WO2014079957A1 - Selektive inhibition der ethylensignaltransduktion - Google Patents

Selektive inhibition der ethylensignaltransduktion Download PDF

Info

Publication number
WO2014079957A1
WO2014079957A1 PCT/EP2013/074428 EP2013074428W WO2014079957A1 WO 2014079957 A1 WO2014079957 A1 WO 2014079957A1 EP 2013074428 W EP2013074428 W EP 2013074428W WO 2014079957 A1 WO2014079957 A1 WO 2014079957A1
Authority
WO
WIPO (PCT)
Prior art keywords
seq
amino acid
acid sequence
peptide
acid sequences
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/EP2013/074428
Other languages
English (en)
French (fr)
Inventor
Dr. Melanie M. A. BISSON
Prof. Dr. Georg GROTH
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Bayer CropScience AG
Original Assignee
Bayer CropScience AG
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Bayer CropScience AG filed Critical Bayer CropScience AG
Publication of WO2014079957A1 publication Critical patent/WO2014079957A1/de
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/415Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from plants
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/82Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
    • C12N15/8241Phenotypically and genetically modified plants via recombinant DNA technology
    • C12N15/8261Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield
    • C12N15/8262Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield involving plant development
    • C12N15/8266Abscission; Dehiscence; Senescence

Definitions

  • the present invention relates to a method for influencing the
  • Receptor protein ETR1 (Ethylene resistant 1) or its isoforms ERS1, ETR2, ERS2, EIN4 or homologous or orthologous proteins thereof.
  • the phytohormone ethylene affects numerous plant growth and growth factors
  • Transcriptome analyzes indicate that approximately 7% of all genes of a plant genome are regulated by ethylene (G. van Zhong, JK Bums, Profiling ethylene regulated gene expression in Arabidopsis thaliana by microarray analysis, Plant Mol. Bio! 53: 117-131, 2003 ).
  • Ethylene can be produced in the plant in all tissues from the amino acid methionine (Yang, NE Hoffman, Ethylene biosynthesis and its regulation in higher plants Annu Rev. Plant Physiol Plant Mol. Biol.
  • the rate of synthesis can vary widely depending on the state of development and tissue type or under the influence of stress.
  • the phytohormone also controls numerous physiological processes such as cell extension, flower development, leaf fall, apoptosis, senescence and fruit or seed maturation.
  • the controlled maturation of fruits from an agronomic point of view for organically grown foodstuffs is
  • ethylene plays an important role in the flowering time of flowering plants. By suppressing the ethylene formation leaves For example, the flowering time of cut flowers is significantly longer (MS Reid, MJ Wu, Ethylene and Flower Senescence, Plant Growth Regulation 11, 31-43, 1992).
  • the natural maturation process takes place in the plant through the endogenously formed ethylene in them.
  • the maturation process can also be triggered externally by exogenous ethylene supply or delayed by the suppression of natural ethylene production or the perception of ethylene by the plant.
  • the control of ethylene exposure is used, in particular, for the complete ripening or spoilage of harvested fruits during their
  • ethylene is also responsible for the withering of flowering plants, particularly cut flowers
  • control of ethylene exposure or perception of ethylene may also extend the flowering time of these plants.
  • Ethylene exposure is usually controlled by transporting fruit which has not fully matured, as well as its storage and transport at low temperatures and / or under protective gas such as nitrogen or carbon dioxide or its treatment with inhibitors of ethylene formation or perception of ethylene. In this way, fruits and vegetables can be over long distances without complete
  • ethylene biosynthesis in plants can be inhibited, for example, via the inactivation of genes involved in ethylene biosynthesis in transgenic plants (examples of such transgenic plants can be found in NA Kahn, Ethyiene Action in Plants, Springer Berlin, Heidelberg, New York, 2006, Table 8.1 a) on page 168).
  • Ethylene perception can also be inhibited by genetic alterations of the receptors in transgenic plants (examples of such transgenic plants can be found in NA Kahn, Ethyiene Action in Plants, Springer Berlin, Heidelberg, New York, 2006, Table 8.1 b) on pages 168 -169).
  • Another way to inhibit ethylene perception is to use ethylene antagonists.
  • the first ethylene analogues, which as well as the phytohormone trigger a triple response in seedlings were propylene, acetylene and
  • compound 1-methylcyclopropene (1-MCP) is sold under the trade name Ethylbioc for flowers and Smartfresh for edible products.
  • the present invention starting from the prior art in particular the task of providing a method for controlling the maturation process, the senescence process and / or the stress tolerance of plants and / or their fruits to provide, which preferably at least one of the disadvantages discussed above fixes known in the prior art method.
  • the object of the present invention is to provide a process in which post-harvest losses, that is, post-harvest spoilage of food, in particular before the consumer is reached, are reduced over the processes described in the prior art.
  • a method is to be provided which preferably provides effective control of the
  • Maturation process the senescence process and / or the stress tolerance to a variety of different plants, fruits and flowering plants has.
  • At least part of these objects are achieved, preferably all of these objects, by providing a compound selected from the group consisting of a peptide, a peptide mimetic and an aptamer, a means and / or a method for influencing the maturation process, the senescence process and / or the stress tolerance of plants and / or their fruits, as explained in more detail below.
  • Amino acid sequence SEQ ID NO: 2 the amino acid sequence SEQ ID NO: 3, a permutation of one of the amino acid sequences SEQ ID NO: 1 to SEQ ID NO: 3, a part of one of the amino acid sequences SEQ ID NO: 1 to SEQ ID NO: 3, which at least 4, preferably at least 5, more preferably at least 6 of the amino acids mentioned in SEQ ID NO: 1 to SEQ ID NO: 3, and a derivative of one of the amino acid sequences SEQ ID NO: 1 to SEQ ID NO: 3, that the
  • Peptide mimetic consists of a peptide backbone modified amino acid sequence which is selected from the group consisting of
  • Amino acid sequence SEQ ID NO: 1 the amino acid sequence SEQ ID NO: 2
  • Amino acid sequence SEQ ID NO: 3 a permutation of one of
  • compounds are excluded in which the peptide from an amino acid sequence of SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101 or SEQ ID NO: 102, and / or from a part of one of the amino acid sequences SEQ ID NO: 98 to SEQ ID NO: 102, which comprises at least 6 of the amino acids mentioned in SEQ ID NO: 98 to SEQ ID NO: 102 and / or from a derivative of the amino acid sequences SEQ ID NO: 98 to 102 and / or in which a peptide mimetic consists of an am
  • Peptide backbone modified amino acid sequence which is selected from the group consisting of SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101 and SEQ ID NO: 102, and / or in which Aptamer is prepared based on the peptide structure of a peptide, wherein the peptide is selected from the group consisting of SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100 SEQ ID NO: 101 and SEQ ID NO: 102.
  • Peptidomimetic an antibody and / or its fragments and an aptamer, characterized in that the peptide and / or the antibody and / or fragments thereof, the amino acid sequence SEQ ID NO: 103, or a part of
  • Amino acid sequence SEQ ID NO: 103 which at least 4, preferably at least 5, more preferably at least 6 of the amino acids mentioned in SEQ ID NO: 103 or comprises a derivative of the amino acid sequence SEQ ID NO: 103 or that the peptide mimetic has the peptide backbone modified amino acid sequence SEQ ID NO: 103 or a portion of the peptide backbone modified amino acid sequence SEQ ID NO: 103, which at least 4, preferably at least 5, especially preferably comprises at least 6 of the amino acids recited in SEQ ID NO: 103, or a derivative of the peptide backbone modified amino acid sequence SEQ ID NO: 103 comprises or the aptamer is prepared based on the target structure of a peptide, wherein the peptide is selected from the amino acid sequence SEQ ID NO: 103, a part of the amino acid sequence SEQ ID NO: 103 which comprises at least 4, preferably at least 5, more preferably at least 6 of the amino acids mentioned in SEQ ID NO: 103, and a derivative of
  • the peptide or antibody and / or its fragments comprises an amino acid sequence which is selected is selected from the group consisting of the amino acid sequence SEQ ID NO: 1, the amino acid sequence SEQ ID NO: 2, the amino acid sequence SEQ ID NO: 3, a permutation of one of the amino acid sequences SEQ ID NO: 1 to SEQ ID NO: 3, a part one of the amino acid sequences SEQ ID NO: 1 to SEQ ID NO: 3, which comprises at least 4, preferably at least 5, more preferably at least 6 of the amino acids mentioned in SEQ ID NO: 1 to SEQ ID NO: 3, and a derivative of one of the amino acid sequences SEQ ID NO: 1 to SEQ ID NO: 3 that the group consisting of the amino acid sequence SEQ ID NO: 1, the amino acid sequence SEQ ID NO: 2, the amino acid sequence SEQ ID NO: 3, a permutation of one of the amino acid sequences SEQ ID NO: 1 to SEQ ID NO: 3, a part one of the amino acid sequences SEQ ID NO: 1 to SEQ ID NO: 3, which
  • Peptide mimetic comprises at least one peptide backbone modified amino acid sequence selected from the group consisting of
  • Amino acid sequence SEQ ID NO: 1 the amino acid sequence SEQ ID NO: 2
  • amino acid sequence SEQ ID NO: 3 a permutation of one of
  • a peptide is selected from the amino acid sequence SEQ ID NO: 1, the amino acid sequence SEQ ID NO: 2, the amino acid sequence SEQ ID NO: 3, a permutation of the peptide
  • compounds are excluded in which the peptide or antibody and / or fragments thereof has an amino acid sequence of SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100 , SEQ ID NO: 101 or SEQ ID NO: 102, and / or a part of one of the
  • Amino acid sequences SEQ ID NO: 98 to SEQ ID NO: 102 which comprises at least 6 of the amino acids mentioned in SEQ ID NO: 98 to SEQ ID NO: 102 and / or comprises a derivative of the amino acid sequences SEQ ID NO: 98 to 102 and / or where a peptide mimetic is modified from one on the peptide backbone
  • An amino acid sequence is selected which is selected from the group consisting of SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101 and SEQ ID NO: 102, and / or in which an aptamer Based on the target structure of a peptide, wherein the peptide is selected from the group consisting of SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100 SEQ ID NO: 101 and SEQ ID NO: 102.
  • a means for influencing the maturation process, the senescence process and / or the stress tolerance of plants and / or their fruits comprising at least one compound which is selected from the group consisting of a peptide, a peptide mimetic, an aptamer, an antibody and / or its
  • Fragments characterized in that the peptide or the antibody and / or its fragments have the amino acid sequence SEQ ID NO: 103, a part of
  • Amino acid sequence SEQ ID NO: 103 which at least 4, preferably at least 5, more preferably at least 6 of the amino acids mentioned in SEQ ID NO: 103 or a derivative of the amino acid sequence SEQ ID NO: 103
  • the peptide mimetic comprises the peptide backbone modified amino acid sequence SEQ ID NO: 103, a portion of a peptide backbone modified amino acid sequence SEQ ID NO: 103, which is at least 4, preferably at least 5, especially preferably comprises at least 6 of the amino acids recited in SEQ ID NO: 103, or a derivative of a peptide backbone modified amino acid sequence SEQ ID NO: 103 or that the aptamer is prepared based on the target structure of a peptide, wherein the peptide is selected from the amino acid sequence SEQ ID NO: 103, a part of one of the amino acid sequences SEQ ID NO: 103, which
  • Amino acid sequence SEQ ID NO: 103 wherein, when the amino acid sequence SEQ ID NO: 103 comprises alanine at one position, none of the other amino acids of SEQ ID NO: 103 is alanine.
  • Insensitive 2 or an orthologous protein thereof with the receptor protein ETR1 (Ethylene resistant 1), its isoforms E S1, ETR2, ERS2, IN4 or homologous or orthologous proteins thereof by the interaction of a compound, which is selected from the group 'consisting of a Peptide, one
  • Amino acid sequence which is selected from the group consisting of the amino acid sequence SEQ ID NO: 1, the amino acid sequence SEQ ID NO: 2, the amino acid sequence SEQ ID NO: 3, a permutation of one of
  • amino acid sequence modified on the peptide backbone which is selected from the group consisting of the amino acid sequence SEQ ID NO: 1, the amino acid sequence SEQ ID NO: 2, the amino acid sequence SEQ ID NO: 3, a permutation of one of the amino acid sequences SEQ ID NO 1 to SEQ ID NO: 3, a part of one of the amirosanic acid sequences SEQ ID NO: 1 to SEQ ID NO: 3, which contains at least 4, preferably at least 5, particularly preferably at least 6, of SEQ ID NO: 1 to SEQ ID NO: 3 amino acids, and a derivative of one of the amino acid sequences SEQ ID NO: 1 to SEQ ID NO: 3 or the aptamer based on the target structure of a peptide is prepared, wherein the peptide is selected from the amino acid sequence SEQ ID NO: 1, the Amino acid sequence SEQ ID NO: 2, the amino acid sequence SEQ ID NO: 3, a permutation of one of
  • compounds are excluded in which the peptide or antibody and / or fragments thereof has an amino acid sequence of SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100 , SEQ ID NO: 101 or SEQ ID NO: 102, and / or a part of one of the
  • Amino acid sequences SEQ ID NO: 98 to SEQ ID NO: 102 which comprises at least 6 of the amino acids mentioned in SEQ ID NO: 98 to SEQ ID NO: 102 and / or comprises a derivative of the amino acid sequences SEQ ID NO: 98 to 102 and / or where a peptide mimetic is modified from one on the peptide backbone
  • An amino acid sequence is selected which is selected from the group consisting of SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101 and SEQ ID NO: 102, and / or in which an aptamer Based on the target structure of a peptide, wherein the peptide is selected from the group consisting of SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100 SEQ ID NO: 101 and SEQ ID NO: Likewise, these objects are achieved by providing a method for influencing the maturation process, the senescence process and / or the stress tolerance of plants and / or their fruits, characterized in that in the plants and / or fruits, the interaction of the protein E1N2 (Ethylene
  • Insensitive 2 or an orthologous protein thereof with the receptor protein ETR1 (Ethylene resistant 1), its isoforms ERS1, ETR2, ERS2, EIN4 or homologous or orthologous proteins thereof by the interaction of a compound selected from the group consisting of a peptide one
  • Peptide mimetic, an aptamer, an antibody and / or its fragments, small molecules and mixtures of these compounds with a contact domain of the ethylene receptor ETR1 or its isoforms ERS1, ETR2, ERS2, EIN4 or a homologous or orthologous protein thereof is inhibited, wherein the contact domain is that which interacts with EIN2 or an orthologous protein thereof and wherein the peptide, the antibody and / or its fragments at least one
  • Amino acid sequence SEQ ID NO: 103 a part of the amino acid sequence SEQ ID NO: 103, which comprises at least 4, preferably at least 5, more preferably at least 6 of the amino acids mentioned in SEQ ID NO: 103, or a derivative of the amino acid sequence SEQ ID NO: 103
  • the peptide mimetic comprises at least one amino acid sequence modified at the peptide backbone SEQ ID NO: 103, a part of the peptide backbone modified amino acid sequence SEQ ID NO: 103, which at least 4, preferably at least 5, more preferably at least 6 of the amino acids mentioned in SEQ ID NO: 103 or a derivative of the peptide backbone modified amino acid sequence of SEQ ID NO: 103 or the aptamer is prepared based on the target structure of a peptide, wherein the peptide is selected from the amino acid sequence SEQ ID NO: 103, a part of
  • Amino acid sequence SEQ ID NO: 103 which comprises at least 4, preferably at least 5, particularly preferably at least 6, of the amino acids mentioned in SEQ ID NO: 103, and a derivative of the amino acid sequence SEQ ID NO: 103, where if the amino acid sequence SEQ ID NO: 103 at one position comprises alanine, none of the other amino acids of SEQ ID NO: 103 is alanine.
  • the compound according to the invention, the agent according to the invention and the process according to the invention are effective in controlling the rearing process, the senescence process and / or the Stress tolerance in a variety of different plants, fruits and
  • control of ethylene exposure is used equivalently for influencing retraction processes, senescence processes and / or stress tolerance of plants and / or their fruits, in which case maturation processes include, in particular, complete suppression and / or
  • Suppression and / or delay of ripening is particularly present when the plants and / or their fruits at the time of acceptance by the
  • flowering plants means that the senescence process is delayed.
  • the senescence process is delayed.
  • the senescence process is delayed.
  • Senescence process in particular the extension of the flowering time of the treated plant according to the invention compared to the same plant, which was not treated according to the invention to understand.
  • influencing the stress tolerance as used in the context of the invention preferably means an improved adaptation of the morphological, physiological and biochemical state of the plants and / or their fruits to stress factors, in particular dryness, heat, cold , Flooding, salinity, mechanical irritation, injury or pathogen infection understood.
  • plant is used interchangeably in the present invention for the fruits of the plant, and in particular also for flowering plants,
  • this term includes all aboveground and subterranean parts and organs of the plant, such as shoot, leaf, flower and root, by way of example Leaves, needles, stems, stems, flowers, fruiting bodies, fruits and seeds, as well as roots, tubers and rhizomes
  • the plant parts also include crops and vegetative and generative propagation material such as cuttings, tubers, rhizomes, cuttings and seeds.
  • Compound inhibited which is selected from the group consisting of a peptide, a peptide mimetic, an aptamer, an antibody and / or its fragments, small molecules and mixtures of these compounds.
  • Mixtures of these compounds preferably comprise two of said compounds, but may also comprise more than two of the compounds. The following is the
  • the interaction-inhibiting compound Fragments, small molecules and mixtures of these compounds, also referred to as "the interaction-inhibiting compound”.
  • peptide is used in particular for an amino acid sequence of up to 100 amino acids, preferably up to 50 amino acids, most preferably up to 12, more preferably up to 10, most preferably up to 8 amino acids by the term peptides, preferably L-peptides comprising a sequence of L-amino acids.
  • peptide mimetic describes a low molecular weight compound whose essential structural elements are modeled on those of a peptide and which can thereby have similar biological activity to peptides, Preferably, the low molecular weight compound has a molecular weight of up to 11000 g / mol.
  • the low molecular weight compound has a molecular weight between 500 to 5000 g / mol, very particularly preferably from 1000 to 1500 g / mol,
  • peptide mimetics include D-peptides which have a sequence of D-
  • peptide mimetics include peptides whose backbones are chemically modified. Preferably, these have chemically modified on the backbone Peptides an optionally modified amino acid sequence of up to 100 amino acids, preferably up to 50 amino acids, most preferably up to 12, further preferably up to 10, most preferably up to 8 amino acids on.
  • the peptide index is particularly preferably replaced by a bioisosteric group.
  • peptide mimetics have an amino acid sequence structure in which at least one of the peptide backbones (* NHCO *) of the peptide backbone is selected by an isosteric group selected from the group consisting of * CH 2 -CH 2 *. * CO-0 *. * CHOH-CH 2 *, * CH 2 -0 *, * CH 2 -NH *, * CH 2 -S * . * CS-NH * and N- modified * N CO * - is replaced.
  • a modification of the peptide backbone may optionally additionally comprise a cyclization.
  • the term peptide mimetic also includes "peptoids" (N-substituted polyglycine) which have an amino acid sequence structure in which at least one of the peptide bonds ( * NHCO * ) of the peptide backbone is replaced by an N-modified * NRCO * group and where R corresponds to the amino acid side chain which in a corresponding peptide to the a carbon atom
  • the peptoids have a
  • peptoids have exclusively a structure analogous to a peptide, in which all peptide bonds are N-modified
  • the peptide mimetic is a peptoid.
  • aptamer refers to single- or double-stranded DNA or RNA oligonucleotides, which are characterized in particular in that they can bind specifically to a molecule via their 3D structure They can bind specifically to the contact domain of ETR1
  • SELEX Systematic Evolutton of Ligands by Exponential Enrichment
  • Tuerk, L. Gold Systematic evolution of ligands by exponential enrichment: RNA ligands to bacteriophage T4 DNA polymerase, Science 249, 505-510; 1990; DW Drolet, RD Jenison, DE Smith, D.
  • the target structure here can preferably be a peptide which is selected from the amino acid sequence SEQ ID NO: 1, the amino acid sequence SEQ ID NO: 2, the amino acid sequence SEQ ID NO: 3, the amino acid sequence SEQ ID NO: 4, a permutation of one of
  • Amino acid sequences SEQ ID NO: 1 to SEQ ID NO: 4 which comprises at least 4, preferably at least 5, more preferably at least 6 of the amino acids mentioned in SEQ ID NO: 1 to SEQ ID NO: 4, and a derivative of one of
  • Amino acid sequences SEQ ID NO: 1 to SEQ ID NO: 4 are presented. In this case, compounds are excluded in which the peptide from an amino acid sequence of SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101 or SEQ ID NO: 102, and / or from a part of a the amino acid sequences SEQ ID NO: 98 to SEQ ID NO: 102, which comprises at least 6 of the amino acids mentioned in SEQ ID NO: 98 to SEQ ID NO: 102 and / or from a derivative of the
  • Amino acid sequences SEQ ID NO: 98 to 102 consists.
  • the target structure is a peptide selected from the amino acid sequence SEQ ID NO: 103, a part of
  • Amino acid sequence SEQ ID NO: 103 which comprises at least 4, preferably at least 5, particularly preferably at least 6, of the amino acids mentioned in SEQ ID NO: 103, and a derivative of the amino acid sequence SEQ ID NO: 103, where if the amino acid sequence SEQ ID NO: 103 at one position comprises alanine, none of the other amino acids of SEQ ID NO: 103 is alanine.
  • the target structure is particularly preferably selected from the group consisting of an amino acid sequence SEQ ID NO: 103, SEQ ID NO: 104, SEQ ID NO: 105, SEQ ID NO: 106, SEQ ID NO: 107, SEQ ID NO: 108, a portion of the amino acid sequence SEQ ID NO: 103, SEQ ID NO: 104, SEQ ID NO: 105, SEQ ID NO: 106, SEQ ID NO: 107, SEQ ID NO: 108, which is at least 4, preferably at least 5, particularly preferred at least 6 of the amino acids mentioned in SEQ ID NO: 103 to SEQ ID NO: 108, and a derivative of one of the amino acid sequence SEQ ID NO: 103, SEQ ID NO: 104, SEQ ID NO: 105, SEQ ID NO: 106, SEQ ID NO: 107 and SEQ ID NO: 108, wherein if one of the amino acid sequences SEQ ID NO: 103, SEQ ID NO: 104, SEQ ID NO: 105, S
  • SEQ ID NO: 4 An amino acid sequence selected from the group consisting of SEQ ID NO: 4, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 111, SEQ ID NO: 112, SEQ ID NO: 113, SEQ ID NO: 114, SEQ ID NO: 115, SEQ ID NO: 116, SEQ ID NO: 117, SEQ ID NO: 118, SEQ ID NO: 119, SEQ ID NO: 120, SEQ ID NO: 121, SEQ ID NO: 122, SEQ ID NO: 123 and SEQ ID NO: 124.
  • an "antibody and / or its fragments” refers to a protein and / or its subsequence from the class of globulins
  • this monoclonal antibody and / or its fragments is directed against the domain of the EIN2 or an orthologous protein which is in contact with the contact domain of the ETR1
  • Very particular preference is given to the antibody and / or its fragment based on a peptide which is selected from the amino acid sequence SEQ ID NO: 1, the amino acid sequence SEQ ID NO: 2, the amino acid sequence SEQ ID NO: 3, the amino acid sequence SEQ ID NO: 4, a permutation of one of
  • Amino acid sequences SEQ ID NO: 1 to SEQ ID NO: 4 which comprises at least 4, preferably at least 5, more preferably at least 6 of the amino acids mentioned in SEQ ID NO: 1 to SEQ ID NO: 4, and a derivative of one of
  • compounds are excluded in which the antibody and / or its fragment has an amino acid sequence of SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101 or SEQ ID NO: 102, and / or a part of one of
  • Amino acid sequences SEQ ID NO: 98 to SEQ ID NO: 102 which comprises at least 6 of the amino acids mentioned in SEQ ID NO: 98 to SEQ ID NO: 102 and / or comprises a derivative of the amino acid sequences SEQ ID NO: 98 to 102.
  • the antibody and / or its fragment is prepared on the basis of a peptide which is selected from the amino acid sequence SEQ ID NO: 103, a part of the amino acid sequence SEQ ID NO: 103, which is at least 4, preferably at least 5, particularly preferred at least 6 of the amino acids mentioned in SEQ ID NO: 103, and a derivative of the
  • Amino acid sequence SEQ ID NO: 103 wherein, when the amino acid sequence SEQ ID NO: 103 comprises alanine at one position, none of the other amino acids of SEQ ID NO: 103 is alanine.
  • the antibody and / or its fragment are particularly preferably prepared on the basis of a peptide which is selected from the group consisting of an amino acid sequence SEQ ID NO: 103, SEQ ID NO: 104, SEQ ID NO: 105, SEQ ID NO: 106 , SEQ ID NO: 107, SEQ ID NO: 108 part of the group consisting of an amino acid sequence SEQ ID NO: 103, SEQ ID NO: 104, SEQ ID NO: 105, SEQ ID NO: 106 , SEQ ID NO: 107, SEQ ID NO: 108 part of the group consisting of an amino acid sequence SEQ ID NO: 103, SEQ ID NO: 104, SEQ ID NO: 105, SEQ ID NO: 106 , SEQ ID NO: 107, SEQ
  • Amino acid sequences SEQ ID NO: 103, SEQ ID NO: 104, SEQ ID NO: 105, SEQ ID NO: 106, SEQ ID NO: 107 or SEQ ID NO: 108 at one position comprises alanine, none of the other amino acids of the corresponding SEQ ID NO: Alanine is.
  • the antibody and / or its fragment is prepared on the basis of an amino acid sequence which is selected from the group consisting of SEQ ID NO: 4, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 111 , SEQ ID NO: 112, SEQ ID NO: 113, SEQ ID NO: 114, SEQ ID NO: 115, SEQ ID NO: 116, SEQ ID NO: 117, SEQ ID NO: 118, SEQ ID NO: 119, SEQ ID NO: 120, SEQ ID NO: 121, SEQ ID NO: 122, SEQ ID NO: 123 and SEQ ID NO: 124.
  • SEQ ID NO: 4 amino acid sequence which is selected from the group consisting of SEQ ID NO: 4, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 111 , SEQ ID NO: 112, SEQ ID NO: 113, SEQ ID NO: 114, SEQ ID NO: 115, SEQ ID NO: 116, SEQ ID NO:
  • small molecules are chemical ones
  • small molecules have similar physicochemical properties as the peptide SEQ ID NO: 4.
  • small molecules have similar physicochemical Properties such as a peptide selected from the group consisting of SEQ ID NO: 4, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 11 1, SEQ ID NO: 1 12, SEQ ID NO: 1 13, SEQ ID NO: 1 14, SEQ ID NO: 1 15, SEQ ID NO: 1 16, SEQ ID NO: 1 17, SEQ ID NO: 118, SEQ ID NO: 1 19, SEQ ID NO: 120, SEQ ID NO: 121, SEQ ID NO: 122, SEQ ID NO: 123 and SEQ ID NO: 124.
  • the small molecules have a positive partial charge or charge.
  • the small molecules have a net charge of +3 to +7, most preferably +4 to +6.
  • the small molecules have a net charge of +5.
  • they have a hydrophobicity of + 15, 7 Kcal / mol.
  • Electrostatic requirements based on the following homology model can be determined by comparative modeling with the program MODELER 9.11 (A.Sali & TL Blundell, Comparative protein modeling by satisfaction of spatial restraints, J.Mol., Biol., 234, 779-815, 1993) the basis of the crystal structure of the RNA-directed RNA polymerase (RCSB protein data bank: 4f5x.pdb) was created, which has an 87.5 percent match with SEQ ID NO: 4 in the sequence section 160-167 (see also Figure 8):
  • HELIX 8 8 LY S 2 ARG 7 1 6
  • An interaction may preferably be such that the interaction-inhibiting compound interacts with the ETR1 or its isoforms ERS1, ETR2, ERS2, EIN4 or a homologous or orthologous protein thereof.
  • the interaction inhibiting compound binds to ETR1 or one of its isoforms ERS1, ETR2, ERS2, EIN4, or a homologous or orthogenic protein thereof. In particular, this prevents the interaction with the retarded signal component EIN2 or an orthologous protein thereof.
