten Aminosäureabschnitten des Troponin-Proteins, den sogenannten Epitopen. Der Begriff „Epitop" bezeichnet einen kurzen Aminosäureabschnitte eines Proteins von etwa 5 bis etwa 20 Aminosäuren, der als spezifi- sehe Bindungsstelle für einen Antikörper fungiert.
Der Begriff „Probe" bezeichnet eine Probe von beispielsweise Blut oder Serum eines Patienten, bei dem vorzugsweise ein Verdacht auf akutes Koronarsyndrom besteht.
Im erfindungsgemäßen Verfahren wird das Troponin-Protein mit einem Enzym in mindestens ein an den Antikörper gebundenes Epitop-Fragment und mindestens ein Nicht-Epitop-Fragment ge-
spalten. Durch die Bindung an den Antikörper sind etwaige Schnittstellen des Enzyms, die innerhalb der Epitope liegen, nicht zugänglich und werden vor der enzymatischen Spaltung geschützt. Das Troponin-Protein wird daher nur an den
Schnittstellen des Enzyms, die für eine enzymatische Spaltung zugänglich sind, gespalten. Der Begriff „Epitop-Fragment" bezeichnet ein Fragment des Troponin-Proteins , das mindestens ein Epitop des Troponin-Proteins aufweist, an das der Anti¬ körper gebunden ist. Das Epitop-Fragment des Troponin- Proteins bleibt daher bei der enzymatischen Spaltung des
Troponin-Proteins an den Träger gebunden. Der Begriff „Nicht- Epitop-Fragment" bezeichnet ein Fragment des Troponin- Proteins, das keine Bindungsstelle für den Antikörper auf¬ weist und dadurch bei der Spaltung des Troponin-Proteins mit einem Enzym von dem Träger gelöst wird.
Die Anzahl der Epitop-Fragmente hängt vom verwendeten Anti¬ körper ab. Wenn der Antikörper beispielsweise nur ein Epitop des Troponin-Proteins bindet, kann bei der Spaltung durch das Enzym ein einziges Epitop-Fragment am Träger verbleiben. Der Antikörper kann aber auch zwei oder mehr Epitope des
Troponin-Proteins binden, so dass durch die enzymatische Spaltung des Troponin-Proteins zwei oder mehr als zwei
Epitop-Fragmente entstehen.
Die Anzahl der Nicht-Epitop-Fragmente hängt von der
posttranslationalen Modifikation des Troponin-Proteins und von dem verwendeten Enzym ab. Wenn die Troponin-Isoform beispielsweise nur eine Schnittstelle für das Enzym aufweist, die außerhalb der Epitope liegt, dann entsteht bei der enzym¬ spezifischen Spaltung ein einziges Nicht-Epitop-Fragment. Die Anzahl der Nicht-Epitop-Fragmente hängt weiter davon ab, wie viele Schnittstellen des Enzyms durch die Bindung an den Antikörper geschützt sind. In einer bevorzugten Ausführungsform spaltet das Enzym das Troponin-Protein in etwa 10 bis etwa
100 Nicht-Epitop-Fragmente, beispielsweise in etwa 50 oder in etwa 75 Nicht-Epitop-Fragmente.
Im erfindungsgemäßen Verfahren wird in einem nächsten Schritt das durch das Enzym spezifisch gespaltene Nicht-Epitop- Fragment ausgelesen. Der Begriff „Auslesen" bezeichnet jede Art der Charakterisierung des Nicht-Epitop-Fragments. Das Nicht-Epitop-Fragment kann beispielsweise durch die Bestim¬ mung seiner Länge, seiner Masse und/oder seiner
Aminosäuresequenz charakterisiert werden. Für das Auslesen können gängige Verfahren der Peptidanalyse verwendet werden. Beispielsweise können chromatographische Verfahren wie Rever- se-Phase-Hochleistungsflüssigkeitschromatographie (RP-HPLC) zur Bestimmung der Hydrophobizität des Nicht-Epitop-Fragments und/oder Edman-Abbau zur Identifizierung der
Aminosäuresequenz des Nicht-Epitop-Fragments eingesetzt wer¬ den. Das Auslesen des Nicht-Epitop-Fragments erfolgt vorteil- haft mittels Massenspektrometrie .
Das erfindungsgemäße Verfahren umfasst weiter das Diagnosti¬ zieren des akuten Koronarsyndroms anhand des Vorliegens und/oder Fehlens des enzymspezifischen Nicht-Epitop- Fragments. Aufgrund der posttranslationalen Modifikation des Troponin-Proteins in der BlutZirkulation, die spezifisch bei myokardialer Ischämie auftritt, entstehen bestimmte Nicht- Epitop-Fragmente nur bei Vorliegen der Formen des Troponin- Proteins, welche durch Nicht-Koronarsyndrome hervorgerufen werden, bzw. nur bei Vorliegen von akutem Koronarsyndrom. Die Nicht-Epitop-Fragmente weisen somit ein krankheitsspezifi¬ sches Muster auf, anhand dessen das akute Koronarsyndrom di¬ agnostiziert werden kann. Liegt eine Schnittstelle des Enzyms zum Beispiel in einem Bereich eines Troponin-Protein, das bei akutem Koronarsyndrom von dem Protein abgespaltenen wird, so wird das Nicht-Epitop-Fragment, das durch Spalten des Enzyms an dieser Schnittstelle entsteht, nur bei den Formen des Troponin-Proteins auftreten, welche durch Nicht- Koronarsyndrome hervorgerufen werden, während es bei Vorlie- gen des akuten Koronarsyndroms fehlt. Die posttranslationale Abspaltung bestimmter Aminosäureabschnitte der Troponin- Proteine bei akutem Koronarsyndrom führt weiterhin dazu, dass bei der Spaltung an einer bestimmten Schnittstelle Nicht-
Epitop-Fragmente entstehen, deren Länge sich zwischen der nicht durch Koronarsyndrom hervorgerufenen und der durch Koronarsyndrom modifizierten Form des Troponin-Proteins unterscheidet. Anhand des Auslesen solcher Nicht-Epitop-Fragmente kann das akute Koronarsyndrom ebenfalls diagnostiziert wer¬ den .
Das erfindungsgemäße Verfahren ist sehr spezifisch, so dass Patienten mit akutem Koronarsyndrom von Patienten mit anderen Ursachen für erhöhte Troponin-Werte im Blut unterschieden werden können. Dies ermöglicht eine spezifische Diagnose von akutem Koronarsyndrom und somit die sichere Identifizierung von betroffenen Patienten. Indem das Verfahren sicher stellt, dass Personen, die trotz erhöhter Troponin-Werte im Blut nicht an akutem Koronarsyndrom erkrankt sind, auch als solche erkannt werden, werden Fehldiagnosen und damit verbundene Fehlbehandlungen dieser Patienten vermieden.
In einer bevorzugten Ausführungsform ist der feste Träger ei- ne Chromatographiesäule, beispielsweise eine Sepharosesäule .
In einer bevorzugten Ausführungsform wird Schritt b) bei einer Temperatur von etwa 40°C bis etwa 55°C, vorzugsweise von etwa 50°C bis etwa 53°C, und/oder für etwa 2 Minuten bis etwa 10 Minuten, vorzugsweise etwa 3 Minuten bis etwa 5 Minuten, durchgeführt. Das Spalten des Troponin-Proteins mit einem En¬ zym kann beispielsweise dadurch besonders schnell erfolgen, dass Mikrosäulen verwendet werden, auf denen das Enzym auf einer großen Oberfläche verteilt ist. Überraschenderweise wurde festgestellt, dass das Troponin-Protein bei einer er¬ höhten Temperatur besonders effizient durch ein Enzym gespalten werden kann. Eine erhöhte Temperatur bedeutet, dass die Temperatur höher als etwa 37°C ist. Das Spalten des Troponin- Proteins kann beispielsweise bei etwa 40°C oder bei etwa 53°C erfolgen. Die Temperatur wird vorzugsweise in Abhängigkeit der Thermostabilität und der Aktivität des verwendeten Enzyms gewählt. Durch die erhöhte Temperatur wird die enzymatische Spaltung des Troponin-Proteins und somit auch das Verfahren
insgesamt beschleunigt. Das Spalten des Troponin-Proteins er¬ folgt vorzugsweise in etwa 3 Minuten, etwa 5 Minuten oder et¬ wa 8 Minuten. Durch die Spaltung des Troponin-Proteins in nur etwa 2 Minuten bis etwa 10 Minuten ist das erfindungsgemäße Verfahren insbesondere für den Einsatz im klinischen Umfeld geeignet, da es eine schnelle und spezifische Diagnose von akutem Koronarsyndrom ermöglicht. Somit können lebenswichtige therapeutische Maßnahmen frühzeitig eingeleitet werden, wo¬ durch sich die Heilungschancen der Patienten verbessern.