  • Methods for determining whether a compound interacts with ETR1 or its isoforms ERS1, ETR2, ERS2, EIN4, or a homologous or orthologous protein thereof are known to those skilled in the art. In particular, this is the isothermal
  • thermosphoresis ASSAY and drug development technologies, 9 (201 1) 342-353. Another preferred method is the thermophoresis.
  • the antagonists used must have hydrophobic properties.
  • the known ethylene antagonists are usually poorly soluble in water, which is particularly the formulation of solutions for the treatment of plants and / or their
  • Water solubility of at least 1 g / L is advantageous. As a result, in particular the formulation of the treatment solution is much easier, since formulation based on water can be realized.
  • the interaction inhibiting compound is selected from the group consisting of a peptide
  • Peptidomimetic an antibody and / or its fragments and mixtures of these compounds.
  • Very particularly preferred is the interaction inhibiting A compound selected from the group consisting of a peptide, a
  • the peptide, the antibody and / or its fragments are an isolated partial sequence of the protein EIN2 or an orthologous
  • the peptide mimetic comprises a peptide backbone-modified, isolated partial sequence of the protein EIN2 or an orthologous protein thereof or a permutation of this partial sequence or a permutation thereof.
  • the term "isolated” in the sense of this invention means in particular that the subsequence of the EIN2 or the orthologous protein thereof naturally occurs in this protein but is provided in a modified form from this natural environment
  • the subsequence is particularly free of other proteins, particularly preferably the isolated partial sequence or permutation thereof modified on the peptide backbone thereof in a highly pure form of greater than 95% purity, more preferably higher provided as 99% purity.
  • a "permutation" of the amino acid sequence in the context of the invention means a permutation which is only pronounced to the extent that the resulting amino acid sequence has the same biological activity as the original sequence an orthologous protein thereof, or the sequences SEQ ID NOS: 1 to 4, which are referred to later, is preferred as the sequence of origin of one of the sequences of SEQ ID NO: 4, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO : 111, SEQ ID NO: 112, SEQ ID NO: 113, SEQ ID NO: 114, SEQ ID NO: 115, SEQ ID NO: 116, SEQ ID NO: 117, SEQ ID NO: 118, SEQ ID NO: 119 , SEQ ID NO: 120, SEQ ID NO: 121, SEQ ID NO: 122, SEQ ID NO: 123 or SEQ ID NO: 124.
  • a permutation of a sequence means that half, more preferably 2/3, entirely more preferably 3/4 and most preferably 90% of the amino acids over the Source sequence are not reversed.
  • the peptide, the antibody and / or its fragments comprises an isolated partial sequence or a permutation thereof which corresponds to the domain of EIN2 which interacts with the receptor protein ETR1 or the peptide mimetic comprises a peptide backbone modified, isolated partial sequence or a Permutation thereof, which corresponds to the domain of the EIN2 which interacts with the receptor protein ETR1.
  • the peptide, the antibody and / or its fragments comprises at least one amino acid sequence which is selected from the group consisting of the amino acid sequence SEQ ID NO: 1, the amino acid sequence SEQ ID NO: 2, the amino acid sequence SEQ ID NO: 3, a permutation of one of
  • Peptide mimetic comprises at least one amino acid modified on the peptide backbone, which is selected from the group consisting of
  • Amino acid sequence SEQ ID NO: 1 the amino acid sequence SEQ ID NO: 2
  • amino acid sequence SEQ ID NO: 3 a permutation of one of
  • compounds are excluded in which the peptide or antibody and / or its fragment has an amino acid sequence of SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100 , SEQ ID NO: 101 or SEQ ID NO: 102, and / or a part of one of the
  • Amino acid sequences SEQ ID NO: 98 to SEQ ID NO: 102 which comprises at least 6 of the amino acids mentioned in SEQ ID NO: 98 to SEQ ID NO: 102 and / or comprises a derivative of the amino acid sequences SEQ ID NO: 98 to 102.
  • compounds are excluded in which the peptide mimetic from an am
  • Peptide backbone modified amino acid sequence consists of which is selected of the group consisting of SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101 and SEQ ID NO: 102.
  • the peptide mimetic comprises one on the peptide backbone modified amino acid sequence which is selected from a part of one of the amino acid sequences SEQ ID NO: 98 to SEQ ID NO: 102, which comprises at least 6 of the amino acids mentioned in SEQ ID NO: 98 to SEQ ID NO: 102.
  • the peptide mimetic consists of an amino acid sequence modified on the peptide backbone which is selected from a derivative of the amino acid sequences SEQ ID NO: 98 to 102.
  • the peptide, the antibody and / or its fragments comprises at least one amino acid sequence which is selected from the group consisting of the amino acid sequence SEQ ID NO: 103, a part of
  • Amino acid sequence SEQ ID NO: 103 which comprises at least 4, preferably at least 5, particularly preferably at least 6, of the amino acids mentioned in SEQ ID NO: 103, and a derivative of the amino acid sequence SEQ ID NO: 103, where if the amino acid sequence SEQ ID NO: 103 at one position comprises alanine, none of the other amino acids of SEQ ID NO: 103 is alanine.
  • the peptide, the antibody and / or its fragments preferably comprise at least one amino acid sequence which is selected from the group consisting of the amino acid sequence SEQ ID NO: 103, a part of
  • Amino acid sequence SEQ ID NO: 103 which comprises at least 4, preferably at least 5, more preferably at least 6 of the amino acids mentioned in SEQ ID NO: 103, and a derivative of the amino acid sequence SEQ ID NO: 103, provided that when the amino acid sequence SEQ ID NO: 103 at one position comprises alanine, none of the other amino acids of SEQ ID NO: 103 is alanine, and provided that the positions identified by SEQ ID NO: 03 with No. 6 and No. 7 are present these are either either either arginine or both histidine.
  • the "position" of an amino acid means the site which is under counting when reading the sequence from left to right of the amino acids.
  • an octapeptide from left to right comprises positions 1 to 8.
  • alanine is mentioned at one position, this means that in the given SEQ ID, according to its definition, at least one amino acid can be alanine.
  • the sequence contains alanine at one site, it will not contain alanine as the amino acid at any other of the possible amino acids according to SEQ ID. This means that of the defined choices, the amino acid alanine can preferably be selected only once.
  • the peptide, the antibody and / or its fragments comprises at least one amino acid sequence which is selected from the group consisting of the amino acid sequence SEQ ID NO: 104, a part of
  • Amino acid sequence SEQ ID NO: 104 which comprises at least 4, preferably at least 5, particularly preferably at least 6, of the amino acids mentioned in SEQ ID NO: 104, and a derivative of the amirous acid sequence SEQ ID NO: 104, where, when the amino acid sequence SEQ ID NO: 104 at one position comprises alanine, none of the other amino acids of SEQ ID NO: 104 is alanine
  • the peptide, the antibody and / or its fragments comprises at least one amino acid sequence which is selected from the group consisting of the amino acid sequence SEQ ID NO: 104, a part of
  • Amino acid sequence SEQ ID NO: 104 which comprises at least 4, preferably at least 5, more preferably at least 6 of the amino acids mentioned in SEQ ID NO: 104, and a derivative of the amino acid sequence SEQ ID NO: 104, provided that when the amino acid sequence SEQ ID NO: 104 at a
  • the peptide, the antibody and / or its fragments comprises at least one amino acid sequence which is selected from the group consisting of the amino acid sequence SEQ ID NO: 105, a part of
  • Amino acid sequence SEQ ID NO: 105 which is at least 4, preferably at least 5, particularly preferably at least 6 of the amino acids mentioned in SEQ ID NO: 105 comprises »and a derivative of the amino acid sequence SEQ ID NO: 105, wherein » if the amino acid sequence SEQ ID NO: 105 comprises alanine at one position, none of the other amino acids of SEQ ID NO : 105 Alanin is.
  • the peptide, the antibody and / or its fragments comprises at least one amino acid sequence "is that selected from the group consisting of the amino acid sequence SEQ ID NO: 106, a portion of the
  • Amiriosäuresequenz SEQ ID NO: 106 which comprises at least 4, preferably at least 5, more preferably at least 6 of the amino acids mentioned in SEQ ID NO: 108 » and a derivative of the amino acid sequence SEQ ID NO: 106 » wherein when the amino acid sequence SEQ ID NO: 108 at one position comprises alanine, none of the other amino acids of SEQ ID NO: 106 is alanine.
  • the peptide, the antibody and / or its fragments comprises at least one amino acid sequence which is selected from the group consisting of the amino acid sequence SEQ ID NO: 107, a part of
  • Amino acid sequence SEQ ID NO: 107 which comprises at least 4, preferably at least 5, particularly preferably at least 8, of the amino acids mentioned in SEQ ID NO: 107, and a derivative of the amino acid sequence SEQ ID NO: 1087, where if the amino acid sequence SEQ ID NO: 107 at one position comprises alanine, none of the other amino acids of SEQ ID NO: 107 is alanine.
  • the peptide, the antibody and / or its fragments comprises at least one amino acid sequence which is selected from the group consisting of the amino acid sequence SEQ ID NO: 108 » a part of
  • Amino acid sequence SEQ ID NO: 108 comprising at least 4 " preferably at least 5, more preferably at least 6 of the amino acids mentioned in SEQ ID NO: 108, and a derivative of the amino acid sequence SEQ ID NO: 108, wherein when the amino acid sequence SEQ ID NO: 108 at one position comprises alanine, none of the other amino acids of SEQ ID NO: 108 is alanine.
  • the peptide, the antibody and / or its fragments comprise at least one amino acid sequence selected from the group consisting of consisting of SEQ ID NO: 4, SEQ ID NO: 109, SEQ ID NO: 1 10, SEQ ID NO: 11 1, SEQ ID NO: 1 12, SEQ ID NO: 1 13, SEQ ID NO: 1 14, SEQ ID NO: 1 15, SEQ ID NO: 1 16, SEQ ID NO: 1 17, SEQ ID NO: 1 18, SEQ ID NO: 1 19, SEQ ID NO: 120, SEQ ID NO: 121, SEQ ID NO: 122, SEQ ID NO: 123 and SEQ ID NO: 124, a permutation of one of the amino acid sequences SEQ ID NO: 4, SEQ ID NO: 109, SEQ ID NO: 1 10, SEQ ID NO: 1 1 1, SEQ ID NO: 1 12, SEQ ID NO: 1 13, SEQ ID NO: 1 14, SEQ ID NO: 1 15, SEQ ID NO: 1 16, SEQ ID NO: 1 17, SEQ ID NO: 1 18, SEQ ID NO: 1
  • the aptamer is prepared on the basis of the target structure of a peptide, wherein the peptide is selected from the amino acid sequence SEQ ID NO: 1, the amino acid sequence SEQ ID NO: 2, the amirous acid sequence SEQ ID NO: 3, a permutation of one of the amino acid sequences SEQ ID NO: 1 to SEQ ID NO: 3, a part of one of the amino acid sequences SEQ ID NO: 1 to SEQ ID NO: 3, which at least 4, preferably at least 5, particularly preferably at least 6 in SEQ ID NO: 1 to SEQ ID NO 3 amino acids, and a derivative of one of the amino acid sequences of SEQ ID NO: 1 to SEQ ID NO: 3.
  • an aptamer is prepared on the basis of the target structure of a peptide, wherein the peptide is selected from the A group consisting of SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100 SEQ ID NO: 101 and SEQ ID NO: 102.
  • an aptamer is prepared based on the target structure of a peptide
  • the peptide is selected from a part of one of the amino acid sequences SEQ ID NO: 98 to SEQ ID NO: 102, which at least 6 of the amino acids mentioned in SEQ ID NO: 98 to SEQ ID NO: 102, consists.
  • Preference is also given to compounds in which an aptamer based on the target structure of a peptide is prepared, the peptide consisting of a derivative of the amino acid sequences SEQ ID NO: 98 to 102.
  • the aptamer is prepared based on the target structure of a peptide, wherein the peptide is selected from the group consisting of the amino acid sequence SEQ ID NO: 103, a portion of the amino acid sequence SEQ ID NO: 103, which at least 4, preferably at least 5 , particularly preferably at least 6 of the amino acids mentioned in SEQ ID NO: 103, and a derivative of the amino acid sequence SEQ ID NO: 103, wherein, when the peptide is selected from the group consisting of the amino acid sequence SEQ ID NO: 103, a portion of the amino acid sequence SEQ ID NO: 103, which at least 4, preferably at least 5 , particularly preferably at least 6 of the amino acids mentioned in SEQ ID NO: 103, and a derivative of the amino acid sequence SEQ ID NO: 103, wherein, when the peptide is selected from the group consisting of the amino acid sequence SEQ ID NO: 103, a portion of the amino acid sequence SEQ ID NO: 103, which at least 4, preferably at least
  • Amino acid sequence SEQ ID NO: 103 at one position comprises alanine, none of the other amino acids of SEQ ID NO: 103 is alanine. Also preferred is the aptamer based on the target structure of a peptide
  • the peptide is selected from the group consisting of the amino acid sequence SEQ ID NO: 103, a part of the amino acid sequence SEQ ID NO: 103, which at least 4, preferably at least 5, more preferably at least 6 of the in SEQ ID NO: 103 amino acid sequence, and a derivative of the amino acid sequence SEQ ID NO: 103, provided that when the amino acid sequence SEQ ID NO: 103 comprises alanine at one position, none of the other amino acids of SEQ ID NO: 103 is alanine and of the
  • characterized positions are present, these are either both arginine or both histidine.
  • aptamer based on the target structure of a peptide
  • the peptide is selected from the group consisting of the amino acid sequence SEQ ID NO: 104, a part of the amino acid sequence SEQ ID NO: 104, which at least 4, preferably at least 5, particularly preferably at least 6 of the in SEQ ID NO: 104 amino acid sequence, and a derivative of the amino acid sequence SEQ ID NO: 104, wherein, when the amino acid sequence SEQ ID NO: 104, a part of the amino acid sequence SEQ ID NO: 104, which at least 4, preferably at least 5, particularly preferably at least 6 of the in SEQ ID NO: 104 amino acid sequence, and a derivative of the amino acid sequence SEQ ID NO: 104, wherein, when the amino acid sequence SEQ ID NO: 104, a part of the amino acid sequence SEQ ID NO: 104, which at least 4, preferably at least 5, particularly preferably at least 6 of the in SEQ ID NO: 104 amino acid sequence, and a derivative of the amino acid sequence SEQ ID NO: 104, wherein, when the amino acid sequence SEQ ID NO
  • Amino acid sequence SEQ ID NO: 104 at one position comprises alanine, none of the other amino acids of SEQ ID NO: 104 is alanine.
  • the aptamer is prepared based on the target structure of a peptide, wherein the peptide is selected from the group consisting of the amino acid sequence SEQ ID NO: 104, a portion of the amino acid sequence SEQ ID NO: 104, which at least 4, preferably at least 5 , more preferably at least 6 of the amino acids mentioned in SEQ ID NO: 104, and a derivative of the amino acid sequence SEQ ID NO: 104, provided that when the amino acid sequence SEQ ID NO: 104 at one position comprises alanine, none of the others Amino acids of SEQ ID NO: 104 is alanine, and provided that when the positions identified in SEQ ID NO: 104 with No. 6 and No. 7 are present, they are either both arginine or both histidine.
  • the aptamer is prepared based on the target structure of a peptide, wherein the peptide is selected from the group consisting of the amino acid sequence SEQ ID NO: 105, a portion of the amino acid sequence SEQ ID NO: 105, which at least 4, preferably at least 5 , particularly preferably at least 6 of the amino acids mentioned in SEQ ID NO: 105, and a derivative of the amino acid sequence SEQ ID NO: 105, wherein, when the peptide is selected from the group consisting of the amino acid sequence SEQ ID NO: 105, a portion of the amino acid sequence SEQ ID NO: 105, which at least 4, preferably at least 5 , particularly preferably at least 6 of the amino acids mentioned in SEQ ID NO: 105, and a derivative of the amino acid sequence SEQ ID NO: 105, wherein, when the peptide is selected from the group consisting of the amino acid sequence SEQ ID NO: 105, a portion of the amino acid sequence SEQ ID NO: 105, which at least 4, preferably at least
  • Amino acid sequence SEQ ID NO: 105 at one position comprises alanine, none of the other amino acids of SEQ ID NO: 105 is alanine.
  • the aptamer is prepared based on the target structure of a peptide, wherein the peptide is selected from the group consisting of the amino acid sequence SEQ ID NO: 106, a portion of the amino acid sequence SEQ ID NO: 106, which at least 4, preferably at least 5 , particularly preferably at least 6 of the amino acids mentioned in SEQ ID NO: 106, and a derivative of the amino acid sequence SEQ ID NO: 106, wherein, when the peptide is selected from the group consisting of the amino acid sequence SEQ ID NO: 106, a portion of the amino acid sequence SEQ ID NO: 106, which at least 4, preferably at least 5 , particularly preferably at least 6 of the amino acids mentioned in SEQ ID NO: 106, and a derivative of the amino acid sequence SEQ ID NO: 106, wherein, when the peptide is selected from the group consisting of the amino acid sequence SEQ ID NO: 106, a portion of the amino acid sequence SEQ ID NO: 106, which at least 4, preferably at least
  • Amino acid sequence SEQ ID NO: 106 at one position comprises alanine, none of the other amino acids of SEQ ID NO: 106 is alanine.
  • the aptamer is prepared based on the target structure of a peptide, wherein the peptide is selected from the group consisting of the amino acid sequence SEQ ID NO: 107, a portion of the amino acid sequence SEQ ID NO: 107, which comprises at least 4, preferably at least 5, more preferably at least 6 of the amino acids mentioned in SEQ ID NO: 107, and a derivative of the amino acid sequence SEQ ID NO: 107, wherein, when the peptide is selected from the group consisting of the amino acid sequence SEQ ID NO: 107, a portion of the amino acid sequence SEQ ID NO: 107, which comprises at least 4, preferably at least 5, more preferably at least 6 of the amino acids mentioned in SEQ ID NO: 107, and a derivative of the amino acid sequence SEQ ID NO: 107, wherein, when the peptide is selected from the group consisting of the amino acid sequence SEQ ID NO: 107, a portion of the amino acid sequence SEQ ID NO: 107, which comprises at least 4, preferably at least 5,
  • Amino acid sequence SEQ ID NO: 107 at one position comprises alanine, none of the other amino acids of SEQ ID NO: 107 is alanine.
  • the aptamer is prepared based on the target structure of a peptide, wherein the peptide is selected from the group consisting of the amino acid sequence SEQ ID NO: 108, a portion of the amino acid sequence SEQ ID NO: 108, which at least 4, preferably at least 5 , more preferably at least 6 of the amino acids mentioned in SEQ ID NO: 108, and a derivative of the amino acid sequence SEQ ID NO: 108, wherein, when the peptide is selected from the group consisting of the amino acid sequence SEQ ID NO: 108, a portion of the amino acid sequence SEQ ID NO: 108, which at least 4, preferably at least 5 , more preferably at least 6 of the amino acids mentioned in SEQ ID NO: 108, and a derivative of the amino acid sequence SEQ ID NO: 108, wherein, when the peptide is selected from the group consisting of the amino acid sequence SEQ ID NO: 108, a portion of the amino acid sequence SEQ ID NO: 108, which at least 4, preferably at least
  • Amino acid sequence SEQ ID NO: 108 at one position comprises alanine, none of the other amino acids of SEQ ID NO: 108 is alanine.
  • the aptamer becomes based on the target structure of a peptide
  • the peptide is selected from the group consisting of SEQ ID NO: 4, SEQ ID NO: 109, SEQ ID NO: 1 10, SEQ ID NO: 11, SEQ ID NO: 1 12, SEQ ID NO SEQ ID NO: 1,13, SEQ ID NO: 1,17, SEQ ID NO: 1,17, SEQ ID NO: 1,18, SEQ ID NO: 1,19, SEQ ID NO: 1.
  • SEQ ID NO: 4 SEQ ID NO: 109, SEQ ID NO: 1 10
  • SEQ ID NO: 11 SEQ ID NO: 1 12
  • SEQ ID NO SEQ ID NO: 1,13 SEQ ID NO: 1,17, SEQ ID NO: 1,17, SEQ ID NO: 1,18, SEQ ID NO: 1,19, SEQ ID NO: 1.
  • the aptamer is very particularly preferably produced on the basis of the target structure of a peptide, wherein the peptide is selected 'from the group consisting of SEQ ID NO: 4, a permutation of the amino acid sequence SEQ ID NO: 4, a portion of the amino acid sequence SEQ ID NO: 4, which comprises at least 4, preferably at least 5, more preferably at least 6 of the amino acids mentioned in SEQ ID NO: 4, and a derivative of the amino acid sequence SEQ ID NO: 4.
  • the peptide, the antibody and / or its fragments in addition to the at least one amino acid sequence mentioned at least 4 further, preferably at least 3 further, most preferably at least 2 further natural amino acids.
  • the term "comprising" means that the sequence of 4 further amino acids, preferably at least 3 further, most preferably at least 2 further, most preferably 2 further natural amino acids to those in the corresponding
  • a derivative of an amino acid sequence is preferably considered to be a compound which has an organic group which is different from an amino acid on at least one terminus, ie its C- and / or N-terminus of the sequence.
  • This organic group may preferably be RY- wherein R is a hydrophobic residue and Y is a spacer attached to the C and / or N-terminus. It is particularly preferred that the resulting derivative of the
  • R is preferably an aliphatic or aromatic, linear, branched or cyclic hydrocarbon radical which may optionally have alkenyl or alkynyl groups. Particularly preferably, the
  • the peptide mimetic is particularly a peptoid or D-peptide having a similar biological activity to an amino acid sequence selected from the group consisting of
  • Amino acid sequence SEQ ID NO: 1 the amino acid sequence SEQ ID NO: 2
  • amino acid sequence SEQ ID NO: 3 a permutation of one of
  • modified amino acid sequence which is selected from the group consisting of SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101 and SEQ ID NO: 102.
  • Preference is also given to compounds in which the peptide mimetic consists of an amino acid sequence modified on the peptide backbone, which is selected from a derivative of the amirous acid sequences SEQ ID NO: 98 to 102.
  • the peptide mimetic is in particular a peptoid or D-peptide which has a similar biological activity as a
  • Amino acid sequence which is selected from the group consisting of the amino acid sequence SEQ ID NO: 103, a part of the amino acid sequence SEQ ID NO: 103, which at least 4, preferably at least 5, more preferably at least 8 of the mentioned in SEQ ID NO: 103 Amino acid, and a derivative of the amino acid sequence of SEQ ID NO: 103, wherein, when the amino acid sequence SEQ ID NO: 103, a part of the amino acid sequence SEQ ID NO: 103, which at least 4, preferably at least 5, more preferably at least 8 of the mentioned in SEQ ID NO: 103 Amino acid, and a derivative of the amino acid sequence of SEQ ID NO: 103, wherein, when the
  • Amino acid sequence SEQ ID NO: 103 at one position comprises alanine, none of the other amino acids of SEQ ID NO: 103 is aianin.
  • the peptide mimetic preferably represents in particular a peptoid or D-peptide which have a similar biological activity to an amino acid sequence, which is selected from the group consisting of the amino acid sequence SEQ ID NO: 103, a part of the amino acid sequence SEQ ID NO: 103 which comprises at least 4, preferably at least 5, more preferably at least 8 of the amino acids mentioned in SEQ ID NO: 103, and a derivative of the amirous acid sequence SEQ ID NO: 103, with the proviso that when the amino acid sequence SEQ ID NO: 103 at one position comprises alanine, ' none of the other amino acids of SEQ ID NO: 103 is alanine and provided that when the positions indicated by SEQ ID NO: 103 are Nos. 6 and Nos. 7, these are either either either arginine or both histidine.
  • the peptide mimetic is, in particular, a peptoid or D-peptide which has a similar biological activity to an amino acid sequence
  • Amino acid sequence SEQ ID NO: 104 a part of the amino acid sequence SEQ ID NO: 104, which comprises at least 4, preferably at least 5, more preferably at least 6 of the amino acids mentioned in SEQ ID NO: 104, and a derivative of the amino acid sequence SEQ ID NO: 101 , where if the
  • Amino acid sequence SEQ ID NO: 101 at one position comprises alanine, none of the other amino acids of SEQ ID NO: 101 is alanine.
  • the peptide mimetic is, in particular, a peptoid or D-peptide which has a similar biological activity to an amino acid sequence
  • Amino acid sequence SEQ ID NO: 104 a part of the amino acid sequence SEQ ID NO: 104, which comprises at least 4, preferably at least 5, more preferably at least 6 of the amino acids mentioned in SEQ ID NO: 104, and a derivative of the amino acid sequence SEQ ID NO: 104 with the proviso that when the amino acid sequence of SEQ ID NO: 104 comprises alanine at one position, none of the other amino acids of SEQ ID NO: 104 is alanine and under the
  • the peptide mimetic is in particular a peptoid or D-peptide having a similar biological activity to an amino acid sequence selected from the group consisting of
  • Amino acid sequence SEQ ID NO: 105 a part of the amino acid sequence SEQ ID NO: 105 which comprises at least 4, preferably at least 5, more preferably at least 6 of the amino acids mentioned in SEQ ID NO: 105, and a derivative of the amirous acid sequence SEQ ID NO: 05 , where if the
  • Amino acid sequence SEQ ID NO: 05 at one position comprises alanine, none of the other amino acids of SEQ ID NO: 105 is alanine.
  • the peptide mimetic represents in particular a peptoid or D-peptide having a similar biological activity as an amino acid sequence selected from the group consisting of
  • Amino acid sequence SEQ ID NO. 106 a part of the amino acid sequence SEQ ID NO: 106, which comprises at least 4, preferably at least 5, more preferably at least 6 of the amino acids mentioned in SEQ ID NO: 106, and a derivative of the amino acid sequence SEQ ID NO: 106, wherein if
  • Amino acid sequence SEQ ID NO: 106 at one position comprises alanine, none of the other amino acids of SEQ ID NO: 106 is alanine.
  • the peptide mimetic represents in particular a peptoid or D-peptide having a similar biological activity as an amino acid sequence selected from the group consisting of
  • Amino acid sequence SEQ ID NO: 107 a part of the amino acid sequence SEQ ID NO: 107 which comprises at least 4, preferably at least 5, more preferably at least 6 of the amino acids mentioned in SEQ ID NO: 107, and a derivative of the amino acid sequence SEQ ID NO: 107 , where if the
  • Amino acid sequence SEQ ID NO: 107 at one position comprises alanine, none of the other amino acids of SEQ ID NO: 107 is alanine.
  • the peptide mimetic is in particular a peptoid or D-peptide which has a similar biological activity to an amino acid sequence
  • Amino acid sequence SEQ ID NO: 108 a part of the amino acid sequence SEQ ID NO: 108, which comprises at least 4, preferably at least 5, more preferably at least 6 of the amino acids mentioned in SEQ ID NO: 108, and a derivative of the amirous acid sequence SEQ ID NO: 108, wherein, if the
  • Amino acid sequence SEQ ID NO: 108 at one position comprises alanine, none of the other amino acids of SEQ ID NO: 108 is alanine.
  • the peptide mimetic represents a peptoid or D-peptide having a similar biological activity to an amino acid sequence
  • SEQ ID NO: 4 which is selected from the group consisting of SEQ ID NO: 4, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 11, SEQ ID NO: 112, SEQ ID NO: 113, SEQ ID NO: 114, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 117, SEQ ID NO: 118, SEQ ID NO: 1 19, SEQ ID NO: 120, SEQ ID NO: 121, SEQ ID NO: 122, SEQ ID NO: 123 and SEQ ID NO: 124, a permutation of one of the amino acid sequences SEQ ID NO: 4, SEQ ID NO: 109, SEQ ID NO: 1 10, SEQ ID NO: 11, SEQ ID NO: 1 12, SEQ ID NO: 1 13, SEQ ID NO: 114, SEQ ID NO: 1 15, SEQ ID NO: 116, SEQ ID NO: 117, SEQ ID NO: 1 18, SEQ ID NO: 119, SEQ ID NO: 120, SEQ ID NO: 121,
  • the amirous acid sequence SEQ ID NO: 1 may also be represented as sequence xx [PLVIF] [KR] [RKW] x [RK] [RK] [RK] [RK] [PL] xx
  • each x is any natural amino acid.