In einer bevorzugten Ausführungsform wird nach Schritt b) das Epitop-Fragment quantifiziert. Das Epitop-Fragment kann für die Quantifizierung beispielsweise durch Behandeln des Trägers mit Trifluoressigsäure von dem Antikörper gelöst werden. Durch die Quantifizierung des Epitop-Fragments wird die Kon¬ zentration aller Formen des Troponin-Proteins in der Probe bestimmt. Diese Troponin-Konzentration ist ein wertvoller klinischer Parameter, der neben diagnostischen Zwecken auch für die Abschätzung des Risikos, mit der die Erkrankung fort- schreitet oder zu weiteren Komplikationen führt, von Bedeutung ist. Beispielsweise steht die Troponin-Konzentration mit der Größe eines Myokardinfarkts und mit der Überlebensrate nach einem Infarkt in Zusammenhang. Somit kann die Quantifizierung des Epitop-Fragments für die Feindiagnose von akutem Koronarsyndrom beitragen. Die Quantifizierung des Epitop- Fragments kann mittels üblicher Verfahren der
Peptidquantifizierung durchgeführt werden, beispielsweise mit Massenspektrometrie . In einer bevorzugten Ausführungsform ist das Troponin-Protein Troponin I und/oder Troponin T. Troponin I und Troponin T sind spezifische Marker im Blut bzw. im Serum von Patienten mit einer Myokardschädigung . Für beide Troponin-Proteine sind spezifische posttranslationale Modifikationen beschrieben, die bei Myokardinfarkt auftreten. Daher sind Troponin I und/oder Troponin T zur Verwendung in dem erfindungsgemäßen Verfahren besonders geeignet.
In einer bevorzugten Ausführungsform erfolgt das Auslesen des durch das Enzym spezifisch gespaltenen Nicht-Epitop-Fragments mittels Massenspektrometrie . Die Massenspektrometrie ist ein hochempfindliches Verfahren zur Charakterisierung von Protei- nen und Peptiden, mit dem die Masse jedes Nicht-Epitop- Fragments ermittelt werden kann. Sind die Schnittstellen des verwendeten Enzyms im Troponin-Protein bekannt, so kann die Masse dem enzymspezifischen Nicht-Epitop-Fragment zugeordnet werden. Außerdem erlaubt die Masse des Nicht-Epitop-Fragments einen Rückschluss auf dessen Aminosäuresequenz. Dadurch kann das Vorliegen und/oder Fehlen enzymspezifischer Nicht-Epitop- Fragmente mit hoher Genauigkeit bestimmt werden. Das Auslesen der Nicht-Epitop-Fragmente kann beispielsweise mit MALDI-MS (Matrix-unterstützte Laser-DeSorption/ Ionisation
Massenspektrometrie) und/oder ESI-MS (Elektronenspray- Ionisation Massenspektrometrie) durchgeführt werden.
In einer bevorzugten Ausführungsform werden die Schritte a) bis c) des erfindungsgemäßen Verfahrens mittels Affinitäts- Massenspektrometrie durchgeführt. Dabei wird eine Affinitäts¬ chromatographie zum Bereitstellen des Träger mit dem an den Antikörper gebundenen Troponin-Protein mit einer
Massenspektrometrie zum Auslesen des durch das Enzym spezifisch gespaltenen Nicht-Epitop-Fragments kombiniert. Die Af- finitäts-Massenspektrometrie ist einfach zu standardisieren und ermöglicht eine effiziente Durchführung des erfindungsge¬ mäßen Verfahrens .
In einer bevorzugten Ausführungsform wird nach Schritt b) das durch das Enzym spezifisch gespaltene Nicht-Epitop-Fragment quantifiziert. Die Quantifizierung des Nicht-Epitop-Fragments ergibt die Konzentration der jeweiligen posttranslational mo¬ difizierten Form des Troponin-Proteins in der Probe. Die Quantifizierung kann beispielsweise mittels
Massenspektrometrie durchgeführt werden. Aus der Konzentrati¬ on der einzelnen modifizierten Troponin-Formen können Informationen über den Krankheitsverlauf und/oder die Schwere des akuten Koronarsyndroms abgeleitet werden. Somit liefert die
Quantifizierung des Nicht-Epitop-Fragments einen wertvollen klinischen Parameter für die Feindiagnose von akutem Koronarsyndrom. In einer besonders bevorzugten Ausführungsform erfolgt das Quantifizieren des Nicht-Epitop-Fragments unter Verwendung des gleichen Verfahrens, mit der das Nicht-Epitop-Fragment auslesen wird. Dadurch kann das Nicht-Epitop-Fragment auf ef¬ fiziente und kostengünstige Weise identifiziert und quantifi- ziert werden.
In einer bevorzugten Ausführungsform ist der Antikörper ein monoklonaler Antikörper. Während polyklonale Antikörper aufgrund ihrer Herstellung ein Gemisch von Antikörpern darstel- len, die an unterschiedliche Epitope des Troponin-Proteins binden, erkennt ein monoklonaler Antikörper im Optimalfall ein spezifisches Epitop des Troponin-Proteins. Der monoklona¬ le Antikörper wird vorteilhaft so ausgewählt, dass er nicht an Aminosäureabschnitte des Troponin-Proteins bindet, in de- nen posttranslationale Modifikationen auftreten können. Dadurch wird sicher gestellt, dass alle Isoformen des Troponin- Proteins an den Antikörper binden, insbesondere auch
posttranslational modifizierte Formen, denen bestimmte
Aminosäureabschnitte fehlen.
In einer bevorzugten Ausführungsform werden ein erster und ein zweiter Antikörper mit unterschiedlichen Spezifitäten verwendet. In diesem Fall sind zwei verschiedene kardiale Troponin-Proteine aus der Probe an den Träger gebunden, die zusammen in einem Verfahrensdurchlauf zur Diagnose von akutem Koronarsyndrom herangezogen werden. Dadurch wird die Spezifität der Diagnose erhöht.
In einer bevorzugten Ausführungsform bindet der erste Anti- körper spezifisch Troponin I und der zweite Antikörper bindet spezifisch Troponin T. Dadurch sind sowohl Troponin I- als auch Troponin T-Proteine an den Träger gebunden. Beide
Troponin-Proteine weisen bei Vorliegen des akuten Koronarsyn-
droms ischämisch bedingte posttranslationale Modifikationen auf. Das Auslesen der Nicht-Epitop-Fragmente von sowohl
Troponin T als auch Troponin I ermöglicht es daher, das akute Koronarsyndrom mit einer hohen Spezifität zu diagnostizieren.
In einer bevorzugten Ausführungsform werden Muster, die beim Auslesen mehrerer Nicht-Epitop-Fragmente von mindestens zwei unterschiedlichen Troponin-Proteinen wie beispielsweise
Troponin I und Troponin T erhalten werden, einer zugrundelie- genden Erkrankung zugeordnet. Die krankheitsspezifischen Muster, die als Troponin-Fingerprints bezeichnet werden, entste¬ hen aufgrund der unterschiedlichen posttranslationalen Modifikationen der Troponin-Proteine, die bei verschiedenen Herz- Kreislauf-Erkrankungen auftreten. In einer besonders bevor- zugten Ausführungsform wird der Troponin-Fingerprint für die Zuordnung der zugrundeliegenden Erkrankung mit der Konzentration der einzelnen modifizierten Troponin-Formen kombiniert, die durch die Quantifizierung der Nicht-Epitop-Fragmente ge¬ wonnen wird. Durch die Troponin-Muster bzw. -Fingerprints wird die Diagnose von akutem Koronarsyndrom um die Identifi¬ zierung der konkreten zugrundeliegenden Erkrankung erweitert. Dadurch wird die Spezifität der Diagnose erhöht und die Fest¬ stellung einer geeigneten Behandlungsstrategie vereinfacht. In einer bevorzugten Ausführungsform ist das Enzym eine
Protease. Die Protease wird so ausgewählt, dass sie das
Troponin-Protein an mindestens einer Schnittstelle spaltet. Vorteilhaft wird eine Protease eingesetzt, deren Schnittstel¬ le oder Schnittstellen in dem Troponin-Protein bekannt sind, wie beispielsweise Trypsin oder Chymotrypsin . Dadurch wird das nachfolgende Auslesen des durch das Enzym spezifisch gespaltenen Nicht-Epitop-Fragments erleichtert. Trypsin bei¬ spielsweise spaltet Proteine nach den Aminosäuren Lysin und Arginin .
Bei der enzymatischen Troponin-Spaltung ist es möglich, dass das Enzym jedes an den Träger gebundene Troponin-Protein an jeder zugänglichen, das heißt nicht durch die Antikörperbin-
dung geschützten, Schnittstelle spaltet. Die meisten Enzyme spalten jedoch nicht jedes Troponin-Protein an jeder möglichen Schnittstelle. Vielmehr kommt es vor, dass das Enzym in einem Teil der Proteine einzelne oder mehrere zugängliche Schnittstellen auslässt. Das Ausmaß dieses Auslassens von
Schnittstellen hängt vor allem von der Enzymaktivität ab und kann durch die Bedingungen der Troponin-Spaltung wie beispielsweise Dauer, pH-Wert und/oder Temperatur beeinflusst werden. Wenn das Enzym in einem Teil der Troponin-Proteine einzelne oder mehrere Schnittstellen auslässt, entstehen zu¬ sätzlich zu den Fragmenten, die durch Spaltung der Troponin- Proteine an zwei benachbarten Schnittstellen gebildet werden, auch längere Epitop- und Nicht-Epitop-Fragmente. Je mehr Schnittstellen das Enzym auslässt, umso größer ist die Anzahl der möglichen Nicht-Epitop-Fragmente. Mit der steigenden An¬ zahl an Nicht-Epitop-Fragmenten erhöht sich die Komplexität des Ausleseschrittes. Außerdem kann der Nachweis bestimmter Nicht-Epitop-Fragmente durch eine hohe Anzahl an Nicht- Epitop-Fragmenten erschwert werden. Die Bedingungen der
Troponin-Spaltung werden daher vorzugsweise so gewählt, dass das Enzym höchstens zwei aufeinanderfolgende Schnittstellen auslässt. Dadurch können die Nicht-Epitop-Fragmente effizient ausgelesen und das Vorliegen und/oder Fehlen von Nicht- Epitop-Fragmenten kann auf einfache Weise detektiert werden.
In einer besonders bevorzugten Ausführungsform ist das Enzym Chymotrypsin . Chymotrypsin spaltet Proteine nach den Aminosäuren Tyrosin, Tryptophan, Phenylalanin, Leucin und Methio- nin. Bei der Spaltung von Troponin I oder Troponin T mit Chymotrypsin entstehen mehrere Nicht-Epitop-Fragmente, die nur bei der nicht durch Koronarsyndrom hervorgerufenen, nicht oder anders modifizierten Form des Troponin-Proteins vorlie¬ gen, und somit bei akutem Koronarsyndrom fehlen. Zusätzlich werden Nicht-Epitop-Fragmente erzeugt, die nur bei ischämisch posttranslational modifizierten Troponin-Isoformen auftreten. Dadurch, dass bestimmte chymotrypsinspezifische Nicht-Epitop- Fragmente nur bei der nicht durch Koronarsyndrom hervorgeru¬ fenen Form oder nur bei der durch Koronarsyndrom modifizier-
ten Form des Troponin-Proteins entstehen und somit bei der jeweiligen anderen Form fehlen, wird die Diagnose von akutem Koronarsyndrom erleichtert, was zu der hohen Spezifität des erfindungsgemäßen Verfahrens beiträgt.
Ein weiterer Gegenstand der Erfindung betrifft ein Kit zur Diagnose von akutem Koronarsyndrom umfassend einen festen Träger mit mindestens einem ersten Antikörper und mindestens einem zweiten Antikörper, wobei die Antikörper jeweils unter- schiedliche kardiale Troponin-Proteine spezifisch binden. So¬ mit werden zwei verschiedene kardiale Troponin-Proteine an den Träger gebunden, die zusammen zur Diagnose von akutem Koronarsyndrom herangezogen werden. Dadurch wird eine hohe Spezifität der Diagnose erreicht.
In einer bevorzugten Ausführungsform bindet der erste Antikörper spezifisch Troponin I, und der zweite Antikörper bindet spezifisch Troponin T. Ein weiterer Gegenstand der Erfindung betrifft die Verwendung von mindestens einem durch ein Enzym spezifisch gespaltenen Nicht-Epitop-Fragment mindestens eines kardialen Troponin- Proteins zur Diagnose von akutem Koronarsyndrom. Das Nicht- Epitop-Fragment wird vorteilhaft so ausgewählt, dass es ein Nicht-Epitop-Fragment ist, das nur bei enzymatischer Spaltung einer ischämisch posttranslational modifizierten Form des Troponin-Proteins entsteht. Anhand des Vorliegens dieses Nicht-Epitop-Fragments wird das akute Koronarsyndrom diagnos¬ tiziert .
Ein weiterer Gegenstand der Erfindung betrifft eine Verwendung von mindestens einem durch ein Enzym spezifisch gespaltenen Nicht-Epitop-Fragment mindestens eines kardialen
Troponin-Proteins zum Nachweis von mindestens einer
posttranslationalen Modifikation des Troponin-Proteins. In einer bevorzugten Ausführungsform ist die posttranslationale Modifikation des Troponin-Proteins eine Abspaltung von N- terminalen oder C-terminalen Aminosäureabschnitten, wie sie
bei Troponin-Proteinen im Blut von Myokardinfarktpatienten auftreten. Das Nicht-Epitop-Fragment kann nicht nur zum Nach¬ weis einer bekannten posttranslationalen Modifikation des Troponin-Proteins verwendet werden, sondern auch zur Identi- fizierung und Charakterisierung von neuen posttranslationalen Modifikationen des Troponin-Proteins eingesetzt werden.
Im Folgenden wird eine bevorzugte Ausführungsform des erfindungsgemäßen Verfahrens anhand einer schematischen Zeichnung dargestellt.
Figur 1 zeigt einen festen Träger 1, der von einer
Sepharosesäule gebildet wird und auf dessen Oberfläche mono¬ klonale Antikörper 2 immobilisiert sind. Zunächst wird eine Probe 4 mit der Sepharosesäule in Kontakt gebracht. Die Probe 4 ist Serum eines Patienten mit Verdacht auf akutes Koronar¬ syndrom und enthält neben den gewöhnlichen Serumproteinen kardiale Troponin-Proteine 3. Die Antikörper 2 auf der Säule binden spezifisch kardiales Troponin I. Somit binden die im Serum enthaltenen kardialen Troponin I-Proteine bei Kontakt mit der Säule an die Antikörper 2. Die Säule wird anschlie¬ ßend mit phosphatgepufferter Salzlösung (PBS) gewaschen, um ungebundene Proteine 5 von der Säule zu entfernen. In einem nächsten Schritt wird die Säule mit Chymotrypsin in Kontakt gebracht. Die Chymotrypsinspaltung wird für 5 Minuten bei
53°C durchgeführt, wobei Chymotrypsin das an die Säule gebun¬ dene Troponin I spezifisch in mehrere Fragmente spaltet. Da¬ bei sind diejenigen Schnittstellen von Chymotrypsin, die im Bereich der Bindungsstellen des Antikörpers 2 an Troponin I liegen, durch den Antikörper 2 vor einer Spaltung durch
Chymotrypsin geschützt. Troponin-Fragmente, die die Epitope umfassen, bleiben als Epitop-Fragmente 6 an die Antikörper 2 gebunden, während sich durch Chymotrypsin spezifisch gespaltene Nicht-Epitop-Fragmente 7 von der Säule lösen. Die Nicht- Epitop-Fragmente 7 können durch Waschen der Säule von dieser getrennt werden. Anschließend werden die Nicht-Epitop- Fragmente 7 mittels Massenspektrometrie analysiert, um spezi¬ fische posttranslationale Modifikationen von Troponin I nach-
zuweisen (nicht dargestellt) . Durch Behandeln der Säule mit Trifluoressigsäure werden die Epitop-Fragmente 6 von den An¬ tikörpern 2 gelöst und zur Bestimmung der Troponin I- Konzentration im Serum verwendet (nicht dargestellt) .
Beispiele
Im Folgenden sind Beispiele für mittels Massenspektrometrie ausgelesene Nicht-Epitop-Fragmente der humanen kardialen Troponin-Proteine Troponin I und Troponin T gezeigt. Die Be¬ dingungen wurden in allen Beispielen so gewählt, dass
Cystein-und Methioninreste in reduzierter Form vorliegen und bei der Troponin-Spaltung höchstens zwei Schnittstellen von dem Enzym ausgelassen werden. Die Massen der Nicht-Epitop- Fragmente sind in [M+H]+ angegeben. In der ersten Spalte der Tabellen sind die Massen der Nicht-Epitop-Fragmente aufge¬ führt, die bei Vorliegen der nicht modifizierten Form des jeweiligen Troponin-Proteins entstehen. In der zweiten Spalte der Tabellen sind die Massen der Nicht-Epitop-Fragmente auf- geführt, die bei Vorliegen einer posttranslational modifi¬ zierten Form des jeweiligen Troponin-Proteins und damit bei Vorliegen des akuten Koronarsyndroms detektiert werden. In der dritten Spalte der Tabellen sind die Aminosäuresequenzen der Nicht-Epitop-Fragmente angegeben, die entweder nur bei der nicht modifizierten Form oder nur bei der modifizierten Form des Troponin-Proteins entstehen. Die Angaben der
Schnittstellen beziehen sich auf die Position der Aminosäuren in der nicht modifizierten Form des jeweiligen Troponin- Proteins, beginnend vom N-terminalen Ende des Proteins.