  • x preferably also contains natural, non-natural proteinogenic amino acids found in plants.
  • each x may be independently selected from the group consisting of alanine, arginine, asparagine, aspartic acid, cysteine, glutamine, glutamic acid, glycine, histidine, isoleucine, leucine, lysine, methionine, phenylalanine, proline, serine, threonine, tryptophan, Tyrosine, valine, citrulline, ornithine, ⁇ -acetyl-lysine, 3-aminopropionic acid ( ⁇ -alanine), aminobenzoic acid, 6-aminocaproic acid, aminobutyric acid, hydroxyproline, mercaptopropionic acid, 3-nitro-tyrosine, norleucine and pyroglutamic acid.
  • the square brackets of said sequence mean that the actual amino acid
  • amino acid sequence SEQ ID NO: 1 does not include an amino acid sequence which is selected from the group consisting of SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101 and SEQ ID NO: 102 ,
  • amino acid sequence SEQ ID NO: 2 can also be represented as x [PLVIF] [KR] [RKW] x [RK] [RK] [RK] [PL] x and the amino acid sequence SEQ ID NO: 3 also as
  • amino acid sequences SEQ ID NO: 2 and / or 3 include none
  • amino acid sequence selected from the group consisting of SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101 and SEQ ID NO: 102.
  • the peptide, the antibody and or its fragments at least one amino acid sequence which is selected from the group consisting of the amino acid sequence SEQ ID NO: 3, a permutation of
  • Amino acid sequence SEQ ID NO: 3 a part of the amino acid sequence SEQ ID NO: 3, which at least 4, preferably at least 5, more preferably at least 6 the amino acid mentioned in SEQ ID NO: 3, and a derivative of the amino acid mentioned in SEQ ID NO: 3, and a derivative of the amino acid mentioned in SEQ ID NO: 3.
  • amino acid sequences SEQ ID NO: 3 or that the peptide mimetic comprises at least one peptide backbone modified amino acid sequence which is selected from the group consisting of the amino acid sequence SEQ ID NO: 3, a permutation of the amino acid sequence SEQ ID NO: 3, a part of
  • Amino acid sequence SEQ ID NO: 3 which comprises at least 4, preferably at least 5, more preferably at least 6 of the amino acids mentioned in SEQ ID NO: 3, and a derivative of the amino acid sequences SEQ ID NO: 3.
  • the amino acid sequence SEQ ID NO: 3 no amirous acid sequence selected from the group consisting of SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101 and SEQ ID NO: 102
  • Amino acid sequence SEQ ID NO: 3 also no part of a Amiriosäuresequenz comprising at least 6 of the mentioned in SEQ ID NO: 98 to 102 amino acids. Further preferably, the peptide, the antibody and / or its fragments also do not comprise a derivative of the amino acid sequence SEQ ID NO: 98 to 102.
  • the aptamer is prepared on the basis of the target structure of a peptide, wherein the peptide is selected from the amino acid sequence SEQ ID NO: 3, a permutation of one of the amino acid sequence SEQ ID NO: 3, a part of one of the amino acid sequences SEQ ID NO: 3, which comprises at least 4, preferably at least 5, more preferably at least 6 of the amino acids mentioned in SEQ ID NO: 3, and a derivative of one of the amino acid sequence SEQ ID NO: 3
  • Amino acid sequences SEQ ID NO: 3 no amino acid sequence which is selected from the group consisting of SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101 and SEQ ID NO: 102 it prefers that
  • Amino acid sequence SEQ ID NO: 103 also does not comprise any part of an amino acid sequence which comprises at least 6 of the amino acids mentioned in SEQ ID NO: 98 to 102. Further preferably, the amino acid sequence SEQ ID NO: 3 also does not comprise a derivative of the amino acid sequence SEQ ID NO: 98 to 102.
  • the peptide consists of an amino acid sequence which is selected from the group consisting of the amino acid sequence SEQ ID NO: 3, a permutation of the amino acid sequence SEQ ID NO: 3, a part of the amino acid sequence SEQ ID NO: 3, which at least 4, preferably at least 5, more preferably at least 6 of the amino acids mentioned in SEQ ID NO: 3 and a derivative of the amino acid sequences of SEQ ID NO: 3 or that the peptide mimetic consists of a peptide backbone modified amino acid sequence selected from the group consisting of
  • Amino acid sequence SEQ ID NO: 3 a permutation of the amino acid sequence SEQ ID NO: 3, a part of the amino acid sequence SEQ ID NO: 3, which
  • amino acid sequence SEQ ID NO: 3 does not include an amino acid sequence which is selected from the group consisting of SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101 and SEQ ID NO: 102 and / or no part of an amino acid sequence which comprises at least 6 of the amino acids mentioned in SEQ ID NO: 98 to 102 and / or no derivative of the amino acid sequences SEQ ID NO: 98 to 102.
  • the interaction-inhibiting compound has the amino acid sequence SEQ ID NO: 4, a part of the amino acid sequence SEQ ID NO: 4 which comprises at least 4, preferably at least 5, particularly preferably at least 6 of the amino acids mentioned in SEQ ID NO: 4.
  • the amino acid sequence SEQ ID NO: 4 can also be represented by the sequence
  • amino acid sequences SEQ ID NO: 103 to 124 can be represented as follows:
  • LKRYKRRA SEQ ID NO: 124 In another aspect of the present invention is a compound
  • peptide which is selected from the group consisting of a peptide, a peptide mimetic and an aptamer, characterized in that the peptide consists of an amino acid sequence which is selected from the group consisting of the amino acid sequence SEQ ID NO: 1, the
  • Amino acid sequence SEQ ID NO: 2 the amino acid sequence SEQ ID NO: 3, a permutation of one of the amino acid sequences SEQ ID NO: 1 to SEQ ID NO: 3, a part of one of the amino acid sequences SEQ ID NO: 1 to SEQ ID NO: 3, which at least 4, preferably at least 5, more preferably at least 6 of the amino acids mentioned in SEQ ID NO: 1 to SEQ ID NO: 3, and a derivative of one of the amino acid sequences SEQ ID NO: 1 to SEQ ID NO: 3, that the
  • Peptide mimetic consists of a peptide backbone modified amino acid sequence which is selected from the group consisting of
  • Amino acid sequence SEQ ID NO: 1 the amino acid sequence SEQ ID NO: 2
  • amino acid sequence SEQ ID NO: 3 a permutation of one of
  • SEQ ID NO: 2 the amino acid sequence SEQ ID NO: 3, a permutation of one of the amino acid sequences SEQ ID NO: 1 to SEQ ID NO: 3, a part of one of
  • compounds are excluded in which the peptide from an amino acid sequence of SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101 or SEQ ID NO: 102, and / or from a part of one of the amino acid sequences SEQ ID NO: 98 to SEQ ID NO: 102, which comprises at least 6 of the amino acids mentioned in SEQ ID NO: 98 to SEQ ID NO: 102 and / or from a derivative of the amino acid sequences SEQ ID NO: 98 to 102 and / or in which a peptide mimetic consists of an am
  • Peptide backbone modified amino acid sequence which is selected from the group consisting of SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101 and SEQ ID NO: 102, and / or in which Aptamer is prepared based on the target structure of a peptide, wherein the peptide is selected from the group consisting of SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100 SEQ ID NO: 101 and SEQ ID NO: 102.
  • the compound is preferably isolated.
  • the connection is in the
  • the compound is provided in a highly pure form of greater than 95% purity, more preferably greater than 99% purity.
  • the ethylene signal chain has been studied in the model plant Arabidopsis thaliana.
  • the membrane protein "Ethylene insensitive 2" (EIN2) could be identified as a central element of this chain (J.M. Alonso, T. Hiryama, G.
  • Ethylene response sensor ERS1
  • Ethylene response sensor 2 ERS2
  • ethylene ethylene receptors identified in Arabidopsis thaliana insensitive 4 "(EIN4) (MM Bisson, G. Groth, New paradigm in ethylene signaling, Plant Signal & Behav 6: 164-166; 2011).
  • EIN4 MM Bisson, G. Groth, New paradigm in ethylene signaling, Plant Signal & Behav 6: 164-166; 2011.
  • EIN2 MM Bisson, G. Groth, New paradigm in ethylene signaling, Plant Signal & Behav 6: 164-166; 2011
  • EIN4 MM Bisson, G. Groth, New paradigm in ethylene signaling, Plant Signal & Behav 6: 164-166; 2011
  • the method of the present invention leads to a disruption of the signal transduction important interaction of the receptor protein ETR1 or its isoforms ERS1, ETR2, ERS2, EIN4 or a homologous or orthologous protein thereof with the protein EIN2 or an orthologous protein thereof ,
  • ETR1 or its isoforms ERS1, ETR2, ERS2, EIN4 or a homologous or orthologous protein thereof with the protein EIN2 or an orthologous protein thereof By interrupting this signal path according to the invention, it has been possible to influence the maturation process, senescence process and / or the stress tolerance of plants and / or their fruits.
  • Homologous and orthologous proteins are characterized as having the same biological activity in a different species as a particular protein (e.g., ETR1) in a particular species (e.g., Arabidopsis).
  • a "homologous protein” is understood as meaning a protein with significant structural homology to the protein ETR1, in particular an identity of more than 70%, preferably more than 75%, more preferably more than 80% and most preferably more than 90%. with the protein ETR1
  • BLAST Basic Local Alignment Search Tool
  • Lactuca sativa 78.83 SEQ ID NO: 16 GenBank: AAQ15122.1
  • Prunus salicina 84.82 SEQ ID NO: 23 GenBank: ABU68266.1
  • homologous proteins of the ETR1 selected from the group consisting of SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 24, SEQ ID NO: 25 » SEQ ID NO: 26, SEQ ID NO: 27, SEQ ID NO: 28,
  • orthologous protein is meant a protein that is the functional counterpart of another protein (ETR1 or EIN2) in another species. Sequence differences between the orthologs are the result of speciation. Methods for the identification of orthologous proteins are known in the art. Frequently, identification of orthologous proteins is based on the
  • OrthoMCL-DB querying a comprehensive multi-species collection of orthologue groups.
  • Inparanoid a comprehensive database of eukaryotic orthologs.Nucleic Acids Res, 33, D476; Wheeler.D.L., Barrett.T., Benson.D.A.,
  • Amino acid sequences selected from the group consisting of SEQ ID NO: 31, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO : 38, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 41, SEQ ID NO: 42, SEQ ID NO: 43, SEQ ID NO: 44, SEQ ID NO: 45, SEQ ID NO: 46 , SEQ ID NO: 47, SEQ ID NO: 48, SEQ ID NO: 49, SEQ ID NO: 50, SEQ ID NO: 51, SEQ ID NO: 52 and SEQ ID NO: 53.
  • Chlamydomonas reinhardtii SEQ ID NO: 52 NCBI Reference
  • the orthologous proteins of the ETR1 or its isoforms comprise an amino acid sequence selected from the group consisting of SEQ ID NO: 54, SEQ ID NO: 55, SEQ ID NO: 56, SEQ ID NO: 57, SEQ ID NO : 58, SEQ ID NO: 59, SEQ ID NO: 60, SEQ ID NO: 61, SEQ ID NO: 62, SEQ ID NO: 63, SEQ ID NO: 64, SEQ ID NO: 65, SEQ ID NO: 66 , SEQ ID NO: 67, SEQ ID NO: 68, SEQ ID NO: 69, SEQ ID NO: 70, SEQ ID NO: 71, SEQ ID NO: 72, SEQ ID NO: 73, SEQ ID NO: 74, SEQ ID NO: 75, SEQ ID NO: 76, SEQ ID NO: 77, SEQ ID NO: 78, SEQ ID NO: 79, SEQ ID NO: 70, SEQ ID NO: 71, SEQ ID NO: 72, SEQ ID
  • Prunus persica SEQ ID NO: 21 UniProtKB / Swiss-Prot:
  • Coffea canephora SEQ ID NO: 63 GenBank: ABL63474.1
  • Petunia x hybrida SEQ ID NO: 67 GenBank: AAL40901.1 Organism amino acid sequence deposit
  • Nicotiana tabacum SEQ ID NO: 27 UniProtKB / Swiss-Prot:
  • Phalaenopsis equestris SEQ ID NO: 83 GenBank: CAD91247.1
  • Oryza sativa SEQ ID NO: 86 GenBank: AAB72193.1
  • Triticum aestivum ERS SEQ ID NO: 91 GenBank: ADJ67795.1
  • Actinidia deliciosa ERS1 SEQ ID NO: 95 GenBank: ABY28263.1
  • the receptor protein ETR1 or its isoform ERS1, ETR2, ERS2, EIN4 or a homologous or orthologous protein thereof interacts with the EIN2 protein.
  • the region of the amino acid sequence of the ETR1 or its isoforms ERS1, ETR2, ERS2, EIN4, or a homologous or orthologous protein thereof which interacts with the EIN2 or an orthologous protein thereof is described in U.S. Pat This is occasionally also referred to as the contact domain of the ETRi which interacts with EIN2 or an orthologous protein thereof, or even just as the contact domain of the ETRi
  • ETR1 designates. Plants and / or their fruits
  • the plants of the method according to the invention are preferably selected from the group consisting of useful plants and ornamental plants. Their fruits are correspondingly preferably selected from the group consisting of the fruits of crops and ornamental plants.
  • crops refers to crops used as plants for the production of food, feed, fuel or for technical purposes. Ornamental plants are understood to be, in particular, annual and perennial plants such as cut flowers and / or their plant extracts.
  • the crops are selected from the group of the following:
  • Plant species triticale, durum (durum wheat), turf, vines, cereals, such as wheat, barley, rye, oats, rice, corn and millet; Beets, for example
  • Sugar beets and fodder beets Fruits, such as pome fruit, stone fruit and
  • Berry fruits such as apples, pears, plums, peaches, almonds, cherries and berries, eg. Strawberries, raspberries, blackberries or even mango, dates and figs;
  • Legumes such as beans, lentils, peas and soybeans;
  • Oil crops such as oilseed rape, mustard, poppy, olives, sunflowers, coconut,
  • Castor oil plants cocoa beans and peanuts; Cucurbits, for example squash, cucumbers and melons; Fiber plants, for example cotton, flax, hemp and jute; Citrus fruits, such as oranges, lemons, grapefruit and mandarins; Vegetables such as spinach, (head) salad, asparagus, cabbages, carrots, onions, tomatoes, potatoes and peppers; Laurel family, such as avocado, cinnamomum, camphor, or plants such as tobacco, nuts, coffee, eggplant, sugar cane, tea, pepper, vines, hops, bananas,
  • Natural rubber plants and ornamental plants such as flowers and shrubs. This list is not a limitation.
  • the plants are transgenic plants.
  • the transgenic plants can be selected from the group consisting of herbicide-tolerant plants, insect-resistant plants, plants with increased stress tolerance, plants, which altered the amount, quality and / or shelf life of the harvested product and / or altered
  • Plants or plant varieties obtained by plant biotechnology methods, such as genetic engineering which can be used in the process according to the invention are herbicidally tolerant plants, ie plants which have been made tolerant to one or more given herbicides. Such plants can be obtained either by genetic transformation or by selection of plants containing a mutation conferring such herbicide tolerance.
  • Herbicide-tolerant plants are, for example, glyphosate-tolerant plants, ie
  • glyphosate-tolerant plants can be obtained by transforming the plant with a gene encoding the enzyme 5-enolpyruvylshikimate-3-phosphate synthase (EPSPS).
  • EPSPS 5-enolpyruvylshikimate-3-phosphate synthase
  • Examples of such EPSPS genes are the AroA gene (mutant CT7) of the bacterium Salmonella typhimurium (Comai et al., Science (1983), 221, 370-371), the GP4 gene of the bacterium
  • Glyphosate-tolerant plants can also be obtained by expressing a gene coding for a glyphosate oxidoreductase enzyme as described in US 5,776,760 and US 5,463,175. Glyphosate-tolerant plants may also be obtained by expressing a gene encoding a glyphosate acetyltransferase enzyme as described in, e.g. WO 02/036782, WO 03/092360, WO 05/012515 and WO 07/024782. Glyphosate-tolerant plants can also be obtained by culturing plants containing the naturally occurring mutations of the above-mentioned genes, as described, for example, in WO 01/024615 or WO
  • herbicide-resistant plants are, for example, plants which have been tolerated to herbicides which inhibit the enzyme glutamine synthase, such as bialaphos, phosphinotricin or glufosinate.
  • Such plants can be obtained by expressing an enzyme which detoxifies the herbicide or a mutant of the enzyme glutamine synthase, which is resistant to inhibition.
  • an effective detoxifying enzyme is, for example, an enzyme suitable for
  • Phosphinotricin acetyltransferase encoded such as the bar or pat protein from Streptomyces species. Plants expressing an exogenous phosphinotricin acetyltransferase are described, for example, in US 5,561,236; US 5,648,477; US 5,646,024; US 5,273,894; US 5,637,489; US 5,276,268; US 5,739,082; US 5,908,810 and US 7,112,665. Further herbicide-tolerant plants are also plants tolerant to the herbicides which inhibit the enzyme hydroxyphenylpyruvate dioxygenase (HPPD).
  • HPPD hydroxyphenylpyruvate dioxygenase
  • the hydroxyphenylpyruvate dioxygenases are enzymes that catalyze the reaction in which para-hydroxyphenylpyruvate (HPP) is converted to homogentisate.
  • Plants tolerant of HPPD inhibitors may be treated with a gene encoding a naturally occurring resistant HPPD enzyme, or a gene encoding a mutant HPPD enzyme as described in WO 96/038567, WO 99/024585 and WO 99/1998 / 024586, are transformed.
  • Tolerance to HPPD inhibitors can also be achieved by transforming plants with genes encoding certain enzymes that allow the formation of homogentisate despite inhibition of the native HPPD enzyme by the HPPD inhibitor.
  • Such plants and genes are described in WO 99/034008 and WO 2002/36787.
  • the tolerance of plants to HPPD inhibitors can also be improved by transforming plants, in addition to a gene which codes for an HPPD-to-oxidant enzyme, with a gene which codes for a prephenate dehydrogenase enzyme, as described in WO 2004 / 024928 is described.
  • ALS acetolactate synthase
  • known ALS inhibitors include sulfonylurea, imidazolinone, triazolopyrimidines,
  • ALS Pyrimidyloxy (thio) benzoates and / or sulfonylaminocarbonyl-triazolinone herbicides. It is known that various mutations in the enzyme ALS (also known as
  • Acetohydroxy acid synthase known
  • Imidazolinones, sulfonylureas and / or sulfamoylcarbonyltriazolinones can be obtained by induced mutagenesis, selection in cell cultures in the presence of the herbicide or by mutation breeding, as for example for the soybean in US 5,084,082, for rice in WO 97/41218, for Sugar beet in US 5,773,702 and WO 99/057965, for salad in US 5,198,599 or for the sunflower in WO 2001/065922 is described.
  • Plants or plant varieties obtained by plant biotechnology methods such as genetic engineering), which may also be used in the method of the invention, are insect-resistant transgenic plants, i. Plants that have been made resistant to attack by certain target insects. Such plants can be obtained by genetic transformation or by selection of plants containing a mutation conferring such insect resistance.
  • an insecticidal crystal protein from Bacillus thuringiensis or an insecticidal portion thereof such as the insecticidal crystal proteins collected by Crickmore et al., Microbiology and Molecular Biology Reviews (1998), 62, 807-813, by Crickmore et al. (2005) in the Bacillus thuringiensis toxin nomenclature (online at: http: //www.lifesci.suspsex.ac.uk/Home/NeiLCrickmore/Bt/), or insecticidal portions thereof, e.g. Proteins of the cry protein classes CrylAb, CrylAc, Cry1F, Cry2Ab, Cry3Ae or Cry3Bb or insecticidal parts thereof; or
  • a crystal protein from Bacillus thuringiensis or a part thereof in the presence of a second, other crystal protein than Bacillus thuringiensis or a part thereof insecticidal, such as the binary toxin consisting of the crystal proteins Cy34 and Cy35 (Moellenbeck et al., Nat. Biotechnol. (2001), 19, 668-72; Schnepf et al., Applied Environment Microb. (2006) , 71, 1765-1774); or 3) an insecticidal hybrid protein comprising parts of two different insecticides of Bacillus thuringiensis crystal proteins, such as a hybrid of the proteins of 1) above or a hybrid of the proteins of 2) above, e.g.
  • the protein Cry1A.105 produced by the corn event MON98034 WO
  • Changes induced in the coding DNA during cloning or transformation such as the protein Cry3Bb1 in maize events MON863 or MON88017 or the protein Cry3A in the maize event MIR 604; or
  • a secreted protein from Bacillus thuringiensis or Bacillus cereus which acts in the presence of a second secreted protein from Bacillus thuringiensis or B. cereus insecticide, such as the binary toxin consisting of the proteins VIP1A and VIP2A (WO 94/21795); or 7) an insecticidal hybrid protein comprising parts of various secreted proteins of Bacillus thuringiensis or Bacillus cereus, such as a hybrid of the proteins of 1) or a hybrid of the proteins of 2) above; or 8) a protein according to any of items 1) to 3) above, in which some, in particular 1 to 10, amino acids have been replaced by another amino acid in order to achieve a higher insecticidal activity against a target insect species and / or the spectrum of the corresponding Extend target species and / or because of
  • insect-resistant transgenic plants in the present context also include any plant comprising a combination of genes encoding the proteins of any of the above classes 1 to 8.
  • an insect resistant plant contains more than one transgene encoding a protein of any one of the above 1 to 8 in order to extend the spectrum of the corresponding target insect species or to develop a protein
  • Plants or plant varieties obtained by methods of plant biotechnology, such as genetic engineering), which can also be used in the method according to the invention, are tolerant of abiotic stress factors.
  • Such plants can be obtained by genetic transformation or by selection of plants containing a mutation conferring such stress resistance.
  • Particularly useful plants with stress tolerance include the following: a. Plants which contain a transgene which have the expression and / or activity of the gene for the poly (ADP-ribose) polymerase (PARP) in the plant cells or
  • plants containing a stress tolerance enhancing transgene capable of reducing the expression and / or activity of the PARP-encoding genes of the plants or plant cells as described, for example, in WO 2004/090140; 80 c.
  • shelf life of the crop and / or altered characteristics of certain components of the crop such as:
  • WO 00/029030 WO 2006/033862, WO 2006/072603, WO 2002/034923, EP 06090134.5, EP 06090228.5, EP 06090227.7, EP 07090007.1, EP 07090009.7, WO 2001/14569, WO 2002/79410, WO 2003/33540, WO 2004/078983, WO 2001/19975, WO 95/26407, 81
  • Wildtype plants are modified without genetic modification. Examples are plants which produce polyfructose, in particular of the inulin and levan type, as described in EP 0663956, WO 96/001904, Wo 96/021023, WO 98/039460 and WO 99/024593, plants which are alpha-1 To produce 4-glucans, as in WO
  • Plants or plant varieties obtained by plant biotechnology methods, such as genetic engineering), which can also be used in the method according to the invention, are plants such as cotton plants with altered fiber properties. Such plants can be obtained by genetic transformation or by selection of plants containing a mutation conferring such altered fiber properties; These include: a) plants, such as cotton plants, which have an altered form of
  • Sucrose phosphate synthase as described in WO 2001/017333; d) plants such as cotton plants with an increased expression of
  • Sucrose synthase as described in WO 02/45485; e) plants such as cotton plants in which the timing of the passage control of the Plasmodesmen is changed at the base of the fiber cell, z. B. by
  • Plants or plant varieties obtained by plant biotechnology methods such as genetic engineering which can also be used in the method according to the invention are plants such as rapeseed or related Brassica plants with altered properties of the oil composition. Such plants can be obtained by genetic transformation or by selection of plants containing a mutation conferring such altered oil properties; These include: a) plants such as rape plants that produce high oleic acid oil, as described, for example, in US 5,969,169, US 5,840,946 or US 6,323,392 or US 6,063,
  • plants such as oilseed rape plants which produce low linolenic acid oil, as described in US 6,270,828, US 6,169,190 or US 5,965,755.
  • plants such as oilseed rape plants which produce oil with a low saturated fatty acid content, such as e.g. As described in US 5,434,283.
  • Particularly useful transgenic plants that may find application in the method of the invention are plants that contain transformation events, or a combination of transformation events, and that are listed, for example, in the files of various national or regional authorities.
  • YIELD GARD ® for example maize
  • Particularly useful transgenic plants which may be used in the present process are exemplary plants with one or more genes that encode one or more toxins are the transgenic plants which are sold under the following trade names , cotton, soya beans), KnockOut ® (for example maize), BiteGard ® (for example maize), BT-Xtra ® (for example maize), StarLink ® (for example maize), Bollgard ® (cotton), NuCOTN ® (cotton ), NuCOTN ® 33B (cotton), NatureGard® ® (for example maize), Protecta ® and Ne Leaf ® (potato).
  • Herbicide-tolerant plants to be mentioned are, for example, maize varieties, cotton varieties and
  • Plants that may be mentioned include the varieties sold under the name Clearfield ® (for example maize).
  • Process according to the invention treated with the interaction inhibiting compound for influencing their maturation process, their senescence process and / or their stress tolerance.
  • treatment includes all measures that lead to contact between these agents and at least one
  • the interaction-inhibiting compound of the present invention can be formulated in various ways, depending on which biological and / or chemical
  • formulation options come for example: wettable powders (WP), water-soluble powders (SP), water-soluble concentrates, emulsifiable concentrates (EC), emulsions (EW), such as oil in water and water in oil emulsions, sprayable solutions, suspension concentrates (SC), dispersions on oil or water-based, oil-miscible solutions, capsule suspensions (CS), dusts (DP), mordants, granules for litter application, granules (GR) in the form of micro, spray, elevator and adsorption granules,
  • Formulations microcapsules and waxes. These individual formulation types are known and will be known in principle
  • inert materials for example, in Watkins, Handbook of Insecticides Dust Diluents and Carriers, 2nd ed., Darland Books, Caldwell N.J., H.v. Olphen, "Introduction to Clay Colloid
  • Injectable powders are preparations which are uniformly dispersible in water and contain not only the interaction-inhibiting compound but also surfactants of an ionic and / or non-ionic type (wetting agent, dispersing agent), e.g.
  • polyoxyethylated alkylphenols polyoxethylated fatty alcohols, polyoxethylated
  • Fatty amines Fatty amines, fatty alcohol polyglycol ether sulfates, alkanesulfonates, alkylbenzenesulfonates, lignosulfonate sodium, 2,2 'dinaphthylmethane, 6,6' disulfonic acid sodium, dibutylnaphthalene sulfonic acid sodium or oleoylmethyltaurine acid.
  • the interaction inhibits Compounds, for example, in conventional apparatus such as hammer mills,
  • Dusts are obtained by milling the interaction inhibiting compound with finely divided solids, e.g. Talc, natural clays such as kaolin, bentonite and pyrophyllite, or diatomaceous earth.
  • finely divided solids e.g. Talc, natural clays such as kaolin, bentonite and pyrophyllite, or diatomaceous earth.
  • Suspension concentrates may be water or oil based. You can
  • Emulsions e.g. Oil-in-water emulsions (EW) can be prepared, for example, by means of stirrers, colloid mills and / or static mixers using aqueous organic solvents and optionally surfactants such as those described e.g. listed above for the other formulation types.
  • EW Oil-in-water emulsions
  • Granules can either inhibit by inhibiting the interaction
  • Compound be made on adsorptive, granulated inert material or by applying concentrates by means of adhesives, e.g. Polyvinyl alcohol, sodium poliyacrylic or mineral oils, on the surface of carriers such as sand, kaolinites or granulated inert material.
  • adhesives e.g. Polyvinyl alcohol, sodium poliyacrylic or mineral oils
  • Water-dispersible granules are generally prepared by the usual methods such as spray-drying, fluidized-bed granulation, plate granulation, mixing with high-speed mixers and extrusion without solid inert material.
  • the preparations according to the invention generally contain from 0.1 to 99% by weight, in particular from 0.1 to 95% by weight, of the compound inhibiting the interaction.
  • Spray powders the concentration is e.g. about 10 to 90% by weight, the remainder to 100% by weight consists of customary formulation constituents.