Beispiel 1: Troponin I
Bei Ischämie tritt eine C-terminal modifizierte Form von Troponin I auf, die am C-terminalen Ende um 17 Aminosäuren verkürzt ist. Als Antikörper wurde der anti-Troponin I Anti¬ körper aus dem Siemens Immulite 2500 cTnl Kit (2nd generation assay, Siemens Diagnostic Products Corporation, Los Angeles, CA, USA) verwendet. Die Bindungsstelle des Antikörpers liegt
im Abschnitt von Aminosäure 24 bis 40 des Troponin I- Proteins. Dieses Epitop des Troponin I-Proteins ist durch die Bindung an den Antikörper vor der Spaltung durch Chymotrypsin und/oder Trypsin geschützt. Aus Vorarbeiten ist bekannt, dass das N-terminale Methionin des Troponin I in der
massenspektrometrischen Analyse nicht detektiert wird.
Aminosäuresequenz der nicht modifizierten Form von Troponin I :
M ADGSSDAARE PRPAPAPIRR RSSNYRAYAT EPHAKKKSKI SASRKLQLKT LLLQIAKQEL EREAEERRGE KGRALSTRCQ PLELAGLGFA ELQDLCRQLH ARVDKVDEER YDIEAKVTKN ITEIADLTQK IFDLRGKFKR PTLRRVRI SA DAMMQALLGA RAKESLDLRA HLKQVKKEDT EKENREVGDW RK IDALSGMEGRKKKFES (SEQ ID NO: 1)
Die Aminosäuresequenz der C-terminal posttranslational modi¬ fizierten Form von Troponin I ist unter SEQ ID NO: 2 gezeigt.
1. Spalten von Troponin I mit Chymotrypsin
Nicht mo¬ di
fi Modifi- zi zi
er er
te te
Fo Fo
rm rm
vo vo
n n
Tr Tr
op op
on on
in in
I I Aminosäuresequenz
3.888, 0501 3.888, 0501
3.770, 9493 3.770, 9493
3.505, 8622 RAHLKQVKKEDTEKENREVG
DWRKNIDAL (SEQ ID NO: 3)
3.381, 7767 3.381, 7767
Nicht mo- di
fi Modifi- zi zi
er er
te te
Fo Fo
rm rm
o o
n n
Tr Tr
op op
on on
in in
I I Aminosäuresequenz
3 .303, 6749 KQVKKEDTEKENREVGDWRK NIDALSGM
(SEQ ID NO: 4)
3 .270, 6964 3 .270, 6964
3 .028, 5810 KQVKKEDTEKENREVGDWRK NIDAL
(SEQ ID NO: 5)
2 .979, 5871 RAHLKQVKKEDTEKENREVG DWRK
(SEQ ID NO: 6)
2 .923, 5020 2 .923, 5020
2 .813, 4434 2 .813, 4434
2 .709, 4754 2 .709, 4754
2 .695, 3910 2 .695, 3910
2 .618, 4287 2 .618, 4287
2 .596, 3913 2 .596, 3913
2 .571, 3168 2 .571, 3168
2 .502, 3059 KQVKKEDTEKENREVGDWRK (SEQ ID
NO: 7)
2 .390, 3177 2 .390, 3177
2 .373, 1728 2 .373, 1728
2 .258, 3138 2 .258, 3138
2 .218, 1098 2 .218, 1098
2 .017, 0032 2 .017, 0032
1 .978, 1014 RKNIDALSGMEGRKKKF (SEQ ID NO:
8)
1 .901, 0684 1 .901, 0684
1 .785, 9314 1 .785, 9314
Nicht mo- di
fi Modifi- zi zi
er er
te te
Fo Fo
rm rm
o o
n n
Tr Tr
op op
on on
in in
I I Aminosäuresequenz
1.772, 9640 1.772, 9640
1.770, 0279 1.770, 0279
1.617, 8675 1.617, 8675
1.536, 8604 1.536, 8604
1.516, 7502 1.516,7502
1.383, 7049 SGMEGRKKKFES (SEQ ID NO: 9)
1.352, 7685 1.352,7685
1.330, 7953 1.330,7953
1.305, 6878 1.305, 6878
1.287, 6725 1.287, 6725
1.256, 7321 1.256, 7321
1.188, 6041 1.188, 6041
1.174, 6473 1.174, 6473
1.172, 6633 1.172, 6633
1.167, 6303 SGMEGRKKKF (SEQ ID NO: 10)
1.108, 6109 EGRKKKFES (SEQ ID NO: 11)
1.104, 5830 RKNIDALSGM (SEQ ID NO: 12)
1.102, 6843 1.102, 6843
1.059, 5793 1.059, 5793
1.055, 6459 1.055, 6459
1.046, 5299 1.046, 5299
944, 5523 944, 5523
942, 5618 942, 5618
892, 5363 892, 5363
Nicht mo- di
fi Modifi - zi zi
er er
te te
Fo Fo
rm rm
o o
n n
Tr Tr
op op
on on
in in
I I Aminosäuresequenz
892, 4410 892, 4410
875, 4403 875, 4403
864, 4825 864, 4825
831, 4683 831, 4683
829, 4890 RKNIDAL (SEQ ID NO: 13)
829, 4778 829, 4778
804, 4032 804, 4032
777, 4141 777, 4141
735, 4148 735, 4148
724, 4100 724, 4100
715, 4712 715, 4712
706, 3770 706, 3770
688, 3512 688, 3512
636, 3715 636, 3715
614, 3984 614, 3984
602, 3872 602, 3872
587, 4126 587, 4126
575, 3221 575, 3221
536, 2715 536, 2715
519, 2708 519, 2708
507, 3038 507, 3038
502, 2871 502, 2871
496, 2990 496, 2990
474, 3286 474, 3286
Nicht mo- di
fi Modifi- zi zi
er er
te te
Fo Fo
rm rm
o o
n n
Tr Tr
op op
on on
in in
I I Aminosäuresequenz
464, 2503 464, 2503
462, 2381 462, 2381
444,2816 444,2816
375, 1874 375, 1874
361, 2445 361, 2445
332, 1816 332, 1816
331, 1976 331, 1976
303,2139 RK
294, 1118 SGM
261, 1445 261, 1445
260, 1605 260, 1605
260, 1605 260, 1605
247, 1288 247, 1288
245, 1859 245, 1859
235, 0924 ES
223, 1077 223, 1077
150,0583 150,0583
132, 1019 132, 1019
Durch die chymotrypsinspezifische Spaltung nach Aminosäure 190 entsteht bei der modifizierten Form von Troponin I ein Nicht-Epitop-Fragment aus zwei Aminosäuren RK mit der Masse 303,2139 [M+H]+. Bei der nicht modifizierten Form entsteht bei gleichzeitiger Spaltung nach Aminosäure 197, die in der
modifizierten Form nicht existiert, ein Nicht-Epitop-Fragment aus sieben Aminosäuren mit der Sequenz RKNIDAL (SEQ ID NO: 13) und einer Masse von 829,4890 [M+H]+. Wenn keine Spaltung durch Chymotrypsin nach Aminosäure 190 erfolgt, aber an der kurz davor liegenden Schnittstelle nach Aminosäure 172, ent¬ steht bei der modifizierten Form von Troponin I ein Nicht- Epitop-Fragment der Sequenz KQVKKEDTEKENREVGDWRK (SEQ ID NO: 7) mit der Masse 2.502,3059 [M+H]+. Bei der nicht modifizier¬ ten Form entsteht bei gleichzeitiger Spaltung nach Aminosäure 197 dagegen ein Nicht-Epitop-Fragment der Sequenz KQVKKEDTEKENREVGDWRKNIDAL (SEQ ID NO: 5) mit der Masse 3.028,5810 [M+H]+. Wenn keine Spaltung nach den Aminosäuren 190 und 172, 171 erfolgt, entsteht durch Spaltung nach Amino¬ säure 168 bei der modifizierten Form von Troponin I ein Nicht-Epitop-Fragment der Sequenz RAHLKQVKKEDTEKENREVG DWRK (SEQ ID NO: 6) (2.979,5871 [M+H]+) und bei der nicht modifizierten Form ein Nicht-Epitop-Fragment der Sequenz RAHLKQVKKEDTEKENREVG DWRKNIDAL (SEQ ID NO: 3) (3.505,8622 [M+H] +) .
2. Spalten von Troponin I mit Trypsin
Nicht mo- di
fi Modifi- zi zi
er er
te te
Fo Fo
rm rm
vo vo
n n
Tr Tr
op op
on on
in in
I I Aminosäuresequenz
3.209, 6670 3.209, 6670
3.023,5553 3.023,5553
2.817, 4498 2.817, 4498
2.681, 3650 2.681, 3650
Nicht mo- di
f i Modif i- zi zi
er er
te te
Fo Fo
rm rm
o o
n n
Tr Tr
op op
on on
in in
I I Aminosäure sequenz
2.604, 3272 2.604, 3272
2.360, 2424 2.360,2424
2.293, 2285 2.293, 2285
2.218, 2441 2.218,2441
2.169, 1873 2.169, 1873
2.090, 0849 2.090, 0849
2.076, 0252 2.076, 0252
2.075, 1495 2.075, 1495
2.037, 2430 2.037, 2430
2.032, 9868 E VGDWRKN I DAL S GME GR (SEQ ID
NO: 14)
1.933, 9838 1.933, 9838
1.902, 0411 1.902, 0411
1.890, 0331 1.890, 0331
1.859, 0102 1.859, 0102
1.762, 7990 1.762,7990
1.708, 8388 1.708, 8388
1.702, 9091 1.702, 9091
1.694, 8595 1.694, 8595
1.646, 8716 1.646, 8716
1.594, 8295 1.594, 8295
1.573, 8795 1.573, 8795
1.554, 9213 1.554, 9213
1.536, 8856 1.536, 8856
Nicht mo- di
fi Modifi- zi zi
er er
te te
Fo Fo
rm rm
o vo
n n
Tr Tr
op op
on on
in in
I I Aminosäuresequenz
1.510, 0090 1.510, 0090
1.447, 7395 1.447, 7395
1.444, 7139 1.444, 7139
1.418, 7420 KNIDALSGMEGRK (SEQ ID NO:
15) ; alternativ
NIDALSGMEGRKK (SEQ ID NO: 16)
1.415, 8342 1.415, 8342
1.381, 9141 1.381, 9141
1.380,7957 1.380,7957
1.366, 6485 1.366, 6485
1.290, 6470 KNIDALSGMEGR (SEQ ID NO: 17);
alternativ
NIDALSGMEGRK (SEQ ID NO : 18)
1.288, 6392 1.288, 6392
1.288, 6127 1.288, 6127
1.259, 7331 1.259, 7331
1.245, 6685 1.245, 6685
1.181, 6637 1.181, 6637
1.162, 5521 NIDALSGMEGR (SEQ ID NO: 19)
1.160, 5443 1.160, 5443
1.148, 5542 1.148, 5542
1.123, 6622 1.123, 6622
1.104, 5895 1.104, 5895
1.103, 6320 1.103, 6320
Nicht mo- di
f i Modif i - zi zi
er er
te te
Fo Fo
rm rm
o o
n n
Tr Tr
op op
on on
in in
I I Aminosäure sequenz
1.103, 5439 1.103, 5439
1.102, 6843 1.102, 6843
1.074, 6014 1.074, 6014
1.073, 6690 1.073, 6690
1.066, 5779 1.066, 5779
1.053, 6752 1.053, 6752
1.020, 4592 1.020, 4592
989, 4898 989, 4898
966, 5479 966, 5479
951, 6098 951, 6098
931, 5207 931, 5207
917, 5679 917, 5679
899, 5924 899, 5924
889, 4526 889, 4526
849, 3697 849, 3697
848, 4988 848, 4988
823, 5148 823, 5148
798, 5057 798, 5057
789, 3849 789, 3849
761, 3576 761, 3576
760, 4424 760, 4424
749, 3675 749, 3675
738, 3668 738, 3668
732, 3886 732, 3886
Nicht mo- di
f i Modif i- zi zi
er er
te te
Fo Fo
rm rm
o o
n n
Tr Tr
op op
on on
in in
I I Aminosäure sequenz
702, 4005 702, 4005
674, 3468 674, 3468
663, 3824 663, 3824
647, 2995 647, 2995
642, 4045 642, 4045
638, 3508 KKFES (SEQ ID NO: 20)
633, 2838 633, 2838
629, 4344 629, 4344
624, 3576 624, 3576
621, 2726 621, 2726
547, 3198 547, 3198
546, 2994 546, 2994
510, 2558 KFES (SEQ ID NO: 21)
502, 3347 502, 3347
501, 3395 501, 3395
489, 2779 489, 2779
479, 2976 479, 2976
468, 2929 468, 2929
430, 2885 430,2885
418, 2045 418,2045
403, 3027 KKK
382, 1609 FES
374, 2398 374, 2398
361, 2081 361, 2081
Nicht mo- di
fi Modifi- zi zi
er er
te te
Fo Fo
rm rm
o o
n n
Tr Tr
op op
on on
in in
I I Aminosäuresequenz
347,2289 347,2289
333, 1768 333, 1768
331, 2200 331, 2200
294, 1812 294, 1812
275,2077 275,2077
274, 1873 274, 1873
232, 1404 232, 1404
218, 1499 218, 1499
204, 1342 204, 1342
175, 1189 175, 1189
147, 1128 147, 1128
Durch die trypsinspezifischen Schnittstellen nach den Aminosäuren 192 und 193, die am C-terminalen Ende der verkürzten modifizierten Form von Troponin I liegen, entstehen Nicht- Epitop-Fragmente, die nur bei der nicht modifizierten Form des Proteins vorliegen. Diese Fragmente treten also nur bei Patienten auf, die kein akutes Koronarsyndrom haben. Ein Beispiel ist das Nicht-Epitop-Fragment der Sequenz
EVGDWRKNIDALSGMEGR (SEQ ID NO: 14) (2.032, 9868 [M+H]+). Durch die Spaltung durch Trypsin an Schnittstellen, die in dem Abschnitt von Troponin I liegen, der bei der modifizierten Form fehlt, treten weitere Nicht-Epitop-Fragmente auf, die nur bei der nicht modifizierten Form des Proteins entstehen. Beispie-
le für solche Fragmente sind KKFES (SEQ ID NO: 20) (638,3508 [M+H]+) und KFES (SEQ ID NO: 21) (510, 2558 [M+H]+).
Beispiel 2: Troponin T
Für Troponin T ist eine N-terminale posttranslationale Modi¬ fikation beschrieben, die bei myokardialer Ischämie auftritt. Die modifizierte Form entsteht durch die Abspaltung der N- terminalen Aminosäuren 1 bis 71 von Troponin T. Als Antikör- per wurden der M7 Antikörper und der M11.7 Antikörper (beide Roche Diagnostics, Penzberg, Deutschland) verwendet. Die Bin¬ dungsstellen der Antikörper liegen beim M7 Antikörper im Abschnitt von Aminosäure 125 bis 131 und beim M11.7 Antikörper im Abschnitt von Aminosäure 136 bis 147 des Troponin T- Proteins. Diese Epitope des Troponin T-Proteins sind durch ihre Bindung an die Antikörper vor der Spaltung durch Trypsin geschützt .
Aminosäuresequenz der nicht modifizierten Form von Troponin T:
MSDIEEVVEEYEEEEQEEAAVEEQEEAAEEDAEAEAETEETRAEEDEEEEEAKEAEDGPM EESKPKPRSFMPNLVPPKI PDGERVDFDDIHRKRMEKDLNELQALIEAHFENRKKEEEEL VSLKDRIERRRAERAEQQRIRNEREKERQNRLAEERARREEEENRRKAEDEARKKKALSN MMHFGGYIQKQAQTERKSGKRQTEREKKKKILAERRKVLAIDHLNEDQLREKAKELWQS I YNLEAEKFDLQEKFKQQKYEINVLRNRINDNQKVSKTRGKAKVTGRWK (SEQ ID NO: 22)
Die Aminosäuresequenz der In¬terminal posttranslational modi- fizierten Form von Troponin T ist unter SEQ ID NO: 23 ge- zeigt .