  • Concentrates may be the concentration of the interaction inhibiting compound about 1 to 90, preferably 5 to 80 wt.%.
  • Dust-like formulations contain from 1 to 30% by weight of the interaction-inhibiting compound, preferably most often from 5 to 20% by weight of the interaction-inhibiting compound.
  • Sprayable solutions contain from about 0.05 to 80, preferably from 2 to 50% by weight of the
  • Interaction inhibiting compound In the case of water-dispersible granules, the content of the compound inhibiting the interaction depends, in part, on whether the active compound is liquid or solid and which granulation aid!
  • the content of the interaction-inhibiting compound is, for example, between 1 and 95% by weight, preferably between 10 and 80% by weight.
  • formulations mentioned optionally contain the customary adhesive, wetting, dispersing, emulsifying, penetrating, preserving, antifreezing and solvent, filling, carriers and dyes, antifoams, evaporation inhibitors and the pH and viscosity-influencing agents.
  • the interaction inhibiting compound is applied in the form of an aqueous solution in the plants and / or fruits on the surface of the plants and / or fruits.
  • the interaction-inhibiting compound is sprayed or applied to the surface of the plants and / or fruits or that the plants and / or fruits are immersed in the aqueous solution of the interaction-inhibiting compound.
  • the interaction-inhibiting compound is sprayed or applied to the surface of the plants and / or fruits or that the plants and / or fruits are immersed in the aqueous solution of the interaction-inhibiting compound.
  • the interaction-inhibiting compound is sprayed or applied to the surface of the plants and / or fruits or that the plants and / or fruits are immersed in the aqueous solution of the interaction-inhibiting compound.
  • the interaction-inhibiting compound is sprayed or applied to the surface of the plants and / or fruits or that the plants and / or fruits are immersed in the aqueous solution of the interaction-inhibiting compound.
  • the interaction-inhibiting compound is sprayed or applied to the surface of the plants and / or fruits or that the plants and / or fruits are immersed in the
  • the present invention therefore further relates to a spray formulation of the interaction inhibiting compound for influencing the ripening process, the senescence process and / or the stress tolerance of plants and / or their fruits.
  • a spray formulation is described in more detail:
  • formulations for spray application are prepared in a known manner, e.g. by mixing the invention to be used, the interaction
  • extenders that is liquid solvents and / or solid carriers, optionally with the use -of surfactants, that is emulsifiers and / or dispersants and / or foam-forming agents.
  • surfactants that is emulsifiers and / or dispersants and / or foam-forming agents.
  • customary additives such as, for example, customary extenders and solvents or diluents, dyes, wetting agents, dispersants,
  • Emulsifiers, defoamers, preservatives, secondary thickeners, adhesives, gibberellins, and also water may optionally be used.
  • the preparation of the formulations is carried out either in suitable systems or before or during use.
  • Excipients which can be used are those which are suitable for imparting special properties to the composition itself or to preparations derived therefrom (for example spray mixtures), such as certain technical properties and / or special biological properties.
  • spray mixtures for example spray mixtures
  • typical aids are:
  • a diluent is particularly suitable water.
  • All formulations which can be used according to the invention may contain all wetting-promoting substances customary for the formulation of agrochemical active compounds.
  • Preferably used are alkylnaphthalene sulfonates, such as
  • Suitable dispersants and / or emulsifiers which may be present in the formulations which can be used according to the invention are all nonionic, anionic and cationic dispersants which are customary for the formulation of agrochemical active compounds.
  • Preferably usable are nonionic or anionic dispersants or mixtures of nonionic or anionic dispersants.
  • Particularly suitable nonionic dispersants are ethylene oxide-propylene oxide block polymers, alkylphenol polyglycol ethers and tristryrylphenol polyglycol ethers and their phosphated or sulfated derivatives.
  • Suitable anionic dispersants are in particular lignosulfonates,
  • Defoamers which may be present in the formulations which can be used according to the invention are all foam-inhibiting substances customary for the formulation of agrochemical active compounds.
  • Defoamers which may be present in the formulations which can be used according to the invention are all foam-inhibiting substances customary for the formulation of agrochemical active compounds.
  • Preferably usable are silicone defoamers and
  • Magnesium stearate Magnesium stearate.
  • Formulations all substances that can be used for such purposes in agrochemical agents be present.
  • Suitable secondary thickeners which may be present in the formulations which can be used according to the invention are all substances which can be used for such purposes in agrochemical compositions. Preference is given to cellulose derivatives, acrylic acid derivatives, xanthan, modified clays and finely divided
  • Suitable adhesives which may be present in the formulations which can be used according to the invention are all customary binders which can be used in pickling agents.
  • polyvinylpyrrolidone polyvinyl acetate
  • polyvinyl alcohol polyvinyl alcohol
  • Tylose polyvinyl acetate
  • More valuable additives may be fragrances, mineral or vegetable optionally modified oils, waxes and nutrients (also trace nutrients), such as salts of iron, manganese, boron, copper, cobalt, molybdenum and zinc.
  • Stabilizers such as cold stabilizers, antioxidants, light stabilizers or other chemical and / or physical stability improving agents may also be included.
  • the formulations generally contain between 0.01 and 98% by weight, preferably between 0.5 and 90%, of the interaction inhibiting compound.
  • a means for influencing the ripening process, the senescence process and / or the stress tolerance of plants and / or their fruits comprising at least one compound selected from the group consisting of a peptide, a peptide mimetic, an aptamer, an antibody and / or its fragments, characterized in that the peptide or antibody and / or its fragments comprises an amino acid sequence selected from the group consisting of the amino acid sequence SEQ ID NO: 1, the
  • Amino acid sequence SEQ ID NO: 2 the amino acid sequence SEQ ID NO: 3, a permutation of one of the amino acid sequences SEQ ID NO: 1 to SEQ ID NO: 3, a part of one of the amino acid sequences SEQ ID NO: 1 to SEQ ID NO: 3, which at least 4, preferably at least 5, more preferably at least 6 of the amino acids mentioned in SEQ ID NO: 1 to SEQ ID NO: 3, and a derivative of one of the amino acid sequences SEQ ID NO: 1 to SEQ ID NO: 3, that the
  • Peptide mimetic comprises at least one backbone modified amino acid sequence selected from the group consisting of
  • Amino acid sequence SEQ ID NO: 1 the amino acid sequence SEQ ID NO: 2
  • amino acid sequence SEQ ID NO: 3 a permutation of one of
  • SEQ ID NO: 2 the amino acid sequence SEQ ID NO: 3, a permutation of one of the amino acid sequences SEQ ID NO: 1 to SEQ ID NO: 3, a part of one of
  • Fragments an amino acid sequence of SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101 or SEQ ID NO: 102, and / or a part of one of Amino acid sequences SEQ ID NO: 98 to SEQ ID NO: 102, which comprises at least 6 of the amino acids mentioned in SEQ ID NO: 98 to SEQ ID NO: 102 and / or comprises a derivative of the amino acid sequences SEQ ID NO: 98 to 102 and / or in which a peptide mimetic is modified from a backbone on the peptide
  • Amino acid sequence which is selected from the group consisting of SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101 and SEQ ID NO: 102, and / or in which an aptamer Based on the target structure of a peptide, wherein the peptide is selected from the group consisting of SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100 SEQ ID NO: 101 and SEQ ID NO: 102.
  • Senescence process and / or the stress tolerance of plants and / or their fruits provided at least one compound which is selected from the group consisting of a peptide, a peptide mimetic, an aptamer, an antibody and / or its fragments, characterized in that Peptide or the antibody and / or fragments thereof has the amino acid sequence SEQ ID NO: 103, a part of the amino acid sequence SEQ ID NO: 103 which comprises at least 4, preferably at least 5, particularly preferably at least 6 of the amino acids mentioned in SEQ ID NO: 102, or a derivative of the amino acid sequence SEQ ID NO: 103, the peptide mimetic comprises the peptide backbone modified amino acid sequence of SEQ ID NO: 103, a part of the peptide backbone
  • modified amino acid sequence SEQ ID NO: 103 which comprises at least 4, preferably at least 5, more preferably at least 8 of the amino acids mentioned in SEQ ID NO: 103, or a derivative of a peptide backbone modified
  • Amino acid sequence SEQ ID NO: 103 at one position comprises alanine, none of the other amino acids of SEQ ID NO: 103 is alanine.
  • This agent can also comprise the above-described preferred embodiments of the compounds which are selected from the group consisting of the peptide according to the invention, the antibody according to the invention and / or its fragments, the peptide mimetic according to the invention, the aptamer according to the invention and combinations of these compounds according to the invention.
  • the agent is characterized in that it is the interaction of the protein EIN2 (Ethylene Insensitive 2) or an orthologous protein thereof with the receptor protein ETR1 (Ethylene resistant 1), its isoforms ERS1, ETR2, ERS2, EIN4 or homologous or orthologous proteins thereof by interacting with a contact domain of the ethylene receptor ETR1 or its isoforms ERS1, ETR2, ERS2, EIN4 or a homologous or orthologous protein thereof.
  • EIN2 Ethylene Insensitive 2
  • ETR1 Ethylene resistant 1
  • ERS1, ETR2, ERS2, EIN4 homologous or orthologous proteins thereof by interacting with a contact domain of the ethylene receptor ETR1 or its isoforms ERS1, ETR2, ERS2, EIN4 or a homologous or orthologous protein thereof.
  • the agent comprises at least one further compound which is suitable for influencing the ripening process, the senescence process and / or the stress tolerance of plants and / or their fruits. It is preferably an ethylene antagonist.
  • the agent additionally comprises at least one formulating agent which is selected from the group consisting of inert materials, surfactants, solvents and auxiliaries.
  • Embodiment 1 Method for Influencing the Ripening Process
  • Interaction of a compound selected from the group consisting of a peptide, a peptide mimetic and mixtures of these compounds with a contact domain of the ethylene receptor ETR1 or its isoforms ERS1, ETR2, ERS2, EIN4 or a homologous or orthologous protein thereof is inhibited, wherein the contact domain is that which interacts with EIN2 or an orthoiogenic protein thereof.
  • Figure 1 Representation of species having a protein homologous to ETR1, partially indicating the degree of agreement
  • Figure 2 Results of Example 1: Determination of in vitro ETR1-EIN2 interaction based on tryptophan fluorescence by the addition of NLSOP-1 (peptide capable of interacting with the contact domain of ETR1) and ROP-1 ⁇ Peptide with random amino acid sequence » as a control)
  • FIG. 3 Results of Example 2: Determination of the ETA1 and mCherry Labeled ETR1 in Planta FRET Efficiency of a GFP with Addition of NLSOP-1 (Peptide Capable of Interacting with the Contact Domain of the ETR1) and ROP-1 (FIG. Peptide with random amino acid sequence, as a control)
  • NLSOP-1 Arabidopsis using NLSOP-1 at different concentrations (peptide capable of interacting with the contact domain of ETR1) and ROP-1 (random amino acid peptide, control); * means: P ⁇ 0.005 compared to positive control (ACC only)
  • FIG. 5 Results of Example 5: Determination of the in vitro ETR1 -EIN2 interaction on the basis of the FRET efficiency of an Alexa Fluor 568-labeled EIN2 479 "1297 and an Alexa Fluor 488-labeled ETR1 with the addition of different peptides
  • FIG. 6 Results of Example 6: Determination of the in vitro ETR1-EIN2 interaction on the basis of the FRET efficiency of an Alexa Fluor 568-labeled E1N2 479 "1297 and an Alexa Fluor 488-labeled ETR1 with the addition of different sequence variants of the peptide SEQ ID NO: 4
  • FIG. 7 Results of example 7: Determination of the in vitro ETR1-E1N2 interaction on the basis of the FRET efficiency of an Alexa Fluor 568-labeled E1 2 479 "1297 and an Alexa Fluor 488-labeled ETR1 with the addition of different aptamer variants of the peptide SEQ ID NO: 4
  • FIG. 8 Representation of the homology model according to 4f5x.pdb (present in RCSB Protein Data Bank) (see also Table 1) Examples
  • NLSOP-1 nuclear localization signal octapeptide
  • ROP-1 random peptide
  • octapeptide contains a random sequence determined by ExPASy Random Protein Sequence Generator (http://web.expasy.org/randseq) and was used as a negative control.
  • ROP-1 has the amino acid sequence SEQ ID NO: 97, which corresponds to the sequence H 2 N-EFLYMSVN-COOH. The synthesis of both peptides was carried out by solid phase peptide synthesis using the device "Peptide Synthesizer 433A" from Applied Biosystems.
  • Expression vector is described in Bisson MMA, A. Bleckmann, S. Allekotte, G. Groth, EIN2, the central regulator of ethylene signaling, is localized at the ER membrane where it interacts with the ethylene receptor ETR1, Brachem J: 424, 1-6; 2009, and MMA Bisson, G. Groth, New insight in ethylene signaling: autokinase activity of ETR1 modulates the interaction of receptors and EIN2, Molecular Plant: 5,882-889, 2010.
  • the tryptophan fluorescence of the ETR1 was observed at 348 nm with an excitation wavelength of 295 nm.
  • the resulting quenching of the fluorescence was against the
  • Dissociation constant calculated using the program GraFit (Erithacus Software Ltd.). A curve fit was used, which underpins the model that there is a single bond part per interaction partner.
  • the dissociation constants given in FIG. 2 were characterized by three independent
  • Example 1 Wild type plants of Arabidopsis thaliana (Columbia ecotype) as described in M.M.A. Bisson, G.Groth, New insight in ethylene signaling: autokinase activity of ETR1 modulates the interaction of receptors and EIN2, Molecular Plant: 5,882-889, 2010.
  • the peptides of Example 1 were added to the agar at various concentrations before the seeds were planted.
  • the ethylene precursor used was 1-amino-cyano-propane-1-carboxylic acid (ACC).
  • ACC 1-amino-cyano-propane-1-carboxylic acid
  • hypocotyl growth of the plants was determined as a characteristic feature of the triple response.
  • hypocotyl length of a plant which in
  • Example 1 The influence of the NLSOP-1 peptide described in Example 1 on the inhibition of the ethylene response was investigated by the tomato maturation. For this, green, immature tomatoes were incubated with the peptide by two different treatment methods. The treated tomatoes and also untreated control tomatoes were stored in sample tubes sealed with aluminum foil for up to 20 days at room temperature in a windowless, dark room. The maturation process was documented at different times with a digital camera.
  • a tomato was once coated with a 200 ⁇ NLSOP-1 solution (dissolved in ultrapure water) using a brush.
  • a tomato was immersed for about 30 minutes in a 200 ⁇ NLSOP-1 solution (dissolved in ultrapure water).
  • Example 2 In addition to Example 1, to demonstrate interference with the interaction of EIN2 and ETR1, additional peptides were synthesized which included a region suitable for interaction with ETR1.
  • YSOP-4 LKRLSRRL-100 8 1041, 7 -0,850 12,3
  • EIN2 479 "1294 which has the carboxy-terminal portion of the protein (amino acid 479-1294) according to MMA bites, Bleckmann A, Allekotte S & Groth G (2009) EIN2, the central regulator of ethylene signaling, is localized at the ER ETR1, Biochem J. 424, 1-6 isolated from Arabidopsis thaliana, cloned, heterologously expressed and isolated in Escherichia coli
  • the ETR1 protein was labeled with Alexa Fluor 488 as donor dye and the EIN2 479 "1294 with Alexa Fluor 588 labeled as acceptor dye (both dyes are commercially available from Molecular Probes, Inc. and known to those skilled in the art).
  • Protein labeling was carried out in a buffer system according to the manufacturer's instructions (50 mM potassium phosphate pH 8.0, 300 mM NaCl, 0.1% ⁇ -dodecyimaltoside, 0.002% RMSF).
  • the degree of fabling was calculated photometrically.
  • the labeled proteins were used for the following FRET test when a protein: dye ratio of 1: 1 was achieved.
  • Protein complex mixed.
  • the protein complex solution was transformed into a white 384
  • Microtiter plate and fluorescence was determined using an Infinite M200pro microtiter plate reader (Tecan GmbH, Craislheim, Germany).
  • the donor fluorescence was excited at 455 nm and the acceptor emission was measured at a wavelength between 570 nm and 650 nm.
  • the formation of the ETR1-EiN2 complex led to a Förster transfer between the donor and the acceptor dye. As a result, an increased acceptor emission could be observed.
  • FIG. 5 shows the results of the measurement of the different compounds at a final concentration of 0.1 mM of the respective peptide (the percentage decrease in acceptor fluorescence is shown in comparison to a solution without addition of a peptide).
  • octapeptides according to the invention that they are particularly suitable as a drug molecule to inhibit the complex formation between ETR1 and EIN2.
  • Example 5 To analyze the inhibition of ETR1 -EIN2 complex formation, the FRET-based in vitro method described in Example 5 was used. The peptides were used in the assay at a concentration of 100 ⁇ , since this corresponded to the IC50 value for the inhibition of ETR1 -EIN2 interaction by the starting peptide NLSOP-1 (SEQ ID NO: 4). The negative control used was the peptide ROP-1 (SEQ ID NO: 97).
  • Example 7 In vitro interaction study of EIN2 and ETR1 aptamer variants Two aptamer variants of the peptide of SEQ ID NO: 4 were prepared and examined for their effect on the interaction of ERT1 and EIN2 using the FRET-based in vitro test system described in Example 5 , (Here, in measuring the effect of the aptamers, the ETR1 -EIN2 protein complex was first incubated with the respective compound at a final concentration of 0.03 mM for 10 min at room temperature). As a basis for the aptamer was thioredoxin A from E. coli with the sequence (MSDKIIHLTD DSFDTDVLKA DGAILVDFWA EWCGPCKMIA
  • Both aptamer variants were heterologously expressed in E. coli and released from the
  • Trx thioredoxin A
  • Example 8 Inhibition of the Ethylene Response in Tomatoes - Other Peptides
  • the influence of the peptides described in Examples 5 and 6 on the inhibition of the ethylene response was investigated by the tomato maturation.
  • green, immature tomatoes were incubated by the application method 1 with the peptide.
  • a total of three series of measurements were carried out.
  • the visually determined results of a series of measurements (color of the tomatoes) at the different times were averaged and these results can be summarized as follows (visual description of the color of the tomato, scale from green to yellow to red and dark red, where red represents a ripe tomato) :
  • Table 8 Results of the visual description of the color of the treated tomatoes

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Molecular Biology (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Biophysics (AREA)
  • Biotechnology (AREA)
  • General Engineering & Computer Science (AREA)
  • General Health & Medical Sciences (AREA)
  • Biomedical Technology (AREA)
  • Biochemistry (AREA)
  • Wood Science & Technology (AREA)
  • Zoology (AREA)
  • Physics & Mathematics (AREA)
  • Microbiology (AREA)
  • Plant Pathology (AREA)
  • Cell Biology (AREA)
  • Botany (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Medicinal Chemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Peptides Or Proteins (AREA)

Abstract

Die Erfindung betrifft ein Peptid, Peptidmimetikum, einen Antikörper und/oder dessen Fragmente, ein Aptamer sowie kleine Moleküle, ein Mittel und ein Verfahren zur Beeinflussung des Reifungsprozesses, des Seneszenzprozesses und/oder der Stresstoleranz von Pflanzen und/oder ihrer Früchte, durch die Hemmung der Interaktion des Proteins EIN2 (Ethylene Insensitive 2) oder eines orthologen Proteins davon mit dem Rezeptorprotein ETR1 (Ethylene resistant 1) seiner Isoformen ERS1, ETR2, ERS2, EIN4 oder homologen oder orthologen Proteinen davon durch eine die Interaktion hemmende Verbindung.

Description

SELEKTIVE INHIBITION DER ETHYLENSIGNALTRANSDUKTION
Beschreibung
Die vorliegende Erfindung betrifft ein Verfahren zur Beeinflussung des
Reifungsprozesses, des Seneszenzprozesses und/oder der Stresstoleranz von Pflanzen und/oder ihrer Früchte durch die Hemmung der Interaktion des Proteins EIN2 (Ethylene Insensitive 2) oder eines orthologen Proteins davon mit dem
Rezeptorprotein ETR1 (Ethylene resistant 1 ) oder seiner Isoformen ERS1 , ETR2, ERS2, EIN4 oder homologen oder orthologen Proteinen davon. Das Phytohormon Ethylen beeinflusst zahlreiche pflanzliche Wachstums- und
Entwicklungsprozesse. Transkriptomanalysen zeigen, dass etwa 7 % aller Gene eines pflanzlichen Genoms durch Ethylen reguliert werden (G. van Zhong, J.K. Bums, Profiling ethylene regulated gene expression in Arabidopsis thaliana by microarray analysis, Plant Mol. Bio!. 53: 117-131 ; 2003). Ethylen kann in der Pflanze in allen Geweben aus der Aminosäure Methionin gebildet werden (S. F. Yang, N. E. Hoffman, Ethylene biosynthesis and its regulation in higher-plants. Annu. Rev. Plant Physiol. Plant Mol. Biol. 35: 155-189; 1984; G. E. Schaller, J. J. Kieber, Ethylene. In CR Somerville, EM Meyerowitz, eds, The Arabidopsis Book. American Society of Plant Biologists, Rockville, MD; 2002; B. S. Chauhan, Principles of Biochemistry and
Biophysics, Laxmi Publications, p370; 2008), wobei die Syntheserate in Abhängigkeit von Entwicklungszustand und Gewebetyp oder unter dem Einfluss von Stress stark variieren kann. Neben der Anpassung der Pflanze an wechselnde Umweltbedingungen als Antwort auf Trockenheit, Hitze, Kälte, Überflutung, mechanischen Reiz, Verletzung oder Pathogen-Infektion steuert das Phytohormon auch zahlreiche physiologische Prozesse wie beispielswiese die Zellstreckung, Blütenentwicklung, Blattfall, Apoptose, Seneszenz und Frucht- oder Samenreifung. Von diesen vielfältigen Prozessen, die durch das Phytohormon vermittelt werden, ist die kontrollierte Reifung von Früchten aus agrarökonomischer Sicht für biologisch angebaute Nahrungsmittel der
bedeutendste Prozess. Ebenso spielt Ethylen für die Lebens- bzw. Blühdauer von Blühpflanzen eine bedeutende Rolle. Durch Unterdrückung der Ethylenbildung lässt sich beispielsweise die Blühdauer von Schnittblumen deutlich verlängern (M. S. Reid, M-J. Wu, Eth lene and flower senescence. Plant Growth Regulation 11 , 31-43; 1992).
Der natürliche Reifungsprozess findet in der Pflanze durch das in ihnen endogen gebildete Ethylen statt. Allerdings kann der Reifungsprozess auch gezielt von außen durch exogene Ethylenzufuhr ausgelöst werden oder durch die Unterdrückung der natürlichen Ethylenbildung oder der Ethyienwahrnehmung durch die Pflanze verzögert werden. Die Kontrolle der Ethylenexposition wird insbesondere dazu genutzt, die vollständige Reifung bzw. das Verderben geernteter Früchte während ihres
Transportes und ihrer Lagerung zu verhindern. Da Ethylen auch für das Verwelken von Blühpflanzen, insbesondere von Schnittblumen verantwortlich ist, kann durch eine Steuerung der Ethylenexposition oder Ethyienwahrnehmung auch die Blühdauer dieser Pflanzen verlängert werden. Eine Kontrolle der Ethylenexposition erfolgt üblicherweise durch den Transport von nicht vollständig ausgereiften Früchten, sowie deren Lagerung und Transport bei tiefen Temperaturen und/oder unter Schutzgas wie Stickstoff oder Kohlendioxid oder ihrer Behandlung mit Inhibitoren der Ethylenbildung oder Ethyienwahrnehmung. Auf diesem Wege kann Obst und Gemüse auch über große Distanzen ohne vollständige
Ausreifung transportiert werden. Kurz vor dem Verkauf an den Abnehmer oder
Verbraucher wird die Reifung der Früchte durch ihre Behandlung mit Ethylen oder Ethylenanaloga gezielt induziert. Mit diesem Verfahren sind in Abhängigkeit von Produktionsland, Produktionsstandards und Fruchtspezies allerdings immer noch erhebliche Nachernteverluste von 10 bis 30 % zu verzeichnen. Dies liegt zum einen daran, dass die Unterdrückung der Reifung durch tiefe Temperaturen und
Schutzgasatmosphäre nicht bei allen Früchten möglich ist. Selbst wenn dieses jedoch möglich ist, ist dieses Verfahren mit einem hohen Energieaufwand für Transport und Lagerung und entsprechend hohen Kosten verbunden. Dies gilt ebenso für den Transport und die Lagerung von Schnittblumen (Umweltaspekte im Blumenhandel, Studie zur Klimaverträglichkeit der Schnittblumenproduktion, Blumen Rosinski;
Dokumentation von Myclimate; J. van der Hülst, Kühlkettenmanaaement für
Schnittblumen, www.flowerwatch.com). Zur Untersuchung der Wirkung eines Verfahrens auf die Ethylenantwort einer Frucht kann zunächst das Ausmaß der Verzögerung der Reifung betrachtet werden. Ebenso ist als Screening-System auch die Bestimmung der Änderung der Dreifachantwort von Keimlingen bekannt, die von ihnen bei Ethylenexposition im Dunkeln gezeigt werden (P. Guzmän, J. R. Ecker, Exploiting the Triple Response of Arabidopsis To Identify Ethylene-Related Mutants, Plant Cell 2: 13-523; 1990). Bei Behandlung mit Ethylen kommt es zu einer Verdickung und Verkürzung des Hypokotyls, einer Verkürzung der Wurzel und einer starken Krümmung des Apikaihakens. Mit Hilfe von veränderten Dreifachantworten in Mutanten konnten auch die an der Ethylensignalkette beteiligten Rezeptoren und weitere Signaiproteine identifiziert werden. Diese Erkenntnisse wurden bereits genutzt, um weitere Verfahren zur Kontrolle der Ethylenexposition zu entwickeln.
So kann die Ethylenbiosynthese in Pflanzen beispielsweise über die Inaktivierung von an der Ethylenbiosynthese beteiligten Genen in transgenen Pflanzen gehemmt werden (Beispiele für solche transgenen Pflanzen sind zu finden in N. A. Kahn, Ethyiene Action in Plants, Springer Berlin, Heidelberg, New York, 2006, Tabelle 8.1 a) auf Seite 168). Die Ethylenwahrnehmung kann ebenso durch genetische Veränderungen der Rezeptoren in transgenen Pflanzen gehemmt werden (Beispiele für solche transgenen Pflanzen sind zu finden in N. A. Kahn, Ethyiene Action in Plants, Springer Berlin, Heidelberg, New York, 2006, Tabelle 8.1 b) auf den Seiten 168-169). Eine weitere Möglichkeit zur Hemmung der Ethylenwahrnehmung besteht in der Verwendung von Ethylenantagonisten. Als erste Ethylenanaloga, welche ebenso wie das Phytohormon in Keimlingen eine Dreifachantwort auslösen, wurden Propylen, Acetylen und
Kohlenmonoxid sowie Alkene und Alken-verwandte Verbindungen identifiziert (S. P. Burg, E. A. Burg, Molecular requirement for the biologica! activity of ethyiene, Plant Physiol 42: 144-152). Später konnte auch für Isocyanide nachgewiesen werden, dass diese eine Rolle als Ethylenantagonisten spielen können (E. C. Sisler, Ethyiene acitvity of some ττ-acceptor Compounds, Tob Sei 21 : 43-45; 1977). Verschiedene zyklische Alkene (Beispiele hierfür sind zu finden in N. A. Kahn, Ethyiene Action in Plants,
Springer Berlin, Heidelberg, New York, 2006, Tabelle 1.1 ) und natürlich vorkommende Terpene (Beispiele hierfür sind zu finden in N. A. Kahn, Ethyiene Action in Plants, Springer Berlin, Heidelberg, New York, 2006, Tabelle 1.2) hemmen die Ethylenantwort und wirken als Ethylenantagonisten. Ebenso sind Silber-Ionen wie beispielsweise Silbernitrat, Silbersulfat und Silberthiosulfat wirksame Ethylenantagonisten. Sehr wirksame Ethylenantagonisten sind Cyclopropene (Beispiele hierfür sind zu finden in
N. A. Kahn, Ethylene Action in Plants, Springer Berlin, Heidelberg, New York, 2006, Tabelle 1.3). Beispielsweise wird die Verbindung 1 -Methylcyclopropen (1-MCP) unter dem Handelsriamen Ethylbioc für Blumen und Smartfresh für essbare Produkte vertrieben.