1. Spalten von Troponin T mit Chymotrypsin
Nicht mo- di
fi Modifi- zi zi
er er
te te
Fo Fo
rm rm
o o
n n
Tr Tr
op op
on on
in in
T T Aminosäuresequenz
7.934,2965 SDIEEVVEEYEEEEQEEAAV
EEQEEAAEEDAEAEAETEET RAEEDEEEEEAKEAEDGPME ESKPKPRSF (SEQ ID NO: 24)
7.197,0032 EEEEQEEAAVEEQEEAAEED
AEAEAETEETRAEEDEEEEE AKEAEDGPMEESKPKPRSFM PNL (SEQ ID NO: 25)
6.879,7228 MSDIEEVVEEYEEEEQEEAA
VEEQEEAAEEDAEAEAETEE TRAEEDEEEEEAKEAEDGPM
(SEQ ID NO: 26)
6.748,6823 SDIEEVVEEYEEEEQEEAAV
EEQEEAAEEDAEAEAETEET RAEEDEEEEEAKEAEDGPM
(SEQ ID NO: 27)
6.741,7830 EEEEQEEAAVEEQEEAAEED
AEAEAETEETRAEEDEEEEE AKEAEDGPMEESKPKPRSF
(SEQ ID NO: 28)
5.556,1688 EEEEQEEAAVEEQEEAAEED
AEAEAETEETRAEEDEEEEE AKEAEDGPM (SEQ ID NO: 29)
4. 441, 6065 4. 441, 6065
4. 169, 4217 4. 169, 4217
3. 956, 2165 3. 956, 2165
3. 892, 3155 3. 892, 3155
3. 660, 8405 3. 660, 8405
Nicht mo- di
fi Modifi- zi zi
er er
te te
Fo Fo
rm rm
o o
n n
Tr Tr
op op
on on
in in
T T Aminosäuresequenz
3.601, 0197 3.601, 0197
3.529, 8000 3.529, 8000
3.408, 9410 3.408, 9410
3.316, 8924 3.316, 8924
3.280, 8461 3.280, 8461
3.197, 6845 3.197, 6845
3.109, 6138 3.109, 6138
3.039,7861 3.039,7861
3.005,5625 3.005,5625
2.975, 5342 MPNLVPPKI PDGERVDFDDI HRKRM
(SEQ ID NO: 30)
2.844, 4937 PNLVPPKIPDGERVDFDDIH RKRM
(SEQ ID NO: 31)
2.840, 6190 2.840, 6190
2.712, 5240 2.712, 5240
2.520,3139 2.520,3139
2.213, 1196 2.213, 1196
2.200, 1244 2.200, 1244
2.022, 0614 2.022, 0614
2.020, 0934 2.020, 0934
1.923, 9996 MPNLVPPKI PDGERVDF (SEQ ID NO:
32)
1.911, 9705 1.911, 9705
1.900, 9399 1.900, 9399
1.794, 9748 1.794, 9748
Nicht mo- di
fi Modifi- zi zi
er er
te te
Fo Fo
rm rm
o o
n n
Tr Tr
op op
on on
in in
T T Aminosäuresequenz
1 .792, 9591 PNLVPPKI PDGERVDF (SEQ ID NO:
33)
1.659, 8523 EESKPKPRSFMPNL (SEQ ID NO:
34)
1.658, 8496 1 .658, 8496
1.602, 8333 1 .602, 8333
1.555, 8009 1 .555, 8009
1.550, 8325 1 .550, 8325
1.472, 7703 1 .472,7703
1.468, 7794 1 .468, 7794
1.454, 7638 1 .454, 7638
1.420, 8383 1 .420, 8383
1.383, 6790 1 .383, 6790
1.342, 5719 MSDIEEVVEEY (SEQ ID NO : 35)
1.341, 6685 1 .341, 6685
1.303, 6488 1 .303, 6488
1.284, 6582 1 .284, 6582
1.262, 7103 1 .262, 7103
1.226, 6528 1 .226, 6528
1.211, 5314 SDIEEVVEEY (SEQ ID NO: 36)
1.204, 6320 EESKPKPRSF (SEQ ID NO: 37)
1.172, 6157 1 .172, 6157
1.167, 5640 1 .167, 5640
1.078, 5415 1 .078, 5415
1.070, 5523 1 .070, 5523
Nicht mo- di
f i Modif i - zi zi
er er
te te
Fo Fo
rm rm
o o
n n
Tr Tr
op op
on on
in in
T T Aminosäure sequenz
1.059, 5945 1.059, 5945
928, 4887 928, 4887
923, 4621 923, 4621
873, 5152 873, 5152
871, 5472 871, 5472
860, 4360 860, 4360
851, 4145 851, 4145
850, 4305 850, 4305
779, 3934 779, 3934
766, 3011 766, 3011
737, 3828 737, 3828
711, 2919 711, 2919
696, 3351 696, 3351
694, 3882 694, 3882
687, 3672 687, 3672
623, 3035 623, 3035
618, 2729 618, 2729
616, 3089 616, 3089
587, 3399 587, 3399
580, 2514 580, 2514
568, 3089 568, 3089
551, 2824 551, 2824
510, 2558 510, 2558
504, 2664 504, 2664
Nicht mo- di
fi Modifi- zi zi
er er
te te
Fo Fo
rm rm
o o
n n
Tr Tr
op op
on on
in in
T T Aminosäuresequenz
482, 1738 482, 1738
474,2381 MPNL (SEQ ID NO: 38)
434, 1856 434, 1856
375, 1874 375, 1874
351, 1333 351, 1333
343, 1976 PNL
331, 1976 331, 1976
318, 2023 318, 2023
303, 1451 303, 1451
296, 1241 296, 1241
247, 1288 247, 1288
246, 1448 246, 1448
205, 0971 205, 0971
150,0583 150,0583
147, 1128 147, 1128
Durch die chymotrypsinspezifische Spaltung nach Aminosäure 74 entsteht bei der modifizierten Form von Troponin T ein kurzes Nicht-Epitop-Fragment aus drei Aminosäuren der Sequenz PNL mit der Masse 343,1976 [M+H]+. Bei der nicht modifizierten Form des Troponin T-Proteins entsteht dagegen bei gleichzei¬ tiger Spaltung nach Aminosäure 70 ein längeres Nicht-Epitop- Fragment mit der Sequenz MPNL (SEQ ID NO: 38) und der Masse 474,2381 [M+H]+. Erfolgt keine Spaltung durch Chymotrypsin nach Aminosäure 74, aber nach Aminosäure 87, so entsteht bei
der modifizierten Form von Troponin T das Nicht-Epitop- Fragment der Sequenz PNLVPPKI PDGERVDF (SEQ ID NO: 33)
(1.792,9591 [M+H]+), während bei der nicht modifizierten Form bei gleichzeitiger Spaltung nach Aminosäure 70 das Nicht- Epitop-Fragment der Sequenz MPNLVPPKI PDGERVDF (SEQ ID NO: 32) (1.923,9996 [M+H]+) entsteht. Erfolgt weder eine Spaltung nach Aminosäure 74 noch nach Aminosäure 87, aber nach Amino¬ säure 91, so entsteht bei der modifizierten Form von Troponin T ein Nicht-Epitop-Fragment der Sequenz PNLVPPKIPDGERVDFDDIH RKRM (SEQ ID NO: 31) (2.844,4937 [M+H]+). Bei der natürlichen Form entsteht bei gleichzeitiger Spaltung nach Aminosäure 70 ein Nicht-Epitop-Fragment der Sequenz MPNLVPPKIPDGERVDFDDI HRKRM (SEQ ID NO: 30) (2.975,5342 [M+H]+). 2. Spalten von Troponin T mit Trypsin
Nicht mo- di
fi Modifi- zi zi
er er
te te
Fo Fo
rm rm
vo vo
n n
Tr Tr
op op
on on
in in
T T Aminosäuresequenz
7.831,2366 MSDIEEVVEEYEEEEQEEAA
VEEQEEAAEEDAEAEAETEE TRAEEDEEEEEAKEAEDGPM EESKPKPR (SEQ ID NO: 39)
6.150,4589 MSDIEEVVEEYEEEEQEEAA
VEEQEEAAEEDAEAEAETEE TRAEEDEEEEEAK (SEQ ID NO : 40)
4.861,9646 MSDIEEVVEEYEEEEQEEAA
VEEQEEAAEEDAEAEAETEE TR (SEQ ID NO: 41)
Nicht mo- di
fi Modifi- zi zi
er er
te te
Fo Fo
rm rm
o o
n n
Tr Tr
op op
on on
in in
T T Aminosäuresequenz
4 .098, 8793 AEEDEEEEEAKEAEDGPMEE
SKPKPRSFMPNLVPPK (SEQ
ID NO: 42)
3 .477, 7140 EAEDGPMEESKPKPRSFMPN
LVPPKI PDGER (SEQ ID
NO: 43)
2 .988, 2898 AEEDEEEEEAKEAEDGPMEE SKPKPR
(SEQ ID NO: 44)
2 .810, 3851 EAEDGPMEESKPKPRSFMPN LVPPK
(SEQ ID NO: 45)
2 .794, 3980 SFMPNLVPPKI PDGERVDFD DIHR
(SEQ ID NO: 46)
2 .658, 3449 2 .658, 3449
2 .582, 3136 2 .582, 3136
2 .456, 2350 2 .456,2350
2 .438, 2067 2 .438,2067
2 .429, 2571 PNLVPPKI PDGERVDFDDIH R (SEQ
ID NO: 47)
2 .428, 2289 2 .428,2289
2 .383, 1816 2 .383, 1816
2 .310, 1118 2 .310, 1118
2 .300, 1339 2 .300, 1339
2 .168, 1458 2 .168, 1458
2 .079, 0756 2 .079, 0756
2 .040, 0508 2 .040, 0508
1 .992, 0872 1 .992, 0872
Nicht mo- di
fi Modifi- zi zi
er er
te te
Fo Fo
rm rm
o o
n n
Tr Tr
op op
on on
in in
T T Aminosäuresequenz
1.921, 0501 1 .921, 0501
1.911, 9559 1 .911, 9559
1.888, 9988 1 .888, 9988
1.852, 9560 1 .852, 9560