Allen diesen Ethylenantagonisten mit der Ausnahme von Silbersulfat und Cyclopropen ist es jedoch gemeinsam, dass sie eine kontinuierliche Applikation und Einwirkung benötigen, um ihre Wirksamkeit zu entfalten. Die Verwendung einiger Stoffe wie
Norbornadien oder trans-Cycioocten ist zudem mit einer starken Geruchsbelästigung verbunden. Die praktische Anwendbarkeit von 1-MCP ist eingeschränkt, da es in flüssiger Form oder in Lösung - außer bei tiefen Temperaturen - instabil ist und nur im gasförmigen Zustand unter Inertgasatmosphäre stabil ist. Aus dieser Tatsache der Applikation in gasförmigen Zustand resultiert jedoch, dass eine Exposition der Früchte oder Blumen nur in geschlossenen, gasdichten Räumen erfolgen kann. Zudem ist die Wasserlöslichkeit von 1-MCP unzureichend. Außerdem ist die Wirkung von 1-MCP bei niedrigen Temperaturen, die bei der Lagerung und dem Transport von Früchten oder Blumen Anwendung finden, geringer als bei Raumtemperatur, so dass effektiv eine größere Menge 1-MCP unter Anwendungsbedingungen verwendet werden muss. In einigen Fällen wie bei Petersilie oder Birnen beschleunigt 1-MCP sogar die
Ethylenproduktion und hat somit einen negativen Effekt auf die Reifung. In
verschiedenen Steinfrüchten wird nur ein begrenzter Effekt mit 1-MCP erzielt und Narzissen sind sogar insensitiv gegenüber 1-MCP. Eine weitere Möglichkeit der Kontrolle der Ethylenexposition stellt die Hemmung von ethylen-induzierten
Zielproteinen da. Diese Möglichkeit ist derzeit nur auf die Hemmung
zellwandmodifizierender Enzyme in transgenen Pflanzen beschränkt (Beispiele sind zu finden in N. A. Kahn, Ethylene Action in Plants, Springer Berlin, Heidelberg, New York, 2006, Tabelle 8.1 c) auf den Seite 169).
Insgesamt stellt die Kontrolle der Ethylenexposition von Pflanzen und deren Früchten ebenso wie von Blühpflanzen derzeit ein Verfahren dar, welches insbesondere mit hohen Kosten verbunden ist. Damit stellt sich die vorliegende Erfindung ausgehend vom Stand der Technik insbesondere die Aufgabe, ein Verfahren zur Kontrolle des Reifungsprozesses, des Seneszenzprozesses und/oder der Stresstoleranz von Pflanzen und/oder deren Früchten bereit zu stellen, welche vorzugsweise mindestens einen der vorstehend diskutierten Nachteile der aus dem Stand der Technik bekannten Verfahren behebt. Insbesondere stellt sich der vorliegenden Erfindung die Aufgabe, ein Verfahren bereit zu stellen, in dem Nachernteverluste, das heißt das Verderben von Lebensmitteln nach der Ernte, insbesondere bevor der Verbraucher erreicht wird, gegenüber den im Stand der Technik beschriebenen Verfahren zu reduzieren. Zudem soll ein Verfahren bereitgestellt werden, welches vorzugsweise eine wirksame Kontrolle des
Reifungsprozesses, des Seneszenzprozesses und/oder der Stresstoleranz gegenüber einer Vielzahl an unterschiedlichsten Pflanzen, Früchten und Blühpflanzen aufweist.
Gelöst wird mindestens ein Teil dieser Aufgaben, bevorzugt alle dieser Aufgaben durch die Bereitstellung einer Verbindung, welche ausgewählt wird aus der Gruppe, bestehend aus einem Peptid, einem Peptidmimetikum und einem Aptamer, einem Mittel und/oder eines Verfahrens zur Beeinflussung des Reifungsprozesses, des Seneszenzprozesses und/oder der Stresstoleranz von Pflanzen und/oder ihrer Früchte, wie nachstehend näher erläutert.
Insbesondere werden diese Aufgaben gelöst durch die Bereitstellung einer
Verbindung, welche ausgewählt wird aus der Gruppe, bestehend aus einem Peptid, einem Peptidmimetikum und einem Aptamer, dadurch gekennzeichnet, dass das Peptid aus einer Aminosäuresequenz besteht, welche ausgewählt wird aus der Gruppe, bestehend aus der Aminosäuresequenz SEQ ID NO: 1 , der
Aminosäuresequenz SEQ ID NO: 2, der Aminosäuresequenz SEQ ID NO: 3, einer Permutation einer der Aminosäuresequenzen SEQ ID NO: 1 bis SEQ ID NO: 3, einem Teil einer der Aminosäuresequenzen SEQ ID NO: 1 bis SEQ ID NO: 3, welcher mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 6 der in SEQ ID NO: 1 bis SEQ ID NO: 3 genannten Aminosäuren umfasst, und einem Derivat einer der Aminosäuresequenzen SEQ ID NO: 1 bis SEQ ID NO: 3, dass das
Peptidmimetikum aus einer am Peptid rückgrat modifizierten Aminosäuresequenz besteht, welche ausgewählt wird aus der Gruppe, bestehend aus der
Aminosäuresequenz SEQ ID NO: 1 , der Aminosäuresequenz SEQ ID NO: 2, der Aminosäuresequenz SEQ ID NO: 3, einer Permutation einer der
Aminosäuresequenzen SEQ ID NO: 1 bis SEQ ID NO: 3, einem Teil einer der
Aminosäuresequenzen SEQ ID NO: 1 bis SEQ ID NO: 3, welcher mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 6 der in SEQ ID NO: 1 bis SEQ ID NO: 3 genannten Aminosäuren umfasst, und einem Derivat einer der
Aminosäuresequenzen SEQ ID NO:1 bis SEQ ID NO: 3 oder dass das Aptamer auf Basis der Zielstruktur eines Peptids hergestellt wird, wobei das Peptid ausgewählt wird, aus der Aminosäuresequenz SEQ ID NO: 1 , der Aminosäuresequenz SEQ ID NO: 2, der Aminosäuresequenz SEQ ID NO: 3, einer Permutation einer der
Aminosäuresequenzen SEQ ID NO: 1 bis SEQ ID NO: 3, einem Teil einer der
Aminosäuresequenzen SEQ ID NO: 1 bis SEQ ID NO: 3, welcher mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 6 der in SEQ ID NO: 1 bis SEQ ID NO: 3 genannten Aminosäuren umfasst, und einem Derivat einer der
Aminosäuresequenzen SEQ ID NO: 1 bis SEQ ID NO: 3. Dabei sind Verbindungen ausgenommen, bei denen das Peptid aus einer Aminosäuresequenz der SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101 oder SEQ ID NO: 102, und/oder aus einem Teil einer der Aminosäuresequenzen SEQ ID NO: 98 bis SEQ ID NO: 102, welcher mindestens 6 der in SEQ ID NO: 98 bis SEQ ID NO: 102 genannten Aminosäuren umfasst und/oder aus einem Derivat der Aminosäuresequenzen SEQ ID NO: 98 bis 102 besteht und/oder bei denen ein Peptidmimetikum aus einer am
Peptidrückgrat modifizierten Aminosäuresequenz besteht, welche ausgewählt wird aus der Gruppe, bestehend aus SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101 und SEQ ID NO: 102, und/oder bei denen ein Aptamer auf Basis der Zieistruktur eines Peptids hergestellt wird, wobei das Peptid ausgewählt wird aus der Gruppe, bestehend aus SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100 SEQ ID NO: 101 und SEQ ID NO: 102.
Ebenso werden diese Aufgaben gelöst durch die Bereitstellung einer Verbindung, welche ausgewählt wird aus der Gruppe, bestehend aus einem Peptid, einem
Peptidmimetikum einem Antikörper und/oder seiner Fragmente und einem Aptamer, dadurch gekennzeichnet, dass das Peptid und/oder der Antikörper und/oder dessen Fragmente die Aminosäuresequenz SEQ ID NO: 103, oder einen Teil der
Aminosäuresequenz SEQ ID NO: 103, welcher mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 6 der in SEQ ID NO: 103 genannten Aminosäuren umfasst, oder ein Derivat der Aminosäuresequenz SEQ ID NO: 103 umfasst oder dass das Peptidmimetikum die am Peptidrückgrat modifizierte Aminosäuresequenz SEQ ID NO: 103 oder einen Teil der am Peptidrückgrat modifizierten Aminosäuresequenz SEQ ID NO: 103, welcher mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 6 der in SEQ ID NO: 103 genannten Aminosäuren umfasst, oder ein Derivat der am Peptidrückgrat modifizierten Aminosäuresequenz SEQ ID NO:103 umfasst oder dass das Aptamer auf Basis der Zielstruktur eines Peptids hergestellt wird, wobei das Peptid ausgewählt wird, aus der Aminosäuresequenz SEQ ID NO: 103, einem Teil der Aminosäuresequenz SEQ ID NO: 103, welcher mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 6 der in SEQ ID NO: 103 genannten Aminosäuren umfasst, und einem Derivat der Aminosäuresequenz SEQ ID NO: 103, wobei, wenn die Aminosäuresequenz SEQ ID NO: 103 an einer Position Alanin umfasst, keine der anderen Aminosäuren der SEQ ID NO: 103 Alanin ist. Des Weiteren werden diese Aufgaben insbesondere gelöst durch die Bereitstellung eines Mittels zur Beeinflussung des Reifungsprozesses, des Seneszenzprozesses und/oder der Stresstoleranz von Pflanzen und/oder ihrer Früchte umfassend
mindestens eine Verbindung, welche ausgewählt wird aus der Gruppe, bestehend aus einem Peptid, einem Peptidmimetikum, einem Aptamer, einem Antikörper und/oder seiner Fragmente, dadurch gekennzeichnet, dass das Peptid oder der Antikörper und/oder dessen Fragmente eine Aminosäuresequenz umfasst, welche ausgewählt wird aus der Gruppe, bestehend aus der Aminosäuresequenz SEQ ID NO: 1 , der Aminosäuresequenz SEQ ID NO: 2, der Aminosäuresequenz SEQ ID NO: 3, einer Permutation einer der Aminosäuresequenzen SEQ ID NO: 1 bis SEQ ID NO: 3, einem Teil einer der Aminosäuresequenzen SEQ ID NO: 1 bis SEQ ID NO: 3, welcher mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 6 der in SEQ ID NO: 1 bis SEQ ID NO: 3 genannten Aminosäuren umfasst, und einem Derivat einer der Aminosäuresequenzen SEQ ID NO: 1 bis SEQ ID NO: 3, dass das
Peptidmimetikum mindestens eine am Peptidrückgrat modifizierte Aminosäuresequenz umfasst, welche ausgewählt wird aus der Gruppe, bestehend aus der
Aminosäuresequenz SEQ ID NO: 1 , der Aminosäuresequenz SEQ ID NO: 2, der Aminosäuresequenz SEQ ID NO: 3, einer Permutation einer der
Aminosäuresequenzen SEQ ID NO: 1 bis SEQ ID NO: 3, einem Teil einer der
Aminosäuresequenzen SEQ ID NO: 1 bis SEQ ID NO: 3, welcher mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 6 der in SEQ ID NO: 1 bis SEQ ID NO: 3 genannten Aminosäuren umfasst, und einem Derivat einer der
Aminosäuresequenzen SEQ ID NO:1 bis SEQ ID NO: 3 oder dass das Aptamer auf
Basis der Zielstruktur eines Peptids hergestellt wird, wobei das Peptid ausgewählt wird, aus der Aminosäuresequenz SEQ ID NO: 1 , der Aminosäuresequenz SEQ ID NO: 2, der Aminosäuresequenz SEQ ID NO: 3, einer Permutation einer der
Aminosäuresequenzen SEQ ID NO: 1 bis SEQ ID NO: 3, einem Teil einer der
Aminosäuresequenzen SEQ ID NO: 1 bis SEQ ID NO: 3, welcher mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 6 der in SEQ ID NO: 1 bis SEQ ID NO: 3 genannten Aminosäuren umfasst» und einem Derivat einer der
Aminosäuresequenzen SEQ ID NO: 1 bis SEQ ID NO: 3. Dabei sind Verbindungen ausgenommen, bei denen das Peptid oder der Antikörper und/oder dessen Fragmente eine Aminosäuresequenz der SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101 oder SEQ ID NO: 102, und/oder einen Teil einer der
Aminosäuresequenzen SEQ ID NO: 98 bis SEQ ID NO: 102, welcher mindestens 6 der in SEQ ID NO: 98 bis SEQ ID NO: 102 genannten Aminosäuren umfasst und/oder ein Derivat der Aminosäuresequenzen SEQ ID NO: 98 bis 102 umfasst und/oder bei denen ein Peptidmimetikum aus einer am Peptidrückgrat modifizierten
Aminosäuresequenz besteht, weiche ausgewählt wird aus der Gruppe, bestehend aus SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101 und SEQ ID NO: 102, und/oder bei denen ein Aptamer auf Basis der Zielstruktur eines Peptids hergestellt wird, wobei das Peptid ausgewählt wird aus der Gruppe, bestehend aus SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100 SEQ ID NO: 101 und SEQ ID NO: 102.
Ebenso werden diese Aufgaben insbesondere gelöst durch die Bereitstellung eines Mittels zur Beeinflussung des Reifungsprozesses, des Seneszenzprozesses und/oder der Stresstoleranz von Pflanzen und/oder ihrer Früchte umfassend mindestens eine Verbindung, welche ausgewählt wird aus der Gruppe, bestehend aus einem Peptid, einem Peptidmimetikum, einem Aptamer, einem Antikörper und/oder seiner
Fragmente, dadurch gekennzeichnet, dass das Peptid oder der Antikörper und/oder dessen Fragmente die Aminosäuresequenz SEQ ID NO: 103, einen Teil der
Aminosäuresequenz SEQ ID NO: 103, welcher mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 6 der in SEQ ID NO: 103 genannten Aminosäuren umfasst, oder ein Derivat der Aminosäuresequenz SEQ ID NO: 103 umfasst, dass das Peptidmimetikum die am Peptidrückgrat modifizierte Aminosäuresequenz SEQ ID NO: 103, einen Teil einer am Peptidrückgrat modifizierten Aminosäuresequenz SEQ ID NO: 103, welcher mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 6 der in SEQ ID NO: 103 genannten Aminosäuren umfasst, oder ein Derivat einer am Peptidrückgrat modifizierten Aminosäuresequenz SEQ ID NO: 103 umfasst oder dass das Aptamer auf Basis der Zielstruktur eines Peptids hergestellt wird, wobei das Peptid ausgewählt wird, aus der Aminosäuresequenz SEQ ID NO: 103, einem Teil einer der Aminosäuresequenzen SEQ ID NO: 103, welcher
mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 6 der in SEQ ID NO: 103 genannten Aminosäuren umfasst, und einem Derivat der
Aminosäuresequenz SEQ ID NO: 103, wobei, wenn die Aminosäuresequenz SEQ ID NO: 103 an einer Position Alanin umfasst, keine der anderen Aminosäuren der SEQ ID NO: 103 Alanin ist.
Weiterhin werden diese Aufgaben gelöst durch die Bereitstellung eines Verfahrens zur Beeinflussung des Reifungsprozesses, des Seneszenzprozesses und/oder der Stresstoleranz von Pflanzen und/oder ihrer Früchte, dadurch gekennzeichnet, dass in den Pflanzen und/oder Früchten die Interaktion des Proteins EIN2 (Ethylene
Insensitive 2) oder eines orthologen Proteins davon mit dem Rezeptorprotein ETR1 (Ethylene resistent 1), seiner Isoformen E S1 , ETR2, ERS2, EIN4 oder homologen oder orthologen Proteinen davon durch die Interaktion einer Verbindung, welche ausgewählt wird aus der Gruppe» bestehend aus einem Peptid, einem
Peptidmimetikum, einem Aptamer, einem Antikörper und/oder setner Fragmente, kleinen Molekülen und Mischungen dieser Verbindungen mit einer Kontaktdomäne des Ethylenrezeptors ETR1 oder seiner Isoformen ERS1 , ETR2, ERS2, EIN4 oder eines homologen oder orthologen Proteins davon gehemmt wird, wobei die Kontaktdomäne diejenige ist, welche mit EIN2 oder einem orthologen Protein davon interagiert und wobei das Peptid, der Antikörper und/oder seine Fragmente mindestens eine
Aminosäuresequenz umfasst, welche ausgewählt wird aus der Gruppe, bestehend aus der Aminosäuresequenz SEQ ID NO: 1 , der Aminosäuresequenz SEQ ID NO: 2, der Aminosäuresequenz SEQ ID NO: 3, einer Permutation einer der
Aminosäuresequenzen SEQ ID NO: 1 bis SEQ ID NO: 3, einem Teil einer der
Aminosäuresequenzen SEQ ID NO: 1 bis SEQ ID NO: 3, welcher mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 8 der in SEQ ID NO: 1 bis SEQ ID NO: 3 genannten Aminosäuren umfasst, und einem Derivat einer der
Aminosäuresequenzen SEQ ID NO: 1 bis SEQ ID NO: 3, das Peptidmimetikum
mindestens eine am Peptid rückgrat modifizierte Aminosäuresequenz umfasst, welche ausgewählt wird aus der Gruppe, bestehend aus der Aminosäuresequenz SEQ ID NO: 1 , der Aminosäuresequenz SEQ ID NO: 2, der Aminosäuresequenz SEQ ID NO: 3, einer Permutation einer der Aminosäuresequenzen SEQ ID NO: 1 bis SEQ ID NO: 3, einem Teil einer der Amiriosäuresequenzen SEQ ID NO: 1 bis SEQ ID NO: 3, welcher mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 6 der in SEQ ID NO: 1 bis SEQ ID NO: 3 genannten Aminosäuren umfasst, und einem Derivat einer der Aminosäuresequenzen SEQ ID NO:1 bis SEQ ID NO: 3 oder das Aptamer auf Basis der Zielstruktur eines Peptids hergestellt wird, wobei das Peptid ausgewählt wird, aus der Aminosäuresequenz SEQ ID NO: 1 , der Aminosäuresequenz SEQ ID NO: 2, der Aminosäuresequenz SEQ ID NO: 3, einer Permutation einer der
Aminosäuresequenzen SEQ ID NO: 1 bis SEQ ID NO: 3, einem Teil einer der
Aminosäuresequenzen SEQ ID NO: 1 bis SEQ ID NO: 3; welcher mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 6 der in SEQ ID NO: 1 bis SEQ ID NO: 3 genannten Aminosäuren umfasst, und einem Derivat einer der
Aminosäuresequenzen SEQ ID NO: 1 bis SEQ ID NO: 3. Dabei sind Verbindungen ausgenommen, bei denen das Peptid oder der Antikörper und/oder dessen Fragmente eine Aminosäuresequenz der SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101 oder SEQ ID NO: 102, und/oder einen Teil einer der
Aminosäuresequenzen SEQ ID NO: 98 bis SEQ ID NO: 102, welcher mindestens 6 der in SEQ ID NO: 98 bis SEQ ID NO: 102 genannten Aminosäuren umfasst und/oder ein Derivat der Aminosäuresequenzen SEQ ID- NO: 98 bis 102 umfasst und/oder bei denen ein Peptidmimetikum aus einer am Peptidrückgrat modifizierten
Aminosäuresequenz besteht, weiche ausgewählt wird aus der Gruppe, bestehend aus SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101 und SEQ ID NO: 102, und/oder bei denen ein Aptamer auf Basis der Zielstruktur eines Peptids hergestellt wird, wobei das Peptid ausgewählt wird aus der Gruppe, bestehend aus SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100 SEQ ID NO: 101 und SEQ ID NO: Ebenso werden diese Aufgaben gelöst durch die Bereitstellung eines Verfahrens zur Beeinflussung des Reifungsprozesses, des Seneszenzprozesses und/oder der Stresstoleranz von Pflanzen und/oder ihrer Früchte, dadurch gekennzeichnet, dass in den Pflanzen und/oder Früchten die Interaktion des Proteins E1N2 (Ethylene
Insensitive 2) oder eines orthologen Proteins davon mit dem Rezeptorprotein ETR1 (Ethylene resistant 1), seiner Isoformen ERS1 , ETR2, ERS2, EIN4 oder homologen oder orthologen Proteinen davon durch die Interaktion einer Verbindung, welche ausgewählt wird aus der Gruppe, bestehend aus einem Peptid, einem
Peptidmimetikum, einem Aptamer, einem Antikörper und/oder seiner Fragmente, kleinen Molekülen und Mischungen dieser Verbindungen mit einer Kontaktdomäne des Ethylenrezeptors ETR1 oder seiner Isoformen ERS1 , ETR2, ERS2, EIN4 oder eines homologen oder orthologen Proteins davon gehemmt wird, wobei die Kontaktdomäne diejenige ist, welche mit EIN2 oder einem orthologen Protein davon interagiert und wobei das Peptid, der Antikörper und/oder seine Fragmente mindestens eine
Aminosäuresequenz SEQ ID NO: 103, einen Teil der Aminosäuresequenz SEQ ID NO: 103, welcher mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 6 der in SEQ ID NO: 103 genannten Aminosäuren umfasst, oder ein Derivat der Aminosäuresequenz SEQ ID NO: 103 umfasst, das Peptidmimetikum mindestens eine am Peptidrückgrat modifizierte Aminosäuresequenz SEQ ID NO: 103, einen Teil der am Peptidrückgrat modifizierten Aminosäuresequenz SEQ ID NO: 103, welcher mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 6 der in SEQ ID NO: 103 genannten Aminosäuren umfasst, oder ein Derivat der am Peptidrückgrat modifizierten Aminosäuresequenz SEQ ID NO:103 umfasst oder das Aptamer auf Basis der Zielstruktur eines Peptids hergestellt wird, wobei das Peptid ausgewählt wird, aus der Aminosäuresequenz SEQ ID NO: 103, einem Teil der
Aminosäuresequenz SEQ ID NO: 103, welcher mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 6 der in SEQ ID NO: 103 genannten Aminosäuren umfasst, und einem Derivat der Aminosäuresequenz SEQ ID NO: 103, wobei, wenn die Aminosäuresequenz SEQ ID NO: 103 an einer Position Alanin umfasst, keine der anderen Aminosäuren der SEQ ID NO: 103 Alanin ist.
Es wurde überraschenderweise gefunden, dass die erfindungsgemäße Verbindung, das erfindungsgemäße Mittel und das erfindungsgemäße Verfahren eine wirksame Kontrolle des Rerfungsprozesses, des Seneszenzprozesses und/oder der Stresstoleranz in einer Vielzahl an unterschiedlichsten Pflanzen, Früchten und
Blühpflanzen ermöglicht Dadurch können erhebliche Energiekosten eingespart werden, welche insbesondere durch die Kühlung von Früchten oder aber auch den erhöhten Verbrauch von Blühpflanzen bei einer kürzeren Blühdauer entstehen.
Im Sinne der vorliegenden Erfindung wird der Begriff„Kontrolle der Ethylenexposition" äquivalent zur Beeinflussung von Retfungsprozessen, Seneszenzprozessen und/oder Stresstoleranz von Pflanzen und/oder ihrer Früchte verwendet. Hierbei schließen Reifungsprozesse insbesondere die vollständige Unterdrückung und/oder
Verzögerung der Reifung von Pflanzen und/oder deren Früchten ein. Eine
Unterdrückung und/oder Verzögerung der Reifung liegt insbesondere dann vor, wenn die Pflanzen und/oder deren Früchte zum Zeitpunkt der Abnahme durch den
Endverbraucher, das heißt nach Transport und gegebenenfalls anschließender Lagerung, noch nicht verdorben sind im Vergleich zu der gleichen Pflanze und/oder deren Früchte, welche nicht erfindungsgemäß behandelt wurde. In Bezug auf
Blühpflanzen bedeutet dies insbesondere, dass der Seneszenzprozess verzögert wird. Im Sinne der vorliegenden Erfindung ist unter der Verzögerung des
Seneszenzprozesses insbesondere die Verlängerung der Blühdauer der mit dem erfindungsgemäßen Verfahren behandelten Pflanze im Vergleich zu der gleichen Pflanze, welche nicht erfindungsgemäß behandelt wurde, zu verstehen. Des Weiteren wird unter der„Beeinflussung der Stresstoleranz", wie es im Sinne der Erfindung verwendet wird, vorzugsweise eine verbesserte Anpassung des morphologischen, physiologischen und biochemischen Zustandes der Pflanzen und/oder ihrer Früchte in Bezug auf Stressfaktoren, wie insbesondere Trockenheit, Hitze, Kälte, Überflutung, Salinität, mechanischen Reiz, Verletzung oder Pathogen-Infektion verstanden.
Der Begriff„Pflanze" wird in der vorliegenden Erfindung synonym für die Früchte der Pflanze sowie insbesondere auch für Blühpflanzen verwendet. Insbesondere schließt dieser Begriff alle oberirdischen und unterirdischen Teile und Organe der Pflanze mit ein, wie Spross, Blatt, Blüte und Wurzel, wobei beispielhaft Blätter, Nadeln, Stengel, Stämme, Blüten, Fruchtkörper, Früchte und Saatgut sowie Wurzeln, Knollen und Rhizome. Entsprechend den obigen Ausführungen gehört zu den Pflanzenteilen auch Erntegut sowie vegetatives und generatives Vermehrungsmaterial, beispielsweise Stecklinge, Knollen, Rhizome, Ableger und Saatgut. Die Interaktion hemmende Verbindung
Im erfindungsgemäßen Verfahren wird die Interaktion des Proteins E1N2 oder eines orthologen Proteins mit dem Rezeptorprotein ETR1 oder seiner Isoformen ERS1 , ETR2, ERS2, EIN4 oder eines homologen oder orthologen Proteins durch eine
Verbindung gehemmt, welche ausgewählt wird aus der Gruppe, bestehend aus einem Peptid, einem Peptidmimetikum, einem Aptamer, einem Antikörper und/oder seiner Fragmente, kleinen Molekülen und Mischungen dieser Verbindungen. Mischungen dieser Verbindungen umfassen bevorzugt zwei der genannten Verbindungen, können aber auch mehr als zwei der Verbindungen umfassen. Im Folgenden wird die
Verbindung, welche ausgewählt wird aus der Gruppe, bestehend aus einem Peptid, einem Peptidmimetikum, einem Aptamer, einem Antikörper und/oder seiner
Fragmente, kleinen Molekülen und Mischungen dieser Verbindungen, auch als„die Interaktion hemmende Verbindung" bezeichnet.
In einer bevorzugten Ausführungsform der vorliegenden Erfindung bedeutet der Begriff „umfassen"„bestehend aus".
Gemäß der vorliegenden Erfindung wird der Begriff„Peptid" insbesondere für eine Aminosäuresequenz von bis zu 100 Aminosäuren, bevorzugt bis zu 50 Aminosäuren, ganz besonders bevorzugt bis zu 12, weiterhin bevorzugt bis zu 10, am meisten bevorzugst bis zu 8 Aminosäuren verwendet. Dabei fallen unter den Begriff Peptide vorzugsweise L-Peptide, welche eine Sequenz von L-Aminosäuren umfassen.
Der Begriff„Peptidmimetikum" beschreibt eine niedermolekulare Verbindung, deren wesentliche strukturelle Elemente denen eines Peptids nachempfunden sind und die dadurch ähnliche biologische Aktivität wie Peptide aufweisen können. Bevorzugt weist die niedermolekulare Verbindung eine Molmasse von bis zu 11000 g/mol auf.
Besonders bevorzugt weist die niedermolekulare Verbindung eine Molmasse zwischen 500 bis 5000 g/mol, ganz besonders bevorzugt von 1000 bis 1500 g/mol auf,
Bevorzugt schließen Peptidmimetika D-Peptide ein, welche eine Sequenz von D-
Aminosäuren umfassen. Dabei werden diese insbesondere so designed, dass sie die biologische Aktivität der entsprechenden natürlichen L-Peptide aufweisen. Weiterhin bevorzugt schließen Peptidmimetika Peptide ein, deren Rückgrate chemisch modifiziert sind. Vorzugsweise weisen diese am Rückgrat chemisch modifizierten Peptide eine ggf. modifizierte Aminosäuresequenz von bis zu 100 Aminosäuren, bevorzugt bis zu 50 Aminosäuren, ganz besonders bevorzugt bis zu 12, weiterhin bevorzugt bis zu 10, am meisten bevorzugst bis zu 8 Aminosäuren auf. Besonders bevorzugt ist dabei die Peptid indung durch eine bioisostere Gruppe ersetzt. Ganz besonders bevorzugt weisen Peptidmimetika eine Aminosäuresequenzstruktur auf, in welcher mindestens eine der Peptidbindungen (*NHCO*) des Peptidrückgrats durch eine isostere Gruppe, welche ausgewählt werden, aus der Gruppe bestehend aus *CH2-CH2*. *CO-0*. *CHOH-CH2*, *CH2-0*, *CH2-NH*, *CH2-S*. *CS-NH* und N- modifiziertes *N CO*- ersetzt ist. Ebenso bevorzugt kann eine Modifizierung des Peptidrückgrats gegebenenfalls zusätzlich auch eine Zyklisierung umfassen. Unter den Begriff Peptidmimetikum fallen gemäß der vorliegenden Erfindung auch„Peptoide" (N- substituiertes Poiyglycin), welche eine Aminosäuresequenzstruktur aufweisen, in der mindestens eine der Peptidbindungen (*NHCO*) des Peptidrückgrats durch eine N- modifizierte *NRCO* Gruppe ersetzt ist und dabei R der Aminosäureseitenkette entspricht, welche in einem entsprechenden Peptid an das a-Kohlenstoffatom
gebunden ist. Hierbei ist es bevorzugt, dass die Peptoide eine
Aminosäuresequenzstruktur aufweisen, welche einer Aminosäuresequenz von bis zu 100 Aminosäuren entsprechen, bevorzugt bis zu 50 Aminosäuren, ganz besonders bevorzugt bis zu 12, weiterhin bevorzugt bis zu 10, am meisten bevorzugst bis zu 8 Aminosäuren. Ganz besonders bevorzugt weisen Peptoide ausschließlich eine einem Peptid analoge Struktur auf, in welcher alle Peptidbindungen durch N-modifizierte
*NRCO* Gruppen ersetzt sind und R jeweils der Aminosäureseitenkette entspricht, welche in einem analogen Peptid an das a-Kohlenstoffatom gebunden ist. In einer Ausführungsform ist das Peptidmimetikum ein Peptoid.
Der Begriff„Aptamer", so wie er im Sinne der Erfindung verwendet wird, bezeichnet einzel- oder doppelsträngige DNA- oder RNA-Oligonukleotide, welche insbesondere dadurch gekennzeichnet sind, dass sie über ihre 3D-Struktur spezifisch an ein Molekül binden können. Im vorliegenden Fall können sie spezifisch an die Kontaktdomäne des ETR1 binden. Die Identifizierung von DNA- und RNA-Aptameren kann über SELEX (Systematische Evolutton von Liganden durch exponentteile Anreicherung) erfolgen {C. Tuerk, L. Gold, Systematic evolution of ligands by exponential enrichment: RNA ligands to bacteriophage T4 DNA Polymerase. Science 249, 505-510; 1990; D. W. Drolet, R. D. Jenison, D. E. Smith, D. Pratt, B. J. Hicke, A high throughput platform for systematic evolution of ligands by exponential enrichment (SELEX) Comb. Chem. High Throughput Screen. 2, 271-278» ; 1999). Als Zielstruktur kann hier vorzugsweise ein Peptid, welches ausgewählt wird, aus der Aminosäuresequenz SEQ ID NO: 1 , der Aminosäuresequenz SEQ ID NO: 2, der Aminosäuresequenz SEQ ID NO: 3, der Äminosäuresequenz SEQ ID NO: 4, einer Permutation einer der
Aminosäuresequenzen SEQ ID NO: 1 bis SEQ ID NO: 4, einem Teil einer der
Aminosäuresequenzen SEQ ID NO: 1 bis SEQ ID NO: 4, welcher mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 6 der in SEQ ID NO: 1 bis SEQ ID NO: 4 genannten Aminosäuren umfasst, und einem Derivat einer der
Aminosäuresequenzen SEQ ID NO: 1 bis SEQ ID NO: 4, vorgelegt werden. Dabei sind Verbindungen ausgenommen, bei denen das Peptid aus einer Äminosäuresequenz der SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101 oder SEQ ID NO: 102, und/oder aus einem Teil einer der Aminosäuresequenzen SEQ ID NO: 98 bis SEQ ID NO: 102, welcher mindestens 6 der in SEQ ID NO: 98 bis SEQ ID NO: 102 genannten Aminosäuren umfasst und/oder aus einem Derivat der
Aminosäuresequenzen SEQ ID NO: 98 bis 102 besteht.
In einer anderen Ausführungsform ist die Zielstruktur ein Peptid, welches ausgewählt wird aus der Aminosäuresequenz SEQ ID NO: 103, einem Teil der
Aminosäuresequenz SEQ ID NO: 103, welcher mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 6 der in SEQ ID NO: 103 genannten Aminosäuren umfasst, und einem Derivat der Aminosäuresequenz SEQ ID NO: 103, wobei, wenn die Aminosäuresequenz SEQ ID NO: 103 an einer Position Alanin umfasst, keine der anderen Aminosäuren der SEQ ID NO: 103 Alanin ist. Besonders bevorzugt wird die Zielstruktur ausgewählt aus der Gruppe, bestehend aus einer Aminosäuresequenz SEQ ID NO: 103, SEQ ID NO: 104, SEQ ID NO: 105, SEQ ID NO: 106, SEQ ID NO: 107, SEQ ID NO: 108, einem Teil der Aminosäuresequenz SEQ ID NO: 103, SEQ ID NO: 104, SEQ ID NO: 105, SEQ ID NO: 106, SEQ ID NO: 107, SEQ ID NO: 108, welcher mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 6 der in SEQ ID NO: 103 bis SEQ ID NO: 108 genannten Aminosäuren umfasst, und einem Derivat einer der Aminosäuresequenz SEQ ID NO: 103, SEQ ID NO: 104, SEQ ID NO: 105, SEQ ID NO: 106, SEQ ID NO: 107 und SEQ ID NO: 108, wobei, wenn eine der Aminosäuresequenzen SEQ ID NO: 103, SEQ ID NO: 104, SEQ ID NO: 105, SEQ ID NO: 106, SEQ ID NO: 107 oder SEQ ID NO: 108 an einer Position Alanin umfasst, keine der anderen Aminosäuren der entsprechenden SEQ ID NO: Alanin ist. Ganz besonders bevorzugt handelt es sich bei der Zielstruktur um eine
Aminosäuresequenz, welche ausgewählt wird aus der Gruppe, bestehend aus der SEQ ID NO: 4, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 111 , SEQ ID NO: 112, SEQ ID NO: 113, SEQ ID NO: 114, SEQ ID NO: 115, SEQ ID NO: 116, SEQ ID NO: 117, SEQ ID NO: 118, SEQ ID NO: 119, SEQ ID NO: 120, SEQ ID NO: 121 , SEQ ID NO: 122, SEQ ID NO: 123 und SEQ ID NO: 124. Ebenso ist in H. Kawaki, S. Kubota, E. Aoyama, N. Fujita, H. Hanagata, A. Miyauchi, K. Nakai, M. Takigawa, Desgin and Utility of CCN2 anchor peptide aptamers, Biochimie 92 (2010) 1010-1015 und in C. J. Brown et al., Rational design and biophysical characterization of thioredoxin-based aptamers: insights into peptide grafting, J. Mol. Biol 295 (2012) 871-883 die
Herstellung von Aptameren beschrieben. Auch hier können bevorzugt die oben genannten Peptide als Grundlage für die Aptamerherstellung verwendet werden.
Ein„Antikörper und/oder dessen Fragmente" bezeichnet ein Protein und/oder dessen Teilsequenz aus der Klasse der Globuline. Vorzugsweise ist dieser monoklonale Antikörper und/oder dessen Fragmente gegen die Domäne des EIN2 oder eines orthologen Proteins gerichtet, welche mit der Kontaktdomäne des ETR1 wechselwirkt. Ganz besonders bevorzugt ist der Antikörper und/oder dessen Fragment auf Basis eines Peptids, welches ausgewählt wird, aus der Aminosäuresequenz SEQ ID NO: 1 , der Aminosäuresequenz SEQ ID NO: 2, der Aminosäuresequenz SEQ ID NO: 3, der Aminosäuresequenz SEQ ID NO: 4, einer Permutation einer der
Aminosäuresequenzen SEQ ID NO: 1 bis SEQ ID NO: 4, einem Teil einer der
Aminosäuresequenzen SEQ ID NO: 1 bis SEQ ID NO: 4, welcher mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 6 der in SEQ ID NO: 1 bis SEQ ID NO: 4 genannten Aminosäuren umfasst, und einem Derivat einer der
Aminosäuresequenzen SEQ ID NO: 1 bis SEQ ID NO: 4, hergestellt. Dabei sind Verbindungen ausgenommen, bei denen der Antikörper und/oder dessen Fragment eine Aminosäuresequenz der SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101 oder SEQ ID NO: 102, und/oder einen Teil einer der
Aminosäuresequenzen SEQ ID NO: 98 bis SEQ ID NO: 102, welcher mindestens 6 der in SEQ ID NO: 98 bis SEQ ID NO: 102 genannten Aminosäuren umfasst und/oder eine Derivat der Aminosäuresequenzen SEQ ID NO: 98 bis 102 umfasst. In einer anderen Ausführungsform ist der Antikörper und/oder dessen Fragment auf Basis eines Peptids hergestellt, welches ausgewählt wird aus der Aminosäuresequenz SEQ ID NO: 103, einem Teil der Aminosäuresequenz SEQ ID NO: 103, welcher mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 6 der in SEQ ID NO: 103 genannten Aminosäuren umfasst, und einem Derivat der
Aminosäuresequenz SEQ ID NO: 103, wobei, wenn die Aminosäuresequenz SEQ ID NO: 103 an einer Position Alanin umfasst, keine der anderen Aminosäuren der SEQ ID NO: 103 Alanin ist. Besonders bevorzugt ist der Antikörper und/oder dessen Fragment auf Basis eines Peptids hergestellt, welches ausgewählt wird aus der Gruppe, bestehend aus einer Aminosäuresequenz SEQ ID NO: 103, SEQ ID NO: 104, SEQ ID NO: 105, SEQ ID NO: 106, SEQ ID NO: 107, SEQ ID NO: 108 einem Teil der
Aminosäuresequenz SEQ ID NO: 103, SEQ ID NO: 104, SEQ ID NO: 105, SEQ ID NO: 106, SEQ ID NO: 107, SEQ ID NO: 108, welcher mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 6 der in SEQ ID NO: 103 bis SEQ ID NO: 108 genannten Aminosäuren umfasst, und einem Derivat einer der
Aminosäuresequenzen SEQ ID NO: 103, SEQ ID NO: 104, SEQ ID NO: 105, SEQ ID NO: 106 SEQ ID NO: 107 und SEQ ID NO: 108, wobei, wenn eine der
Aminosäuresequenzen SEQ ID NO: 103, SEQ ID NO: 104, SEQ ID NO: 105, SEQ ID NO: 106, SEQ ID NO: 107 oder SEQ ID NO: 108 an einer Position Alanin umfasst, keine der anderen Aminosäuren der entsprechenden SEQ ID NO: Alanin ist.
Ganz besonders bevorzugt ist der Antikörper und/oder dessen Fragment auf Basis einer Aminosäuresequenz hergestellt, welche ausgewählt wird aus der Gruppe, bestehend aus der SEQ ID NO: 4, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 111 , SEQ ID NO: 112, SEQ ID NO: 113, SEQ ID NO: 114, SEQ ID NO: 115, SEQ ID NO: 116, SEQ ID NO: 117, SEQ ID NO: 118, SEQ ID NO: 119, SEQ ID NO: 120, SEQ ID NO: 121 , SEQ ID NO: 122, SEQ ID NO: 123 und SEQ ID NO: 124.
Gemäß der vorliegenden Erfindung sind„kleine Moleküle" solche chemischen
Verbindungen, welche geeignet sind, mit der Kontaktdomäne des ETR1 oder einem homologen oder orthologen Protein davon zu interagieren und eine Molmasse von bevorzugt höchstens 1500 g/mol aufweisen. Bevorzugt weisen kleine Moleküle ähnliche physikochemische Eigenschaften wie das Peptid SEQ ID NO: 4 auf. Ganz besonders bevorzugt weisen kleine Moleküle ähnliche physikochemische Eigenschaften auf wie ein Peptid, welches ausgewählt wird aus der Gruppe, bestehend aus der SEQ ID NO: 4, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 11 1 , SEQ ID NO: 1 12, SEQ ID NO: 1 13, SEQ ID NO: 1 14, SEQ ID NO: 1 15, SEQ iD NO: 1 16, SEQ ID NO: 1 17, SEQ iD NO: 118, SEQ ID NO: 1 19, SEQ ID NO: 120, SEQ ID NO: 121 , SEQ ID NO: 122, SEQ ID NO: 123 und SEQ ID NO: 124. Besonders bevorzugt weisen die kleinen Moleküle eine positive Partialiadung oder Ladung auf. Ganz besonders bevorzugt weisen die kleinen Moleküle eine Nettoladung von +3 bis +7, am bevorzugsten von +4 bis +6 auf. Ebenso bevorzugt weisen kleine Moleküle einen isoelektrischen Punkt bei 25 °C von pH = 10 bis 14, besonders bevorzugt von 11 bis 13 auf. Weiterhin bevorzugt weisen sie eine Hydrophobizität von + 12 bis + 18 Kcal/mol, besonders bevorzugt von +13 bis +17 Kcal/mol auf. Ganz besonders bevorzugt weisen die kleinen Moleküle eine Nettoladung von + 5 auf. Weiterhin ganz besonders bevorzugt weisen die kleinen Moleküle einen isoelektrischen Punkt von pH = 12.2 auf. Ebenso ganz besonders bevorzugt weisen sie eine Hydrophobizität von + 15, 7 Kcal/mol auf.
Dem Fachmann sind Methoden bekannt, um die oben genannten wirksamen
Verbindungen zu identifizieren. Vorzugsweise kann er die strukturellen und
elektrostatischen Anforderungen auf Basis des folgenden Homologiemodells bestimmen, das über vergleichende Modellierung mit dem Programm MODELLER 9.11 (A. Sali & T.L. Blundell. Comparative protein modelling by satisfaction of spatial restraints. J. Mol. Biol. 234, 779-815, 1993) auf der Basis der Kristallstruktur der RNA- gerichteten RNA Polymerase (RCSB Protein Data Bank: 4f5x.pdb) erstellt wurde, die im Sequenzabschnitt 160-167 eine 87.5 prozentige Übereinstimmung mit SEQ ID NO: 4 besitzt (siehe auch Figur 8):
Tabelle 1 : Homologiemodell
EXPDTA T HEORET ICAL MODE
HELIX 8 8 LY S 2 ARG 7 1 6
ATOM 1 N LEU 1 335.645 5.917 372.542 0.20 188.39 N
ATOM 2 H LEU 1 335.545 5.839 373.574 1.00 168.39
ATOM 3 CA LEU 1 334.308 6.055 371.927 0.20 168.39 C
ATOM 4 HA LEU 1 334.446 6.100 370.858 1.00 168.39 H
ATOM 5 CB LEU 1 333.403 4.874 372.313 0.20 168.39 C
ATOM 6 HB3 LEU 1 333.869 3.928 371.961 1.00 168.39 H ATOM 7 HB2 LEU 1 333.314 4.827 373.421 1.00 168.39 H
ATOM 8 CG LEU 1 331.998 5.000 371.686 0.20 168.39
ATOM 9 HG LEU i 331.994 3.888 371.650 1.00 168.39 H
ATOM 10 CD1 LEU ! 331.914 4.904 370.156 0.20 168.39 c
ATOM 11 HD11 LEU 1 332.484 4.020 369.802 1.00 168.39 H
ATOM 12 HD12 LEU ! 332.345 5.816 369.692 1.00 168.39 H
ATOM 13 HD13 LEU 1 330.857 4.801 369.834 1.00 168.39 H
ATOM 14 CD2 LEU 1 330.776 4.753 372.583 0.20 168.39 c
ATOM 15 HD21 LEU 1 331.025 4.040 373.397 1.00 168.39 H
ATOM 16 HD22 LEU ! 330.430 5.708 373.035 1.00 168.39 H
ATOM 17 HD23 LEU 1 329.945 4.327 371.979 1.00 168.39 H
ATOM 18 C LEU 1 333.646 7.305 372.394 0.20 168.39 C
ATOM 19 O LEU 1 333.063 8.040 371.603 0.20 168.39 O
ATOM 20 H2 LEU 1 336.112 5.063 372.174 1.00 168.39 H
ATOM 21 H3 LEU 1 336.218 6.752 372.310 1.00 168.39 H
! ATOM 22 N LYS 2 333.734 7.576 373.708 0.20 101.11 N
ATOM 23 H LYS 2 334.221 6.977 374.340 1.00 101.11 H
ATOM 24 CA LYS 2 333.097 8.723 374.282 0.20 101.11 C
ATOM 25 HA LYS 2 332.038 8.658 374.081 1.00 101.11 H
ATOM 26 CB LYS 2 333.381 8.818 375.791 0.20 101.11 C
ATOM 27 HB3 LYS 2 334.482 8.833 375.934 1.00 101.11 H
ATOM 28 HB2 LYS 2 332.964 9.763 376.200 1.00 101.11 H
ATOM 29 CG LYS 2 332.806 7.638 376.582 0.20 101.11 C
ATOM 30 HG3 LYS 2 333.070 6.697 376.052 1.00 101.11 H
ATOM 31 HG2 LYS 2 331.698 7.721 376.608 1.00 101.11 H
ATOM 32 CD LYS 2 333.351 7.533 378.012 0.20 101.11 C
ATOM 33 HD3 LYS 2 334.440 7.321 377.968 1.00 101.11 H
ATOM 34 HD2 LYS 2 332.852 6.679 378.515 1.00 101.11 H
ATOM 35 CE LYS 2 333.140 8.797 378.851 0.20 101.11 C
ATOM 36 HE3 LYS 2 333.676 9.663 378.404 1.00 101.11
ATOM 37 HE2 LYS 2 333.503 8.641 379.890 1.00 101.11 H
ATOM 38 NZ LYS 2 331.702 9.130 378.918 0.20 101.11 N
ATOM 39 HZ1 LYS 2 331.571 9,998 379.478 1.00 101.11 H
ATOM 40 HZ2 LYS 2 331.344 9.283 377.954 1.00 101.11 H
ATOM 41 HZ3 LYS 2 331.182 8.348 379.363 1.00 101.11 H
ATOM 42 C LYS 2 333.654 9.957 373.642 0.20 101.11 C
ATOM 43 o LYS 2 332.907 10.831 373.203 0.20 101.11 O
ATOM 44 N ARG 3 334.991 10.049 373.552 0.20 999.99 N
ATOM 45 H ARG 3 335.601 9.332 373.882 1.00 999.99
ATOM 46 CA ARG 3 335.611 1 1.211 372.987 0.20 QQQ QQ C
ATOM 47 HA ARG 3 335.199 12.076 373.487 1.00 999.99 H
ATOM 48 CB ARG 3 337.142 11.195 373.104 0.20 QQQ OD C
ATOM 49 HB3 ARG 3 337.412 11.048 374.172 1.00 999.99 H
ATOM 50 HB2 ARG 3 337.553 10.346 372.515 1.00 999.99 H
ATOM 51 CG ARG 3 337.765 12.507 372.636 1.00 999.99 C ATOM 52 HG3 ARG 3 337,297 13.336 373.210 1.00 999.99 H
ATOM 53 HG2 ARG 3 337.545 12.664 371.560 1.00 999.99 H
ATOM 54 CD ARG 3 339.276 12.562 372.855 1.00 999.99 C
ATOM 55 HD3 ARG 3 339.523 12.421 373.929 1.00 QQQ QQ H
ATOM 56 HD2 ARG 3 339.807 11.809 372.234 1.00 999.99 H
ATOM 57 NE ARG 3 339.744 13.917 372.445 1.00 999.99 N
ATOM 58 HE ARG 3 339.086 14.584 372.096 1.00 999.99 H
ATOM 59 CZ ARG 3 341.064 14.251 372.562 1.00 999.99 C
ATOM 60 NH1 ARG 3 341.958 13.338 373.038 1.00 999.99 N
ATOM 61 HH11 ARG 3 340.826 16.172 371.871 1.00 999.99 H
ATOM 62 HH12 ARG 3 342.453 15.740 372.280 1.00 999.99 H
ATOM 63 NH2 ARG 3 341.485 15.498 372.204 1.00 999.99 N
ATOM 64 HH21 ARG 3 342.924 13.582 373.129 1.00 999.99 H
ATOM 65 HH22 ARG 3 341.647 12.423 373.297 1.00 999.99 H
ATOM 66 C ARG 3 335.249 11.250 371.544 0.20 999.99 C
ATOM 67 O ARG 3 335.080 12.313 370.949 0.20 999.99 O
ATOM 68 N TYR 4 335.115 10.051 370.954 0.20 102.96 N
ATOM 69 H TYR 4 335.245 9.201 371.459 1.00 102.96 H
ATOM 70 CA TYR 4 334.794 9.910 369.568 0.20 102.96 C
ATOM 71 HA TYR 4 335.560 10.407 368.991 1.00 102.96 H
ATOM 72 CB TYR 4 334.672 8.428 369.178 0.20 102.96 C
ATOM 73 HB3 TYR 4 335.637 7.897 369.319 1.00 102.96 H
ATOM 74 HB2 TYR 4 333.882 7.929 369.779 1.00 102.96 H
ATOM 75 CG TYR 4 334.289 8.321 367.747 0.20 102.96 C
ATOM 76 CD1 TYR 4 335.236 8.417 366.755 0.20 102.96 C
ATOM 77 HD1 TYR 4 336.271 8.581 367.015 1.00 102.96 H
ATOM 78 CD2 TYR 4 332.973 8.117 367.401 0.20 102.96 C
ATOM 79 HD2 TYR 4 332.226 8.041 368.177 1.00 102.96 H
ATOM 80 CE1 TYR 4 334.870 8.312 365.435 0.20 102.96 C
ATOM 81 HE1 TYR 4 335.622 8.388 364.664 1.00 102.96 H
ATOM 82 CE2 TYR 4 332.602 8.011 366.082 0.20 102.96 C
ATOM 83 HE2 TYR 4 331.565 7.849 365.827 1.00 102.96 H
ATOM 84 CZ TYR 4 333.556 8.105 365.096 0.20 102.96 C
ATOM 85 OH TYR 4 333.194 7.997 363.738 0.20 102.96 0
ATOM 86 HH TYR 4 334.000 8.027 363.216 1.00 102.96 H
ATOM 87 C TYR 4 333.472 10.564 369.324 0.20 102.96 C
ATOM 88 0 TYR 4 333.285 11.247 368.320 0.20 102.96 O
ATOM 89 N LYS 5 332.517 10.365 370.245 0.20 82.96 N
ATOM 90 H LYS 5 332.678 9.844 371.079 1.00 82.96 H
ATOM 91 CA LYS 5 331.205 10.923 370.105 0.20 82.96 C
ATOM 92 HA LYS 5 330.793 10.603 369.159 1.00 82.96 H
ATOM 93 CB LYS 5 330.286 10.548 371.279 0.20 82.96 C
ATOM 94 HB3 LYS 5 330.838 10.748 372.222 1.00 82.96 H
ATOM 95 HB2 LYS 5 329.390 11.202 371.263 1.00 82.96 H
ATOM 96 CG LYS 5 329.819 9.092 371.282 0.20 82.96 C ATOM 97 HG3 LYS 5 330.675 8.420 371.052 1.00 82.96 H
ATOM 98 HG2 LYS 5 329.052 8.965 370.487 1.00 82.96 H
ATOM 99 CD LYS 5 329.233 8.694 372.639 0.20 82.96 C
ATOM 100 HD3 LYS 5 330.058 8.714 373.384 1.00 82.96 H
ATOM 101 HD2 LYS 5 328.477 9.449 372.948 1.00 82.96
ATOM 102 CE LYS 5 328.581 7.308 372.660 0.20 82.96 C
ATOM 103 HE3 LYS 5 329.287 6.532 372.298 1.00 82.96 H
ATOM 104 HE2 LYS 5 328.247 7.051 373.688 1.00 82.96 H
ATOM 105 NZ LYS 5 327.386 7.287 371.785 0.20 82.96 N
ATOM 106 HZ1 LYS 5 326.968 6.335 371.789 1.00 82.96 H
ATOM 107 HZ2 LYS 5 327.659 7.539 370.813 1.00 82.96 H
ATOM 108 HZ3 LYS 5 326.686 7.972 372.136 1.00 82.96 H
ATOM 109 C LYS 5 331.289 12.414 370.118 0.20 82.96 C
ATOM 110 O LYS 5 330.610 13.075 369.335 0.20 82.96 O
ATOM 111 N ARG 6 332.130 12.982 371.007 0.20 91.69 N
ATOM 112 H ARG 6 332.721 12.454 371.610 1.00 91.69 H
ATOM 113 CA ARG 6 332.121 14.407 371.176 0.20 91.69 C
ATOM 114 HA ARG 6 331.141 14.696 371.527 1.00 91.69 H
ATOM 115 CB ARG 6 333.218 14.896 372.136 0.20 91.69 C
ATOM 116 HB3 ARG 6 334.208 14.595 371.729 1.00 91.69 H
ATOM 117 HB2 ARG 8 333.192 16.006 372.180 1.00 91.69 H
ATOM 118 CG ARG 6 333.105 14.356 373.562 0.20 91.69 C
ATOM 119 HG3 ARG 6 333.991 14.706 374.133 1.00 91.69 H
ATOM 120 HG2 ARG 6 333.124 13.244 373.541 1.00 91.69 H
ATOM 121 CD ARG 6 331.850 14.823 374.299 0.20 91.69 C
ATOM 122 HD3 ARG 6 331.778 15.932 374.305 1.00 91.69 H
ATOM 123 HD2 ARG 6 330.928 14.386 373.858 1.00 91.69 H
ATOM 124 NE ARG 6 331.961 14.361 375.713 0.20 91.69 N
ATOM 125 HE ARG 6 332.323 14.981 376.410 1.00 91.69 H
ATOM 126 CZ ARG 6 331.581 13.099 376.058 0.20 91.69 C
ATOM 127 NH1 ARG 6 331.093 12.244 375.112 0.20 91.69 N
ATOM 128 HH11 ARG 6 330.830 11.315 375.367 1.00 91.69 H
ATOM 129 HH12 ARG 6 331.004 12.546 374.162 1.00 91.69 H
ATOM 130 NH2 ARG 6 331.699 12.693 377.354 0.20 91.69 N
ATOM 131 HH21 ARG 6 332.065 13.321 378.041 1.00 91.69 H
ATOM 132 HH22 ARG 6 331.420 11.770 377.619 1.00 91.69 H
ATOM 133 C ARG 6 332 399 15.078 369.872 0.20 91.69 C
ATOM 134 0 ARG 6 331.567 15.827 369.364 0.20 91.69 O
ATOM 135 N ARG 7 333.574 14.815 369.281 0.20 272.70 N
ATOM 136 H ARG 7 334.255 14.196 369.666 1.00 272.70 H
ATOM 137 CA ARG 7 333.886 15.423 368.025 0.20 272.70 C
ATOM 138 HA ARG 7 334.541 14.573 367.905 1.00 272.70 H
ATOM 139 CB ARG 7 335.256 16.084 367.760 0.20 272.70 C
ATOM 140 HB3 ARG 7 335.614 16.579 368.688 1.00 272.70 H
ATOM 141 HB2 ARG 7 335.973 15.277 367.497 1.00 272.70 H ATOM 142 CG ARG 7 335.265 17.115 366.624 0.20 272.70 c
ATOM 143 HG3 ARG 7 336.329 17.321 366.381 1.00 272.70 H
ATOM 144 HG2 ARG 7 334.776 16.689 365.721 1.00 272.70 H
ATOM 145 CD ARG 7 334.638 18.470 366.976 0.20 272.70 C
ATOM 146 HD3 ARG 7 335.088 18.887 367.901 1.00 272.70 H
ATOM 147 HD2 ARG 7 334.773 19.190 366.141 1.00 272.70 H
ATOM 148 NE ARG 7 333.174 18.322 367.209 0.20 272.70 N
ATOM 149 HE ARG 7 332.713 17.460 367.003 1.00 272.70 H
ATOM 150 CZ ARG 7 332.468 19 392 367.683 0.20 272.70 C
ATOM 151 NH1 ARG 7 333.108 20.558 367.986 0.20 272.70 N
ATOM 152 HH11 ARG 7 332.587 21.341 368.328 1.00 272.70 H
ATOM 153 HH12 ARG 7 334.098 20.631 367.872 1.00 272.70 H
ATOM 154 NH2 ARG 7 331.117 19.299 367.854 0.20 272.70 N
ATOM 155 HH21 ARG 7 330.602 20.087 368.192 1.00 272.70 H
ATOM 156 HH22 ARG 7 330.642 18.450 367.628 1.00 272.70 H
ATOM 157 C ARG 7 333.109 14.928 366.860 0.20 272.70 C
ATOM 158 O ARG 7 332.702 15.685 365.979 0.20 272.70 O
ATOM 159 N LEU 8 332.877 13.605 366.858 0.20 101.17 N
ATOM 160 H LEU 8 333.188 13.024 367.804 1.00 101.17 H
ATOM 161 CA LEU 8 332.225 12.944 365.772 0.20 101.17 C
ATOM 162 HA LEU 8 332.296 11.881 365.950 1.00 101.17 H
ATOM 163 CB LEU 8 330.759 13.354 365.549 0.20 101.17 C
ATOM 164 HB3 LEU 8 330.169 13.168 366.475 1.00 101.17 H
ATOM 165 HB2 LEU 8 330.716 14.440 365.320 1.00 101.17 H
ATOM 166 CG LEU 8 330.141 12.560 364.384 0.20 101.17 C
ATOM 167 HG LEU 8 330.778 12.715 363.488 1.00 101.17 H
ATOM 168 CD1 LEU 8 330.138 11.062 364.716 0.20 101.17 C
ATOM 169 HD11 LEU 8 329.503 10.864 365.606 1.00 101.17 H
ATOM 170 HD12 LEU 8 331.170 10.714 364.935 1.00 101.17 H
ATOM 171 HD13 LEU 8 329.742 10.475 363.860 1.00 101.17 H
ATOM 172 CD2 LEU 8 328.728 13.061 364.047 0.20 101.17 C
ATOM 173 HD21 LEU 8 328.049 12.930 364.915 1.00 101.17 H
ATOM 174 HD22 LEU 8 328.321 12.488 363.188 1.00 101.17 H
ATOM 175 HD23 LEU 8 328.752 14.137 363.775 1.00 101.17 H
ATOM 176 C LEU 8 333.014 13.303 364.520 0.20 101.17 C
ATOM 177 0 LEU 8 332.412 13.866 363.567 0.20 101.17 0
ATOM 178 OXT LEU 8 334.242 13.022 364.505 1.00 101.17 0
END
Eine Interaktion kann vorzugsweise so erfolgen, dass die die Interaktion hemmende Verbindung mit dem ETR1 oder seiner Isoformen ERS1 , ETR2, ERS2, EIN4 oder einem homologen oder orthologen Protein davon wechselwirkt. Besonders bevorzugt bindet die die Interaktion hemmende Verbindung an ETR1 oder eine seiner Isoformen ERS1 , ETR2, ERS2, EIN4 oder an ein homologes oder orthoioges Protein davon. Dadurch wird insbesondere die Interaktion mit der nachgerichteten Signalkomponente EIN2 oder einem orthologen Protein davon verhindert. Methoden zur Bestimmung, ob eine Verbindung mit ETR1 oder seiner Isoformen ERS1 , ETR2, ERS2, EIN4 oder einem homologen oder einem orthologen Protein davon interagiert, vorzugsweise bindet, sind dem Fachmann bekannt. Insbesondere ist dazu die isotherme
Titrationskalorimetrie geeignet, wie sie beispielsweise in J. B. Chaires, Calorimetry and thermodynamics in drug design, Ann. Rev. Biophys., 37, 125-151 (2008) beschrieben ist. Weiterhin bevorzugte Methoden sind in M. A. Coopler, Label-free Screening of biomolecular interactions, Anal. Bioanal. Chem., 337, 834-842 (2003) und oder M. Jerabek-Willemsen et al, Molecular interaction studies using microscale
thermosphoresis, ASSAY and drug Development Technologies, 9 (201 1 ) 342-353 zu finden. Eine weitere bevorzugte Methode stellt die Thermophorese dar. In einer weiteren bevorzugten Ausführungsform weist die die Interaktion hemmende Verbindung eine Wasserlöslichkeit bei pH = 7 und 20 °C von mindestens 1 g/L, besonders bevorzugt mindestens 10 g/L, ganz besonders bevorzugt mindestens 50 g/L auf. In den bekannten Verfahren des Standes der Technik der kompetrtiven Hemmung der Rezeptoren durch Ethylenantagonisten, die an die
Ethylenbindungsstelle in der Membrandomäne der Rezeptoren binden, müssen die verwendeten Antagonisten hydrophobe Eigenschaften aufweisen. Dadurch sind die bekannten Ethylenantagonisten meist schlecht in Wasser löslich, was insbesondere die Formulierung von Lösungen zur Behandlung von Pflanzen und/oder deren
Früchten erschwert (Beispiel: Wasserlöslichkeit von 1 -MCP: 137mg/L bei pH = 7 und 20 °C). Es hat sich überraschenderweise herausgestellt, dass beim
erfindungsgemäßen Verfahren die Verwendung von Verbindungen mit einer
Wasserlöslichkeit von mindestens 1 g/L vorteilhaft ist. Dadurch ist insbesondere die Formulierung der Behandlungslösung wesentlich erleichtert, da auch Formulierung auf Wasser-Basis realisiert werden können.