1.821, 9381 1 .821, 9381
1.820, 0137 1 .820, 0137
1.811, 9034 1 .811, 9034
1.796, 9363 SFMPNLVPPKIPDGER (SEQ ID NO:
48)
1.792, 9551 1 .792, 9551
1.724, 8611 1 .724, 8611
1.699, 7955 EAEDGPMEESKPKPR (SEQ ID NO:
49)
1.683, 8085 1 .683, 8085
1.663, 9125 1 .663, 9125
1.622, 8060 1 .622, 8060
1.596, 7661 1 .596, 7661
1.565, 8798 1 .565, 8798
1.560, 8605 1 .560, 8605
1.535, 8176 1 .535, 8176
1.438, 7689 1 .438, 7689
1 .431, 7954 PNLVPPKI PDGER (SEQ ID NO: 50)
1.331, 7416 1 .331, 7416
1.315, 7077 1 .315, 7077
1.307, 5121 AEEDEEEEEAK (SEQ ID NO: 51)
Nicht mo- di
f i Modif i - zi zi
er er
te te
Fo Fo
rm rm
o o
n n
Tr Tr
op op
on on
in in
T T Aminosäure sequenz
1.302, 7124 1.302, 7124
1.300, 6756 1.300, 6756
1.290, 7164 1.290, 7164
1.242, 6661 1.242, 6661
1.203, 6467 1.203, 6467
1.188, 5716 1.188, 5716
1.176, 6484 1.176, 6484
1.144, 5745 1.144, 5745
1.132, 6069 1.132, 6069
1.129, 6074 SFMPNLVPPK (SEQ ID NO: 52)
1.117, 5344 1.117, 5344
1.089, 5283 1.089, 5283
1.075, 5517 1.075, 5517
1.054, 5567 1.054, 5567
1.045, 5636 1.045, 5636
1.016, 4795 1.016, 4795
1.015, 5279 1.015, 5279
1.001, 5123 1.001, 5123
1.000, 5646 1.000, 5646
974, 5013 974, 5013
961, 5173 961, 5173
961, 4333 961, 4333
946, 5064 946, 5064
946, 4952 946, 4952
Nicht mo- di
f i Modif i - zi zi
er er
te te
Fo Fo
rm rm
o o
n n
Tr Tr
op op
on on
in in
T T Aminosäure sequenz
945, 5628 945, 5628
918, 5003 918, 5003
906, 5043 906, 5043
885, 5628 885, 5628
860, 4584 860, 4584
857, 5567 857, 5567
844, 4635 844, 4635
818, 4002 818, 4002
816, 5050 816, 5050
805, 3322 805, 3322
790, 4053 790, 4053
779, 3934 779, 3934
775, 4784 775, 4784
764, 4665 PNLVPPK (SEQ ID NO: 53)
757, 4679 757, 4679
746, 4308 746, 4308
732, 3635 732, 3635
731, 3682 731, 3682
729, 4617 729, 4617
691, 3919 691, 3919
690, 3053 690, 3053
689, 3689 689, 3689
686, 3467 686, 3467
678, 3933 678, 3933
Nicht mo- di
f i Modif i - zi zi
er er
te te
Fo Fo
rm rm
o o
n n
Tr Tr
op op
on on
in in
T T Aminosäure sequenz
660, 4151 660, 4151
631, 3886 631, 3886
617, 3253 617, 3253
601, 3668 601, 3668
590, 3620 590, 3620
575, 3623 575, 3623
563, 2970 563, 2970
533, 2678 533, 2678
532, 3453 532, 3453
475, 2874 475, 2874
461, 2830 461, 2830
447, 2674 447, 2674
432, 2565 432, 2565
419, 2612 419, 2612
417, 2204 417, 2204
407, 1959 407, 1959
404, 2503 404, 2503
403, 3027 403, 3027
403, 2663 403, 2663
403, 2299 403, 2299
402, 2572 402, 2572
333, 2132 333, 2132
333, 1921 333, 1921
303, 2139 303, 2139
Nicht mo- di
fi Modifi- zi zi
er er
te te
Fo Fo
rm rm
o o
n n
Tr Tr
op op
on on
in in
T T Aminosäuresequenz
294, 1812 294, 1812
291, 1663 291, 1663
289, 1619 289, 1619
276, 1666 276, 1666
276, 1554 276, 1554
275,2077 275,2077
246, 1560 246, 1560
218, 1499 218, 1499
204, 1342 204, 1342
175, 1189 175, 1189
147, 1128 147, 1128
Durch die trypsinspezifische Spaltung nach Aminosäure 78 ent¬ steht bei der modifizierten Form von Troponin T ein Nicht- Epitop-Fragment mit der Sequenz PNLVPPK (SEQ ID NO: 53) und der Masse 764,4665 [M+H]+. Dieses Fragment entsteht nur bei der modifizierten Form von Troponin T, das heißt bei Vorliegen des akuten Koronarsyndroms. Bei der nicht modifizierten Form von Troponin T entsteht durch die trypsinspezifische Spaltung an der gleichen Position und gleichzeitiger Spaltung nach Aminosäure 68, die in der modifizierten Form nicht vorhanden ist, ein Nicht-Epitop-Fragment der Sequenz SFMPNLVPPK (SEQ ID NO: 52) und der Masse 1.129,6074 [M+H]+. Wird die Schnittschnelle bei Aminosäure 78 von der Protease ausgelas¬ sen, aber nach Aminosäure 84 geschnitten, entsteht nur bei
der modifizierten Form von Troponin T ein Nicht-Epitop- Fragment der Sequenz PNLVPPKI PDGER (SEQ ID NO: 50)
(1.431,7954 [M+H]+), bei der nicht modifizierten Form dagegen bei gleichzeitiger Spaltung nach Aminosäure 68 ein Nicht- Epitop-Fragment der Sequenz SFMPNLVPPKIPDGER (SEQ ID NO: 48) (1.796,9363 [M+H]+). Wird nach den Aminosäuren 78 und 84 nicht geschnitten, aber nach Aminosäure 92, entsteht bei der modifizierten Form von Troponin T ein Nicht-Epitop-Fragment der Sequenz PNLVPPKI PDGERVDFDDIH R (SEQ ID NO: 47)
(2.429,2571 [M+H]+) und bei der nicht modifizierten Form bei gleichzeitiger Spaltung nach Aminosäure 68 ein Nicht-Epitop- Fragment der Sequenz SFMPNLVPPKIPDGERVDFD DIHR (SEQ ID NO: 46) (2.794, 3980 [M+H]+).
Claims
1. In-vitro Verfahren zur Diagnose von akutem Koronarsyndrom umfassend die Schritte:
a) Bereitstellen eines festen Trägers (1) mit mindestens einem Antikörper (2), an den mindestens ein kardiales Troponin-Protein (3) aus einer Probe (4) spezifisch gebunden ist;
b) Spalten des Troponin-Proteins (3) mit einem Enzym in mindestens ein an den Antikörper (2) gebundenes Epitop-
Fragment (6) und mindestens ein Nicht-Epitop-Fragment (7) ;
c) Auslesen des durch das Enzym spezifisch gespaltenen Nicht-Epitop-Fragments (7), und
d) Diagnostizieren des akuten Koronarsyndroms anhand des
Vorliegens und/oder Fehlens des enzymspezifischen Nicht- Epitop-Fragments (7) .
2. Verfahren nach Anspruch 1, dadurch gekennzeichnet, dass Schritt b) bei einer Temperatur von etwa 40°C bis etwa
55°C, vorzugsweise von etwa 50°C bis etwa 53°C, und/oder für etwa 2 Minuten bis etwa 10 Minuten, vorzugsweise etwa 3 Minuten bis etwa 5 Minuten, durchgeführt wird.
3. Verfahren nach Anspruch 1 oder 2, dadurch gekennzeichnet, dass nach Schritt b) das Epitop-Fragment (6) quantifi¬ ziert wird.
4. Verfahren nach einem der vorhergehenden Ansprüche, da- durch gekennzeichnet, dass das Troponin-Protein (3)
Troponin I und/oder Troponin T ist.
5. Verfahren nach einem der vorhergehenden Ansprüche, dadurch gekennzeichnet, dass das Auslesen des durch das En- zym spezifisch gespaltenen Nicht-Epitop-Fragments (7) mittels Massenspektrometrie erfolgt.
6. Verfahren nach einem der vorhergehenden Ansprüche, dadurch gekennzeichnet, dass ein erster und ein zweiter Antikörper mit unterschiedlichen Spezifitäten verwendet werden .
7. Verfahren nach Anspruch 6, dadurch gekennzeichnet, dass der erste Antikörper Troponin I und der zweite Antikörper Troponin T spezifisch bindet.