In einer besonders bevorzugten Ausführungsform wird die die Interaktion hemmende Verbindung ausgewählt aus der Gruppe, bestehend aus einem Peptid, einem
Peptidmimetikum, einem Antikörper und/oder seinen Fragmenten und Mischungen dieser Verbindungen. Ganz besonders bevorzugt wird die die Interaktion hemmende Verbindung ausgewählt aus der Gruppe, bestehend aus einem Peptid, einem
Peptidmimetikum und Mischungen dieser Verbindungen.
Dabei ist es weiterhin bevorzugt, dass das Peptid, der Antikörper und/oder seine Fragmente eine isolierte Teilsequenz des Proteins EIN2 oder eines orthologen
Proteins davon oder eine Permutation dieser Teilsequenz umfasst oder dass das Peptidmimetikum eine am Peptidrückgrat modifizierte, isolierte Teilsequenz des Proteins EIN2 oder eines orthologen Proteins davon oder eine Permutation dieser Teilsequenz oder eine Permutation davon umfasst.
Dabei bedeutet der Begriff„isoliert" im Sinne dieser Erfindung insbesondere, dass die Teilsequenz des EIN2 oder des orthologen Proteins davon zwar natürlich in diesem Protein vorkommt, jedoch in einer aus dieser natürlichen Umgebung veränderten Form bereitgestellt wird. Dies bedeutet insbesondere, dass die Teilsequenz im Wesentlichen frei von anderen Substanzen ist, welche sie natürlicherweise umgeben. Dabei ist die Teilsequenz insbesondere frei von anderen Proteinen. Besonders bevorzugt wird die gegebenenfalls am Peptidrückgrat modifizierte isolierte Teilsequenz oder Permutation davon in einer hoch reinen Form von höher als 95 % Reinheit, besonders bevorzugt höher als 99 % Reinheit bereitgestellt.
Unter einer„Permutation" der Aminosäuresequenz im Sinne der Erfindung wird eine Permutation verstanden, welche nur bis zu dem Grad ausgeprägt ist, dass die resultierende Aminosäuresequenz die gleiche biologische Aktivität aufweist wie die Ursprungssequenz. Als Ursprungssequenz wird im vorliegenden Fall die betrachtete Teilsequenz des EIN2 oder eines orthologen Proteins davon, beziehungsweise auf die später Bezug genommenen Sequenzen SEQ ID NO: 1 bis 4 angenommen. Bevorzugt wird als Ursprungssequenz eine der Sequenzen der SEQ ID NO: 4, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 111 , SEQ ID NO: 112, SEQ ID NO: 113, SEQ ID NO: 114, SEQ ID NO: 115, SEQ ID NO: 116, SEQ ID NO: 117, SEQ ID NO: 118, SEQ ID NO: 119, SEQ ID NO: 120, SEQ ID NO: 121 , SEQ ID NO: 122, SEQ ID NO: 123 oder SEQ ID NO: 124 angenommen. Bevorzugt bedeutet eine Permutation einer Sequenz, dass die Hälfte, besonders bevorzugt 2/3, ganz besonders bevorzugt 3/4 und am bevorzugsten 90 % der Aminosäuren gegenüber der Ursprungssequenz nicht vertauscht sind. In einer besonders bevorzugten Ausführungsform umfasst das Peptid, der Antikörper und/oder seine Fragmente eine isolierte Teilsequenz oder eine Permutation davon, welche der Domäne des EIN2 entspricht, welche mit dem Rezeptorprotein ETR1 interagiert oder dass das Peptidmimetikum eine am Peptidrückgrat modifizierte, isolierte Teilsequenz oder eine Permutation davon umfasst, welche der Domäne des EIN2 entspricht, welche mit dem Rezeptorprotein ETR1 interagiert.
Weiterhin bevorzugt umfasst das Peptid, der Antikörper und/oder seine Fragmente mindestens eine Aminosäuresequenz, welche ausgewählt wird aus der Gruppe, bestehend aus der Aminosauresequenz SEQ ID NO: 1 , der Aminosäuresequenz SEQ ID NO: 2, der Aminosäuresequenz SEQ ID NO: 3, einer Permutation einer der
Aminosäuresequenzen SEQ ID NO: 1 bis SEQ ID NO: 3, einem Teil einer der
Aminosäuresequenzen SEQ ID NO: 1 bis SEQ ID NO: 3, welcher mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 6 der in SEQ ID NO: 1 bis SEQ ID NO: 3 genannten Aminosäuren umfasst, und einem Derivat einer der
Aminosäuresequenzen SEQ ID NO: 1 bis SEQ ID NO: 3 oder dass das
Peptidmimetikum mindestens eine am Peptidrückgrat modifizierte Amiriosäuresequenz umfasst, welche ausgewählt wird aus der Gruppe, bestehend aus der
Aminosäuresequenz SEQ ID NO: 1 , der Aminosäuresequenz SEQ ID NO: 2, der Aminosäuresequenz SEQ ID NO: 3, einer Permutation einer der
Aminosäuresequenzen SEQ ID NO: 1 bis SEQ ID NO: 3, einem Teil einer der
Aminosäuresequenzen SEQ ID NO: 1 bis SEQ ID NO: 3, welcher mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 8 der in SEQ ID NO: 1 bis SEQ ID NO: 3 genannten Aminosäuren umfasst, und einem Derivat einer der
Aminosäuresequenzen SEQ ID NO:1 bis SEQ ID NO: 3. Dabei sind Verbindungen ausgenommen, bei denen das Peptid oder der Antikörper und/oder dessen Fragment eine Aminosäuresequenz der SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101 oder SEQ ID NO: 102, und/oder einen Teil einer der
Aminosäuresequenzen SEQ ID NO: 98 bis SEQ ID NO: 102, welcher mindestens 6 der in SEQ ID NO: 98 bis SEQ ID NO: 102 genannten Aminosäuren umfasst und/oder eine Derivat der Aminosäuresequenzen SEQ ID NO: 98 bis 102 umfasst. Ebenso sind Verbindungen ausgenommen, bei denen das Peptidmimetikum aus einer am
Peptidrückgrat modifizierten Aminosäuresequenz besteht, welche ausgewählt wird aus der Gruppe, bestehend aus SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101 und SEQ ID NO: 102. Besonders bevorzugt sind auch Verbindungen ausgenommen, bei denen das Peptidmimetikum aus einer am Peptidrückgrat modifizierten Aminosäuresequenz besteht, welche ausgewählt wird aus einem Teil einer der Aminosäuresequenzen SEQ ID NO: 98 bis SEQ ID NO: 102, welcher mindestens 6 der in SEQ ID NO: 98 bis SEQ ID NO: 102 genannten Aminosäuren umfasst. Besonders bevorzugt sind auch Verbindungen ausgenommen, bei denen das Peptidmimetikum aus einer am Peptidrückgrat modifizierten Aminosäuresequenz besteht, welche ausgewählt wird aus einem Derivat der Aminosäuresequenzen SEQ ID NO: 98 bis 102 besteht.
Ebenso bevorzugt umfasst das Peptid, der Antikörper und/oder seine Fragmente mindestens eine Aminosäuresequenz, welche ausgewählt wird aus der Gruppe, bestehend aus der Aminosäuresequenz SEQ ID NO: 103, einem Teil der
Aminosäuresequenz SEQ ID NO: 103, welcher mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 6 der in SEQ ID NO: 103 genannten Aminosäuren umfasst, und einem Derivat der Aminosäuresequenz SEQ ID NO: 103, wobei, wenn die Aminosäuresequenz SEQ ID NO: 103 an einer Position Alanin umfasst, keine der anderen Aminosäuren der SEQ ID NO: 103 Alanin ist.
Des Weiteren bevorzugt umfasst das Peptid, der Antikörper und/oder seine Fragmente mindestens eine Aminosäuresequenz, welche ausgewählt wird aus der Gruppe, bestehend aus der Aminosäuresequenz SEQ ID NO: 103, einem Teil der
Aminosäuresequenz SEQ ID NO: 103, welcher mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 6 der in SEQ ID NO: 103 genannten Aminosäuren umfasst, und einem Derivat der Aminosäuresequenz SEQ ID NO: 103, unter der Voraussetzung, wobei, wenn die Aminosäuresequenz SEQ ID NO: 103 an einer Position Alanin umfasst, keine der anderen Aminosäuren der SEQ ID NO: 103 Alanin ist und unter der Voraussetzung, dass, wenn die in der SEQ ID NO: 03 mit Nr. 6 und Nr. 7 gekennzeichneten Positionen vorhanden sind, diese entweder beide Arginin oder beide Histidin sind.
Im Sinne der vorliegenden Erfindung bedeutet die„Position" einer Aminosäure, die Stelle, welche sich beim Lesen der Sequenz von links nach rechts unter Abzählung der Aminosäuren ergibt. So umfasst beispielsweise ein Oktapeptid von links nach rechts die Positionen 1 bis 8. Wenn im Sinne der vorliegenden Erfindung von Alanin an einer Position gesprochen wird, so bedeutet dies, dass in der angegeben SEQ ID gemäß ihrer Definition mindestens eine Aminosäure Alanin sein kann. Enthält die Sequenz aber an einer Steile Alanin, so enthält sie an keiner anderen der gemäß der SEQ ID möglichen Stellen als Aminosäure Alanin. Dies bedeutet, dass von den definierten Auswahlmöglichkeiten die Aminosäure Alanin bevorzugt nur einmal ausgewählt werden kann. Ebenso bevorzugt umfasst das Peptid, der Antikörper und/oder seine Fragmente mindestens eine Aminosäuresequenz, welche ausgewählt wird aus der Gruppe, bestehend aus der Aminosäuresequenz SEQ ID NO: 104, einem Teil der
Aminosäuresequenz SEQ ID NO: 104, welcher mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 6 der in SEQ ID NO: 104 genannten Aminosäuren umfasst, und einem Derivat der Amiriosäuresequenz SEQ ID NO: 104, wobei, wenn die Aminosäuresequenz SEQ ID NO: 104 an einer Position Alanin umfasst, keine der anderen Aminosäuren der SEQ ID NO: 104 Alanin ist
Des Weiteren bevorzugt umfasst das Peptid, der Antikörper und/oder seine Fragmente mindestens eine Aminosäuresequenz, welche ausgewählt wird aus der Gruppe, bestehend aus der Aminosäuresequenz SEQ ID NO: 104, einem Teil der
Aminosäuresequenz SEQ ID NO: 104, welcher mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 6 der in SEQ ID NO: 104 genannten Aminosäuren umfasst, und einem Derivat der Aminosäuresequenz SEQ ID NO: 104, unter der Voraussetzung, wobei, wenn die Aminosäuresequenz SEQ ID NO: 104 an einer
Position Alanin umfasst, keine der anderen Aminosäuren der SEQ ID NO: 104 Alanin ist und unter der Voraussetzung, dass, wenn die in der SEQ ID NO: 104 mit Nr. 6 und Nr. 7 gekennzeichneten Positionen vorhanden sind, diese entweder beide Arginin oder beide Histidin sind.
Ebenso bevorzugt umfasst das Peptid, der Antikörper und/oder seine Fragmente mindestens eine Aminosäuresequenz, welche ausgewählt wird aus der Gruppe, bestehend aus der Aminosäuresequenz SEQ ID NO: 105, einem Teil der
Aminosäuresequenz SEQ ID NO: 105, welcher mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 6 der in SEQ ID NO: 105 genannten Aminosäuren umfasst» und einem Derivat der Aminosäuresequenz SEQ ID NO: 105, wobei» wenn die Aminosäuresequenz SEQ ID NO: 105 an einer Position Alanin umfasst, keine der anderen Aminosäuren der SEQ ID NO: 105 Alanin ist.
Ebenso bevorzugt umfasst das Peptid, der Antikörper und/oder seine Fragmente mindestens eine Aminosäuresequenz» welche ausgewählt wird aus der Gruppe, bestehend aus der Aminosäuresequenz SEQ ID NO: 106, einem Teil der
Amiriosäuresequenz SEQ ID NO: 106, welcher mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 6 der in SEQ ID NO: 108 genannten Aminosäuren umfasst» und einem Derivat der Aminosäuresequenz SEQ ID NO: 106» wobei, wenn die Aminosäuresequenz SEQ ID NO: 108 an einer Position Alanin umfasst, keine der anderen Aminosäuren der SEQ ID NO: 106 Alanin ist. Ebenso bevorzugt umfasst das Peptid, der Antikörper und/oder seine Fragmente mindestens eine Aminosäuresequenz» welche ausgewählt wird aus der Gruppe, bestehend aus der Aminosäuresequenz SEQ ID NO: 107, einem Teil der
Aminosäuresequenz SEQ ID NO: 107, welcher mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 8 der in SEQ ID NO: 107 genannten Aminosäuren umfasst, und einem Derivat der Aminosäuresequenz SEQ ID NO: 1087, wobei, wenn die Aminosäuresequenz SEQ ID NO: 107 an einer Position Alanin umfasst, keine der anderen Aminosäuren der SEQ ID NO: 107 Alanin ist.
Ebenso bevorzugt umfasst das Peptid, der Antikörper und/oder seine Fragmente mindestens eine Aminosäuresequenz, welche ausgewählt wird aus der Gruppe, bestehend aus der Aminosäuresequenz SEQ ID NO: 108» einem Teil der
Aminosäuresequenz SEQ ID NO: 108, weicher mindestens 4» bevorzugt mindestens 5, besonders bevorzugt mindestens 6 der in SEQ ID NO: 108 genannten Aminosäuren umfasst, und einem Derivat der Aminosäuresequenz SEQ ID NO: 108, wobei, wenn die Aminosäuresequenz SEQ ID NO: 108 an einer Position Alanin umfasst, keine der anderen Aminosäuren der SEQ ID NO: 108 Alanin ist.
Am bevorzugsten umfasst das Peptid, der Antikörper und/oder seine Fragmente mindestens eine Aminosäuresequenz, welche ausgewählt wird aus der Gruppe, bestehend aus SEQ ID NO: 4, SEQ ID NO: 109, SEQ ID NO: 1 10, SEQ ID NO: 11 1 , SEQ ID NO: 1 12, SEQ ID NO: 1 13, SEQ ID NO: 1 14, SEQ ID NO: 1 15, SEQ ID NO: 1 16, SEQ ID NO: 1 17, SEQ ID NO: 1 18, SEQ ID NO: 1 19, SEQ ID NO: 120, SEQ ID NO: 121 , SEQ ID NO: 122, SEQ ID NO: 123 und SEQ ID NO: 124, einer Permutation einer der Aminosäuresequenzen SEQ ID NO: 4, SEQ ID NO: 109, SEQ ID NO: 1 10, SEQ ID NO: 1 1 1 , SEQ ID NO: 1 12, SEQ ID NO: 1 13, SEQ ID NO: 1 14, SEQ ID NO: 1 15, SEQ ID NO: 1 16, SEQ ID NO: 1 17, SEQ ID NO: 1 18, SEQ ID NO: 1 19, SEQ ID NO: 120, SEQ ID NO: 121 , SEQ ID NO: 122, SEQ ID NO: 123 und SEQ ID NO: 124, einem Teil einer der Aminosäuresequenzen SEQ ID NO: 4, SEQ ID NO: 109, SEQ ID NO: 1 10, SEQ ID NO: 1 1 1 , SEQ ID NO: 1 12, SEQ ID NO: 1 13, SEQ ID NO: 1 14, SEQ ID NO: 1 15, SEQ ID NO: 1 16, SEQ ID NO: 1 17, SEQ ID NO: 1 18, SEQ ID NO: 1 19, SEQ ID NO: 120, SEQ ID NO: 121 , SEQ ID NO: 122, SEQ ID NO: 123 und SEQ ID NO: 124, welcher mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 6 der in SEQ ID NO: 4, SEQ ID NO: 109 bis SEQ ID NO: 124 genannten Aminosäuren umfasst, und einem Derivat einer der Amiriosäuresequenzen SEQ ID NO: 4, SEQ ID NO: 109, SEQ ID NO: 1 10, SEQ ID NO: 1 11 , SEQ ID NO: 1 12, SEQ ID NO: 1 13, SEQ ID NO: 1 14, SEQ ID NO: 1 15, SEQ ID NO: 1 16, SEQ ID NO: 1 17, SEQ ID NO: 1 18, SEQ ID NO: 1 19, SEQ ID NO: 120, SEQ ID NO: 121 , SEQ ID NO: 122, SEQ ID NO: 123 und SEQ ID NO: 124.
Ebenso bevorzugt wird das Aptamer auf Basis der Zielstruktur eines Peptids hergestellt, wobei das Peptid ausgewählt wird, aus der Aminosäuresequenz SEQ ID NO: 1 , der Aminosäuresequenz SEQ ID NO: 2, der Amiriosäuresequenz SEQ ID NO: 3, einer Permutation einer der Aminosäuresequenzen SEQ ID NO: 1 bis SEQ ID NO: 3, einem Teil einer der Aminosäuresequenzen SEQ ID NO: 1 bis SEQ ID NO: 3, welcher mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 6 der in SEQ ID NO: 1 bis SEQ ID NO: 3 genannten Aminosäuren umfasst, und einem Derivat einer der Aminosäuresequenzen SEQ ID NO: 1 bis SEQ ID NO: 3. Dabei sind Verbindungen ausgenommen, bei denen ein Aptamer auf Basis der Zielstruktur eines Peptids hergestellt wird, wobei das Peptid ausgewählt wird aus der Gruppe, bestehend aus SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100 SEQ ID NO: 101 und SEQ ID NO: 102. Bevorzugt sind auch Verbindungen ausgenommen, bei denen ein Aptamer auf Basis der Zielstruktur eines Peptids hergestellt wird, wobei das Peptid aus einem Teil einer der Aminosäuresequenzen SEQ ID NO: 98 bis SEQ ID NO: 102, welcher mindestens 6 der in SEQ ID NO: 98 bis SEQ ID NO: 102 genannten Aminosäuren umfasst, besteht. Bevorzugt sind auch Verbindungen ausgenommen, bei denen ein Aptamer auf Basis der Zielstruktur eines Peptids hergestellt wird, wobei das Peptid aus einem Derivat der Aminosäuresequenzen SEQ ID NO: 98 bis 102 besteht.
Ebenso bevorzugt wird das Aptamer auf Basis der Zielstruktur eines Peptids hergestellt, wobei das Peptid ausgewählt wird, aus der Gruppe, bestehend aus der Aminosäuresequenz SEQ ID NO: 103, einem Teil der Aminosäuresequenz SEQ ID NO: 103, welcher mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 6 der in SEQ ID NO: 103 genannten Aminosäuren umfasst, und einem Derivat der Aminosäuresequenz SEQ ID NO: 103, wobei, wenn die
Aminosäuresequenz SEQ ID NO: 103 an einer Position Alanin umfasst, keine der anderen Aminosäuren der SEQ ID NO: 103 Alanin ist. Ebenso bevorzugt wird das Aptamer auf Basis der Zielstruktur eines Peptids
hergestellt, wobei das Peptid ausgewählt wird, aus der Gruppe, bestehend aus der Aminosäuresequenz SEQ ID NO: 103, einem Teil der Aminosäuresequenz SEQ ID NO: 103, welcher mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 6 der in SEQ ID NO: 103 genannten Aminosäuren umfasst, und einem Derivat der Aminosäuresequenz SEQ ID NO: 103, unter der Voraussetzung, wobei, wenn die Aminosäuresequenz SEQ ID NO: 103 an einer Position Alanin umfasst, keine der anderen Aminosäuren der SEQ ID NO: 103 Alanin ist und unter der
Voraussetzung, dass, wenn die in der SEQ ID NO: 103 mit Nr. 6 und Nr. 7
gekennzeichneten Positionen vorhanden sind, diese entweder beide Arginin oder beide Histidin sind.
Ebenso bevorzugt wird das Aptamer auf Basis der Zielstruktur eines Peptids
hergestellt, wobei das Peptid ausgewählt wird, aus der Gruppe, bestehend aus der Aminosäuresequenz SEQ ID NO: 104, einem Teil der Aminosäuresequenz SEQ ID NO: 104, welcher mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 6 der in SEQ ID NO: 104 genannten Aminosäuren umfasst, und einem Derivat der Aminosäuresequenz SEQ ID NO: 104, wobei, wenn die
Aminosäuresequenz SEQ ID NO: 104 an einer Position Alanin umfasst, keine der anderen Aminosäuren der SEQ ID NO: 104 Alanin ist. Ebenso bevorzugt wird das Aptamer auf Basis der Zielstruktur eines Peptids hergestellt, wobei das Peptid ausgewählt wird, aus der Gruppe, bestehend aus der Aminosäuresequenz SEQ ID NO: 104, einem Teil der Aminosäuresequenz SEQ ID NO: 104, welcher mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 6 der in SEQ ID NO: 104 genannten Aminosäuren umfasst, und einem Derivat der Aminosäuresequenz SEQ ID NO: 104, unter der Voraussetzung, wobei, wenn die Aminosäuresequenz SEQ ID NO: 104 an einer Position Alanin umfasst, keine der anderen Aminosäuren der SEQ ID NO: 104 Alanin ist und unter der Voraussetzung, dass, wenn die in der SEQ ID NO: 104 mit Nr. 6 und Nr. 7 gekennzeichneten Positionen vorhanden sind, diese entweder beide Arginin oder beide Histidin sind.
Ebenso bevorzugt wird das Aptamer auf Basis der Zielstruktur eines Peptids hergestellt, wobei das Peptid ausgewählt wird, aus der Gruppe, bestehend aus der Aminosäuresequenz SEQ ID NO: 105, einem Teil der Aminosäuresequenz SEQ ID NO: 105, welcher mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 6 der in SEQ ID NO: 105 genannten Aminosäuren umfasst, und einem Derivat der Aminosäuresequenz SEQ ID NO: 105, wobei, wenn die
Aminosäuresequenz SEQ ID NO: 105 an einer Position Alanin umfasst, keine der anderen Aminosäuren der SEQ ID NO: 105 Alanin ist.