8. Kit zur Diagnose von akutem Koronarsyndrom umfassend einen festen Träger (1) mit mindestens einem ersten Antikörper und mindestens einem zweiten Antikörper, wobei die Antikörper jeweils unterschiedliche kardiale Troponin- Proteine spezifisch binden.
9. Verwendung von mindestens einem durch ein Enzym spezifisch gespaltenen Nicht-Epitop-Fragment (7) mindestens eines kardialen Troponin-Proteins (3) zur Diagnose von akutem Koronarsyndrom.
10. Verwendung von mindestens einem durch ein Enzym spezifisch gespaltenen Nicht-Epitop-Fragment (7) mindestens eines kardialen Troponin-Proteins (3) zum Nachweis von mindestens einer posttranslationalen Modifikation des Troponin-Proteins (3) .
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| DE201210223378 DE102012223378A1 (de) | 2012-12-17 | 2012-12-17 | In-vitro Verfahren und Kit zur Diagnose von akutem Koronarsyndrom |
| DE102012223378.4 | 2012-12-17 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2014095804A1 true WO2014095804A1 (de) | 2014-06-26 |
Family
ID=49876583
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/EP2013/076824 Ceased WO2014095804A1 (de) | 2012-12-17 | 2013-12-17 | In-vitro verfahren und kit zur diagnose von akutem koronarsyndrom |
Country Status (2)
| Country | Link |
|---|---|
| DE (1) | DE102012223378A1 (de) |
| WO (1) | WO2014095804A1 (de) |
Families Citing this family (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP3237910B1 (de) | 2014-12-23 | 2019-04-17 | Siemens Healthcare Diagnostics Inc. | Proteolytischer abbau und bestimmung von herz-troponin |
Citations (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2002023191A1 (en) * | 2000-09-12 | 2002-03-21 | University Of Sydney | Diagnostic assay |
| WO2002089657A2 (en) * | 2001-05-04 | 2002-11-14 | Biosite, Inc. | Diagnostic markers of acute coronary syndromes and methods of use thereof |
| US20050164317A1 (en) * | 1995-04-18 | 2005-07-28 | Biosite, Inc. | Novel methods for the assay of troponin I and T and complexes of troponin I and T and selection of antibodies for use in immunoassays |
| WO2010042126A1 (en) * | 2008-10-11 | 2010-04-15 | Nanosphere, Inc. | Methods and assays to assess cardiac risk and ischemia |
| WO2010073182A1 (en) * | 2008-12-22 | 2010-07-01 | Koninklijke Philips Electronics N.V. | Assay for troponin i using magnetic labels |
| US20110129818A1 (en) * | 2009-12-02 | 2011-06-02 | Abbott Laboratories | ASSAY FOR CARDIAC TROPONIN-T (cTnT) |
Family Cites Families (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| DE69633780T3 (de) * | 1995-04-18 | 2011-05-05 | Biosite Incorporated, San Diego | Verfahren zum assay von troponin i und t und komplexen von troponin i und t und auswahl von antikörpern zur verwendung in immunoassays |
| WO2004111654A2 (en) * | 2003-06-06 | 2004-12-23 | Ciphergen Biosystems, Inc. | Serum biomarkers in ischaemic heart disease |
| WO2005071421A1 (en) * | 2004-01-16 | 2005-08-04 | Ciphergen Biosystems, Inc. | Specific detection of troponin and modified forms of troponin |
| ES2367311T3 (es) * | 2004-04-15 | 2011-11-02 | University Of Florida Research Foundation, Inc. | Productos de degradación proteolítica de map-2 como biomarcadores de diagnóstico para las lesiones neurales. |
-
2012
- 2012-12-17 DE DE201210223378 patent/DE102012223378A1/de not_active Withdrawn
-
2013
- 2013-12-17 WO PCT/EP2013/076824 patent/WO2014095804A1/de not_active Ceased
Patent Citations (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20050164317A1 (en) * | 1995-04-18 | 2005-07-28 | Biosite, Inc. | Novel methods for the assay of troponin I and T and complexes of troponin I and T and selection of antibodies for use in immunoassays |
| WO2002023191A1 (en) * | 2000-09-12 | 2002-03-21 | University Of Sydney | Diagnostic assay |
| WO2002089657A2 (en) * | 2001-05-04 | 2002-11-14 | Biosite, Inc. | Diagnostic markers of acute coronary syndromes and methods of use thereof |
| WO2010042126A1 (en) * | 2008-10-11 | 2010-04-15 | Nanosphere, Inc. | Methods and assays to assess cardiac risk and ischemia |
| WO2010073182A1 (en) * | 2008-12-22 | 2010-07-01 | Koninklijke Philips Electronics N.V. | Assay for troponin i using magnetic labels |
| US20110129818A1 (en) * | 2009-12-02 | 2011-06-02 | Abbott Laboratories | ASSAY FOR CARDIAC TROPONIN-T (cTnT) |
Non-Patent Citations (2)
| Title |
|---|
| MARCUS MACHT ET AL: "Mass Spectrometric Mapping of Protein Epitope Structures of Myocardial Infarct Markers Myoglobin and Troponin T +", BIOCHEMISTRY, vol. 35, no. 49, 15 November 1996 (1996-11-15), pages 15633 - 15639, XP055109874, ISSN: 0006-2960, DOI: 10.1021/bi961727w * |
| MARTIN MÖCKEL ET AL: "The acute coronary syndrome diagnosis and prognostic evaluation by troponin I is influenced by the test system affinity to different troponin complexes", CLINICA CHIMICA ACTA, vol. 293, no. 1-2, 1 March 2000 (2000-03-01), pages 139 - 155, XP055109723, ISSN: 0009-8981, DOI: 10.1016/S0009-8981(99)00244-2 * |
Also Published As
| Publication number | Publication date |
|---|---|
| DE102012223378A1 (de) | 2014-06-18 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| DE69113273T2 (de) | Zellnekrosnachweis durch prüfung von spektrin und seine abbauprodukte. | |
| DE60317314T2 (de) | Verfahren und gerät für die identifikation und zuordnung von biomolekülen | |
| EP2437064B1 (de) | Biomarker für Leberentzündung | |
| EP1789803B1 (de) | Bestimmung von felinem und caninem probnp | |
| DE69019375T2 (de) | Verfahren zur detektion von knochen- und anderen bindegewebeerkrankungen bei menschen und tieren. | |
| EP1330655B1 (de) | Verfahren zur analyse von proteinen | |
| DE69606651T2 (de) | Test zur diagnose von demenz | |
| WO2014095804A1 (de) | In-vitro verfahren und kit zur diagnose von akutem koronarsyndrom | |
| EP1318406A1 (de) | Verwendung der Glycin-N-Acyl-Transferase (GNAT) für die Diagnose und Therapie von Entzündungserkrankungen und Sepsis | |
| CA2553172A1 (en) | Methods and system for the identification and characterization of peptides and their functional relationships by use of measures of correlation | |
| EP1133697B1 (de) | Verfahren zur modifikation und identifikation funktioneller stellen in proteinen | |
| DE69608683T2 (de) | Analytisches und therapeutisches mittel | |
| DE102005011421A1 (de) | Bestimmung von kurzkettiger SRL-Alkoholdehydrogenase (DHRS4) als Biomarker für Entzündungen und Infektionen | |
| DE10101792B4 (de) | Verfahren zum Nachweis von Pankreaskarzinom oder chronischer Pankreatitis und Verwendung von Antikörpern | |
| DE69928236T2 (de) | Peptid für die diagnose von schizophrenie | |
| WO2008064883A1 (de) | In vitro verfahren zur diagnose und frühdiagnose von neurodegenerativen erkrankungen | |
| Geng et al. | Use of surface enhanced laser desorption/ionization-time of flight mass spectrometry (SELDI-TOF MS) to study protein expression in a rat model of cocaine withdrawal | |
| DE10115083A1 (de) | Nachweis von Milchdrüsenentzündungen | |
| AT500613B1 (de) | Verfahren zur diagnostizierung neurodegenerativer störungen | |
| WO2000019207A2 (de) | Verfahren zur bestimmung von atrialem natriuretischem peptid (anp) | |
| WO2006037521A1 (de) | Bestimmung von gastrokine 1 (gkn1) als biomarker für entzündungen und infektionen | |
| DE102006041644B4 (de) | Verfahren zur Detektion von Modifikationen in einem Protein oder Peptid | |
| EP1784649B1 (de) | Polypeptidmarker zur diagnose von arteriosklerose | |
| DE102019115108B4 (de) | Gezielte protein-charakterisierung durch massenspektrometrie | |
| AT500564B1 (de) | Verfahren zur tumordiagnose |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 13811435 Country of ref document: EP Kind code of ref document: A1 |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| 122 | Ep: pct application non-entry in european phase |
Ref document number: 13811435 Country of ref document: EP Kind code of ref document: A1 |