Ebenso bevorzugt wird das Aptamer auf Basis der Zielstruktur eines Peptids hergestellt, wobei das Peptid ausgewählt wird, aus der Gruppe, bestehend aus der Aminosäuresequenz SEQ ID NO: 106, einem Teil der Aminosäuresequenz SEQ ID NO: 106, welcher mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 6 der in SEQ ID NO: 106 genannten Aminosäuren umfasst, und einem Derivat der Aminosäuresequenz SEQ ID NO: 106, wobei, wenn die
Aminosäuresequenz SEQ ID NO: 106 an einer Position Alanin umfasst, keine der anderen Aminosäuren der SEQ ID NO: 106 Alanin ist.
Ebenso bevorzugt wird das Aptamer auf Basis der Zielstruktur eines Peptids hergestellt, wobei das Peptid ausgewählt wird, aus der Gruppe, bestehend aus der Aminosäuresequenz SEQ ID NO: 107, einem Teil der Aminosäuresequenz SEQ ID NO: 107, welcher mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 6 der in SEQ ID NO: 107 genannten Aminosäuren umfasst, und einem Derivat der Aminosäuresequenz SEQ ID NO: 107, wobei, wenn die
Aminosäuresequenz SEQ ID NO: 107 an einer Position Alanin umfasst, keine der anderen Aminosäuren der SEQ ID NO: 107 Alanin ist.
Ebenso bevorzugt wird das Aptamer auf Basis der Zielstruktur eines Peptids hergestellt, wobei das Peptid ausgewählt wird, aus der Gruppe, bestehend aus der Aminosäuresequenz SEQ ID NO: 108, einem Teil der Aminosäuresequenz SEQ ID NO: 108, welcher mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 6 der in SEQ ID NO: 108 genannten Aminosäuren umfasst, und einem Derivat der Aminosäuresequenz SEQ ID NO: 108, wobei, wenn die
Aminosäuresequenz SEQ ID NO: 108 an einer Position Alanin umfasst, keine der anderen Aminosäuren der SEQ ID NO: 108 Alanin ist.
Am bevorzugsten wird das Aptamer auf Basis der Zielstruktur eines Peptids
hergestellt, wobei das Peptid ausgewählt wird, aus der Gruppe, bestehend aus SEQ ID NO: 4, SEQ ID NO: 109, SEQ ID NO: 1 10, SEQ ID NO: 1 11 , SEQ ID NO: 1 12, SEQ ID NO: 1 13, SEQ ID NO: 1 14, SEQ ID NO: 1 15, SEQ ID NO 1 16, SEQ ID NO: 1 1 7, SEQ ID NO: 1 18, SEQ ID NO: 1 19, SEQ ID NO: 120, SEQ ID NO: 121 , SEQ ID NO: 122, SEQ ID NO: 123 und SEQ ID NO: 124, einer Permutation einer der
Aminosäuresequenzen SEQ ID NO: 4, SEQ ID NO: 109, SEQ ID NO: 1 10, SEQ ID NO: 1 1 1 , SEQ ID NO: 1 12, SEQ ID NO: 1 13, SEQ ID NO: 1 14, SEQ ID NO: 1 15, SEQ ID NO: 1 16, SEQ ID NO: 1 17, SEQ ID NO: 1 18, SEQ ID NO: 119, SEQ ID NO: 120, SEQ ID NO: 121 , SEQ ID NO: 122, SEQ ID NO: 123 und SEQ ID NO: 124, einem Teil einer der Aminosäuresequenzen SEQ ID NO: 4, SEQ ID NO: 109, SEQ ID NO: 1 10, SEQ ID NO: 1 1 1 , SEQ ID NO: 112, SEQ ID NO: 1 13, SEQ ID NO: 1 14, SEQ ID NO: 1 15, SEQ ID NO: 1 16, SEQ ID NO: 1217, SEQ ID NO: 1 18, SEQ ID NO: 1 19, SEQ ID NO: 120, SEQ ID NO: 121 , SEQ ID NO: 122, SEQ ID NO: 123 und SEQ ID NO: 124, welcher mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 6 der in SEQ ID NO: 4, SEQ ID NO: 109 bis SEQ ID NO: 124 genannten Aminosäuren umfasst, und einem Derivat einer der Aminosäuresequenzen SEQ ID NO: 4, 1 SEQ ID NO: 109, SEQ ID NO: 1 10, SEQ ID NO: 1 1 1 , SEQ ID NO: 1 12, SEQ ID NO: 1 13, SEQ ID NO: 1 14, SEQ ID NO: 1 15, SEQ ID NO: 1 16, SEQ ID NO: 1 17, SEQ ID NO: 1 18, SEQ ID NO: 119, SEQ ID NO: 120, SEQ ID NO: 121 , SEQ ID NO: 122, SEQ ID NO: 123 und SEQ ID NO: 124.
Ganz besonders bevorzugt wird das Aptamer auf Basis der Zielstruktur eines Peptids hergestellt, wobei das Peptid ausgewählt wird» aus der Gruppe, bestehend aus SEQ ID NO: 4, einer Permutation der Aminosäuresequenz SEQ ID NO: 4, einem Teil der Aminosäuresequenz SEQ ID NO: 4, welcher mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 6 der in SEQ ID NO: 4 genannten Aminosäuren umfasst, und einem Derivat der Aminosäuresequenz SEQ ID NO: 4.
Dabei ist es insbesondere bevorzugt, dass das Peptid, der Antikörper und/oder seine Fragmente zusätzlich zu der mindestens einen genannten Aminosäuresequenz mindestens 4 weitere, bevorzugt mindestens 3 weitere, ganz besonders bevorzugt mindestens 2 weitere natürliche Aminosäuren umfasst. Bevorzugt bedeutet der Begriff „umfassen", dass die Sequenz aus 4 weiteren Aminosäuren, bevorzugt mindestens 3 weiteren, ganz besonders bevorzugt mindestens 2 weiteren, am bevorzugsten 2 weiteren natürlichen Aminosäuren zu denen in der entsprechenden
Aminosäuresequenz angegebenen. Als Derivat einer Aminosäuresequenz wird vorzugsweise eine Verbindung angesehen, welche an mindestens einem Terminus, also ihrem C- und/oder N-Terminus der Sequenz eine organische Gruppe, welche verschieden von einer Aminosäure ist, aufweist. Diese organische Gruppe kann vorzugsweise RY- sein, wobei R ein hydrophober Rest ist und Y ein Spacer, der an den C- und/oder N-Terminus gebunden ist. Dabei ist es besonders bevorzugt, dass das resultierende Derivat der
Aminosäuresequenz eine Löslichkeit von mindestens 1 g/L bei 20 °C und pH = 7 aufweist. Y ist vorzugsweise ausgewählt aus der Gruppe, bestehend aus -O-, -C(=O)- oder -C(=0)-NH-. R ist vorzugsweise ein aliphatischer oder aromatischer, linearer, verzweigter oder zyklischer Kohlenwasserstoffrest, der gegebenenfalls Alkenyl- oder Alkynylgruppen aufweisen kann. Besonders bevorzugt umfasst der
Kohlenwasserstoffrest 2 bis 12 Kohlenstoffatome. Dabei ist die Gruppe RY- je nachdem, wo sie vorhanden ist, am C-Terminus gleich oder verschieden zu der Gruppe R-Y am N-Terminus sein. In einer Ausführungsform stellt das Peptidmimetikum insbesondere ein Peptoid oder D-Peptid dar, welche eine ähnliche biologische Aktivität wie eine Aminosäuresequenz aufweisen, welche ausgewählt wird aus der Gruppe, bestehend aus der
Aminosäuresequenz SEQ ID NO: 1 , der Aminosäuresequenz SEQ ID NO: 2, der Aminosäuresequenz SEQ ID NO: 3, einer Permutation einer der
Aminosäuresequenzen SEQ ID NO: 1 bis SEQ ID NO: 3, einem Teil einer der
Aminosäuresequenzen SEQ ID NO: 1 bis SEQ ID NO: 3, welcher mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 8 der in SEQ ID NO: 1 bis SEQ ID NO: 3 genannten Aminosäuren umfasst, und einem Derivat einer der
Aminosäuresequenzen SEQ ID NO: 1 bis SEQ ID NO: 3. Dabei sind Verbindungen ausgenommen, bei denen das Peptidmimetikum aus einer am Peptidrückgrat
modifizierten Aminosäuresequenz besteht, welche ausgewählt wird aus der Gruppe, bestehend aus SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101 und SEQ ID NO: 102. Bevorzugt sind auch Verbindungen ausgenommen, bei denen das Peptidmimetikum aus einer am Peptidrückgrat modifizierten Aminosäuresequenz besteht, welche ausgewählt wird aus einem Teil einer der Aminosäuresequenzen SEQ ID NO: 98 bis SEQ ID NO: 102, welcher mindestens 6 der in SEQ ID NO: 98 bis SEQ ID NO: 102 genannten Aminosäuren umfasst. Bevorzugt sind auch Verbindungen ausgenommen, bei denen das Peptidmimetikum aus einer am Peptidrückgrat modifizierten Aminosäuresequenz besteht, welche ausgewählt wird aus einem Derivat der Amiriosäuresequenzen SEQ ID NO: 98 bis 102.
In einer anderen Ausführungsform stellt das Peptidmimetikum insbesondere ein Peptoid oder D-Peptid dar, welche eine ähnliche biologische Aktivität wie eine
Aminosäuresequenz aufweisen, welche ausgewählt wird aus der Gruppe, bestehend aus der Aminosäuresequenz SEQ ID NO: 103, einem Teil der Aminosäuresequenz SEQ ID NO: 103, welcher mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 8 der in SEQ ID NO: 103 genannten Aminosäuren umfasst, und einem Derivat der Aminosäuresequenz SEQ ID NO: 103, wobei, wenn die
Aminosäuresequenz SEQ ID NO: 103 an einer Position Alanin umfasst, keine der anderen Aminosäuren der SEQ ID NO: 103 Aianin ist.
Bevorzugt stellt das Peptidmimetikum insbesondere ein Peptoid oder D-Peptid dar, welche eine ähnliche biologische Aktivität wie eine Aminosäuresequenz aufweisen, welche ausgewählt wird aus der Gruppe, bestehend aus der Aminosäuresequenz SEQ ID NO: 103, einem Teil der Aminosäuresequenz SEQ ID NO: 103, welcher mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 8 der in SEQ ID NO: 103 genannten Aminosäuren umfasst, und einem Derivat der Amiriosäuresequenz SEQ ID NO: 103, unter der Voraussetzung, wobei, wenn die Aminosäuresequenz SEQ ID NO: 103 an einer -Position Alanin umfasst,' keine der anderen Aminosäuren der SEQ ID NO: 103 Alanin ist und unter der Voraussetzung, dass, wenn die in der SEQ ID NO: 103 mit Nr. 6 und Nr, 7 gekennzeichneten Positionen vorhanden sind, diese entweder beide Arginin oder beide Histidin sind.
Ebenso bevorzugt stellt das Peptidmimetikum insbesondere ein Peptoid oder D-Peptid dar, welche eine ähnliche biologische Aktivität wie eine Aminosäuresequenz
aufweisen, welche ausgewählt wird aus der Gruppe, bestehend aus der
Aminosäuresequenz SEQ ID NO: 104, einem Teil der Aminosäuresequenz SEQ ID NO: 104, welcher mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 6 der in SEQ ID NO: 104 genannten Aminosäuren umfasst, und einem Derivat der Aminosäuresequenz SEQ ID NO: 101 , wobei, wenn die
Aminosäuresequenz SEQ ID NO: 101 an einer Position Alanin umfasst, keine der anderen Aminosäuren der SEQ ID NO: 101 Alanin ist.
Ebenso bevorzugt stellt das Peptidmimetikum insbesondere ein Peptoid oder D-Peptid dar, welche eine ähnliche biologische Aktivität wie eine Aminosäuresequenz
aufweisen, weiche ausgewählt wird aus der Gruppe, bestehend aus der
Aminosäuresequenz SEQ ID NO: 104, einem Teil der Aminosäuresequenz SEQ ID NO: 104, welcher mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 6 der in SEQ ID NO: 104 genannten Aminosäuren umfasst, und einem Derivat der Aminosäuresequenz SEQ ID NO: 104, unter der Voraussetzung, wobei, wenn die Aminosäuresequenz SEQ ID NO: 104 an einer Position Alanin umfasst, keine der anderen Aminosäuren der SEQ ID NO: 104 Alanin ist und unter der
Voraussetzung, dass, wenn die in der SEQ iD NO: 104 mit Nr. 6 und Nr. 7
gekennzeichneten Positionen vorhanden sind, diese entweder beide Arginin oder beide Histidin sind. Ebenso bevorzugt stellt das Peptidmimetikum insbesondere ein Peptoid oder D-Peptid dar, weiche eine ähnliche biologische Aktivität wie eine Aminosäuresequenz aufweisen» welche ausgewählt wird aus der Gruppe, bestehend aus der
Aminosäuresequenz SEQ ID NO: 105, einem Teil der Aminosäuresequenz SEQ ID NO: 105, welcher mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 6 der in SEQ ID NO: 105 genannten Aminosäuren umfasst, und einem Derivat der Amiriosäuresequenz SEQ ID NO: 05, wobei, wenn die
Aminosäuresequenz SEQ ID NO: 05 an einer Position Alanin umfasst, keine der anderen Aminosäuren der SEQ ID NO: 105 Alanin ist.
Ebenso bevorzugt stellt das Peptidmimetikum insbesondere ein Peptoid oder D-Peptid dar, welche eine ähnliche biologische Aktivität wie eine Aminosäuresequenz aufweisen, welche ausgewählt wird aus der Gruppe, bestehend aus der
Aminosäuresequenz SEQ ID NO. 106, einem Teil der Aminosäuresequenz SEQ ID NO: 106, welcher mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 6 der in SEQ ID NO: 106 genannten Aminosäuren umfasst, und einem Derivat der Aminosäuresequenz SEQ ID NO: 106, wobei, wenn die
Aminosäuresequenz SEQ ID NO: 106 an einer Position Alanin umfasst, keine der anderen Aminosäuren der SEQ ID NO: 106 Alanin ist.
Ebenso bevorzugt stellt das Peptidmimetikum insbesondere ein Peptoid oder D-Peptid dar, welche eine ähnliche biologische Aktivität wie eine Aminosäuresequenz aufweisen, welche ausgewählt wird aus der Gruppe, bestehend aus der
Aminosäuresequenz SEQ ID NO: 107, einem Teil der Aminosäuresequenz SEQ ID NO: 107, welcher mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 6 der in SEQ ID NO: 107 genannten Aminosäuren umfasst, und einem Derivat der Aminosäuresequenz SEQ ID NO: 107, wobei, wenn die
Aminosäuresequenz SEQ ID NO: 107 an einer Position Alanin umfasst, keine der anderen Aminosäuren der SEQ ID NO: 107 Alanin ist.
Ebenso bevorzugt stellt das Peptidmimetikum insbesondere ein Peptoid oder D- Peptid dar, welche eine ähnliche biologische Aktivität wie eine Aminosäuresequenz
aufweisen, welche ausgewählt wird aus der Gruppe, bestehend aus der
Aminosäuresequenz SEQ ID NO: 108, einem Teil der Aminosäuresequenz SEQ ID NO: 108, welcher mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 6 der in SEQ ID NO: 108 genannten Aminosäuren umfasst, und einem Derivat der Amiriosäuresequenz SEQ ID NO: 108, wobei, wenn die
Aminosäuresequenz SEQ ID NO: 108 an einer Position Alanin umfasst, keine der arideren Aminosäuren der SEQ ID NO: 108 Alanin ist.
Am bevorzugsten stellt das Peptidmimetikum insbesondere ein Peptoid oder D-Peptid dar, welche eine ähnliche biologische Aktivität wie eine Aminosäuresequenz
aufweisen, welche ausgewählt wird aus der Gruppe, bestehend aus SEQ ID NO: 4, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 1 11 , SEQ ID NO: 112, SEQ ID NO: 113, SEQ ID NO: 114, SEQ ID NO: 1 15, SEQ ID NO: 1 16, SEQ ID NO: 117, SEQ ID NO: 118, SEQ ID NO: 1 19, SEQ ID NO: 120, SEQ ID NO: 121 , SEQ ID NO: 122, SEQ ID NO: 123 und SEQ ID NO: 124, einer Permutation einer der Äminosäuresequenzen SEQ ID NO: 4, SEQ ID NO: 109, SEQ ID NO: 1 10, SEQ ID NO: 1 11 , SEQ ID NO: 1 12, SEQ ID NO: 1 13, SEQ ID NO: 114, SEQ ID NO: 1 15, SEQ ID NO: 116, SEQ ID NO: 117, SEQ ID NO: 1 18, SEQ ID NO: 119, SEQ ID NO: 120, SEQ ID NO: 121 , SEQ ID NO: 122, SEQ ID NO: 123 und SEQ ID NO: 124, einem Teil einer der
Aminosäuresequenzen SEQ ID NO: 4, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 111 , SEQ ID NO: 112, SEQ ID NO: 1 13, SEQ ID NO: 1 14, SEQ ID NO: 115, SEQ ID NO: 116, SEQ ID NO: 117, SEQ ID NO: 1 18, SEQ ID NO: 119, SEQ ID NO: 120, SEQ ID NO: 121 , SEQ ID NO: 122, SEQ ID NO: 123 und SEQ ID NO: 124, welcher mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 6 der in SEQ ID NO: 4, SEQ ID NO: 109 bis SEQ ID NO: 124 genannten Aminosäuren umfasst, und einem Derivat einer der Aminosäuresequenzen SEQ ID NO: 4, SEQ ID NO: 109, SEQ ID NO: 1 10, SEQ ID NO: 111 , SEQ ID NO: 1 12, SEQ ID NO: 1 13, SEQ ID NO: 114, SEQ ID NO: 115, SEQ ID NO: 116, SEQ ID NO: 117, SEQ ID NO: 118, SEQ ID NO: 1 19, SEQ ID NO: 120, SEQ ID NO: 121 , SEQ ID NO: 122, SEQ ID NO: 123 und SEQ ID NO: 124.
Die Amiriosäuresequenz SEQ ID NO: 1 kann ebenso dargestellt werden als Sequenz xx[PLVIF][KR][RKW]x[RK][RK][RK][PL]xx
In diesem Fall steht jedes x für eine beliebige natürliche Aminosäure. Zusätzlich zu den proteinogenen Aminosäuren umfasst x vorzugsweise auch natürliche, nicht- proteinogene in Pflanzen vorkommende Aminosäuren. Bevorzugt kann jedes x unabhängig voneinander ausgewählt werden, aus der Gruppe bestehend aus Alanin, Arginin, Asparagin, Asparaginsäure, Cystein, Glutamin, Glutaminsäure, Glycin, Histidin, Isoleucin, Leucin, Lysin, Methionin, Phenylalanin, Prolin, Serin, Threonin, Tryptophan, Tyrosin, Valin, Citrullin, Ornithin, ε-Acetyl-lysin, 3-Aminopropionsäure (ß- Alanin), Aminobenzoesäure, 6-Aminocapronsäure, Aminobuttersäure, Hydroxyprolin, Mercaptopropionsäure, 3-Nitro-tyrosin, Norleucin und Pyroglutaminsäure. Die eckigen Klammern der genannten Sequenz bedeuten, dass die tatsächliche Aminosäure ausgewählt werden kann aus den in der eckigen Klammer genannten Aminosäuren. Damit sind die in einer eckigen Klammer genannten Aminosäuren als mit einem„oder" verknüpft zu verstehen. Die genannten Aminosäuren entsprechen dem
Einbuchstabencode für Aminosäuren, in dem P für Prolin, L für Leucin, V für Valin, I für Isoleucin, F für Phenylalanin, K für Lysin, R für Arginin und W für Tryptophan steht. Dabei umfasst die Aminosäuresequenz SEQ ID NO: 1 keine Aminosäuresequenz, welche ausgewählt wird aus der Gruppe, bestehend aus SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101 und SEQ ID NO: 102.
Demgemäß kann die Aminosäuresequenz SEQ ID NO: 2 auch dargestellt werden als x[PLVIF][KR][RKW]x[RK][RK][RK][PL]x und die Aminosäuresequenz SEQ ID NO: 3 auch als
[PLVIF][KR][RKW]x[RK][RK][RK][PL]
Dabei umfassen die Aminosäuresequenzen SEQ ID NO: 2 und/oder 3 keine
Aminosäuresequenz, welche ausgewählt wird aus der Gruppe, bestehend aus SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101 und SEQ ID NO: 102. Besonders bevorzugt umfasst das Peptid, der Antikörper und/oder seine Fragmente mindestens eine Aminosäuresequenz, welche ausgewählt wird aus der Gruppe, bestehend aus der Aminosäuresequenz SEQ ID NO: 3, einer Permutation der
Aminosäuresequenz SEQ ID NO: 3, einem Teil der Aminosäuresequenz SEQ ID NO: 3, welcher mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 6 der in SEQ ID NO: 3 genannten Aminosäuren umfasst, und einem Derivat der
Aminosäuresequenzen SEQ ID NO: 3 oder dass das Peptidmimetikum mindestens eine am Peptidrückgrat modifizierten Aminosäuresequenz umfasst, welche ausgewählt wird aus der Gruppe, bestehend aus der Aminosäuresequenz SEQ ID NO: 3, einer Permutation der Aminosäuresequenz SEQ ID NO: 3, einem Teil der
Aminosäuresequenz SEQ ID NO: 3, welcher mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 6 der in SEQ ID NO: 3 genannten Aminosäuren umfasst, und einem Derivat der Aminosäuresequenzen SEQ ID NO: 3. Dabei umfasst die Aminosäuresequenz SEQ ID NO: 3 keine Amiriosäuresequenz, weiche ausgewählt wird aus der Gruppe, bestehend aus SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101 und SEQ ID NO: 102. Bevorzugt umfasst die
Aminosäuresequenz SEQ ID NO: 3 auch keinen Teil einer Amiriosäuresequenz, welcher mindestens 6 der in SEQ ID NO: 98 bis 102 genannten Aminosäuren umfasst. Weiterhin bevorzugt umfasst das Peptid, der Antikörper und/oder seine Fragmente auch kein Derivat der Aminosäuresequenz SEQ ID NO: 98 bis 102. Ebenso bevorzugt wird das Aptamer auf Basis der Zielstruktur eines Peptids hergestellt, wobei das Peptid ausgewählt wird, aus der Aminosäuresequenz SEQ ID NO: 3, einer Permutation einer der Aminosäuresequenz SEQ ID NO: 3, einem Teil einer der Aminosäuresequenzen SEQ ID NO: 3, welcher mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 6 der in SEQ ID NO: 3 genannten Aminosäuren umfasst, und einem Derivat einer der Aminosäuresequenz SEQ ID NO: 3. Dabei umfasst die
Aminosäuresequenzen SEQ ID NO: 3 keine Aminosäuresequenz, welche ausgewählt wird aus der Gruppe, bestehend aus SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101 und SEQ ID NO: 102. Dabei ist es bevorzugt, dass die
Aminosäuresequenz SEQ ID NO: 103 auch keinen Teil einer Aminosäuresequenz umfasst, welcher mindestens 6 der in SEQ ID NO: 98 bis 102 genannten Aminosäuren umfasst. Weiterhin bevorzugt umfasst die Aminosäuresequenz SEQ ID NO: 3 auch kein Derivat der Aminosäuresequenz SEQ ID NO: 98 bis 102. Ganz besonders bevorzugt besteht das Peptid aus einer Aminosäuresequenz, welche ausgewählt wird aus der Gruppe, bestehend aus der Aminosäuresequenz SEQ ID NO: 3, einer Permutation der Aminosäuresequenz SEQ ID NO: 3, einem Teil der Aminosäuresequenz SEQ ID NO: 3, welcher mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 6 der in SEQ ID NO: 3 genannten Aminosäuren umfasst, und einem Derivat der Aminosäuresequenzen SEQ ID NO: 3 oder dass das Peptidmimetikum aus einer am Peptidrückgrat modifizierten Aminosäuresequenz besteht, welche ausgewählt wird aus der Gruppe, bestehend aus der
Aminosäuresequenz SEQ ID NO: 3, einer Permutation der Aminosäuresequenz SEQ ID NO: 3, einem Teil der Aminosäuresequenz SEQ ID NO: 3, welcher
mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 6 der in SEQ ID NO: 3 genannten Aminosäuren umfasst, und einem Derivat der
Aminosäuresequenzen SEQ ID NO: 3. Dabei umfasst die Aminosäuresequenz SEQ ID NO: 3 keine Aminosäuresequenz, welche ausgewählt wird aus der Gruppe, bestehend aus SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101 und SEQ ID NO: 102 und/oder auch keinen Teil einer Aminosäuresequenz, welcher mindestens 6 der in SEQ ID NO: 98 bis 102 genannten Aminosäuren umfasst und/oder kein Derivat der Aminosäuresequenzen SEQ ID NO: 98 bis 102. In einer ganz besonders bevorzugten Ausführungsform weist die die Interaktion hemmende Verbindung die Aminosäuresequenz SEQ ID NO: 4, einem Teil der Aminosäuresequenz SEQ ID NO: 4, welcher mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 6 der in SEQ ID NO: 4 genannten Aminosäuren umfasst auf. Analog zu den Ausführungen oben kann die Aminosäuresequenz SEQ ID NO: 4 auch dargestellt werden durch die Sequenz
LKRYKRRL
Ebenso können die Aminosäuresequenzen SEQ ID NO: 103 bis 124 wie folgt dargestellt werden:
[LA] [KHRA] [RVHA] [KYA] [NKLFHA] [RHA] [RHA] [LA] SEQ ID NO: 103
[LA] [KA] [RVHA] [KYA] [NKLFHA] [RHA] [RHA] [LA] SEQ ID NO: 104
[LA] [KA] [RVHA] [KYA] [NKLFHA] [RA] [RA] [LA] SEQ ID NO: 105
[LA] [KA] [RVA] [KYA] [NKLFHA] [RA] [RA] [LA] SEQ ID NO: 106 [LA] [KA] [RA] [KA] [NKLFHA] [RA] [RA] [LA] SEQ ID NO: 107
[LA] [KA] [RA] [KA] [NKA] [RA] [RA] [LA] SEQ ID NO: 108
LKRKNRRL SEQ ID NO: 109
LKRKKRRL SEQ ID NO: 110
LKVYKRRL SEQ ID NO: 111 LKRKLRRL SEQ ID NO: 112
LKRKFRRL SEQ ID NO: 113
LHRYHRRL SEQ ID NO: 114
LRHYKHHL SEQ ID NO: 1145
KRYKRR SEQ ID NO: 116
AKRYKRRL SEQ ID NO: 127
LARYKRRL SEQ ID NO: 128
LKAYKRRL SEQ ID NO: 129
LKRAKRRL SEQ ID NO: 120
LKRYARRL SEQ ID NO: 121
LKRYKARL SEQ ID NO: 122
LKRYKRAL SEQ ID NO: 123
LKRYKRRA SEQ ID NO: 124 In einem weiteren Aspekt der vorliegenden Erfindung wird eine Verbindung
bereitgestellt, welche ausgewählt wird aus der Gruppe, bestehend aus einem Peptid, einem Peptidmimetikum und einem Aptamer, dadurch gekennzeichnet, dass das Peptid aus einer Aminosäuresequenz besteht, welche ausgewählt wird aus der Gruppe, bestehend aus der Aminosäuresequenz SEQ ID NO: 1 , der
Aminosäuresequenz SEQ ID NO: 2, der Aminosäuresequenz SEQ ID NO: 3, einer Permutation einer der Aminosäuresequenzen SEQ ID NO: 1 bis SEQ ID NO: 3, einem Teil einer der Aminosäuresequenzen SEQ ID NO: 1 bis SEQ ID NO: 3, welcher mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 6 der in SEQ ID NO: 1 bis SEQ ID NO: 3 genannten Aminosäuren umfasst, und einem Derivat einer der Aminosäuresequenzen SEQ ID NO: 1 bis SEQ ID NO: 3, dass das
Peptidmimetikum aus einer am Peptidrückgrat modifizierte Aminosäuresequenz besteht, welche ausgewählt wird aus der Gruppe, bestehend aus der
Aminosäuresequenz SEQ ID NO: 1 , der Aminosäuresequenz SEQ ID NO: 2, der Aminosäuresequenz SEQ ID NO: 3, einer Permutation einer der
Aminosäuresequenzen SEQ ID NO: 1 bis SEQ ID NO: 3, einem Teil einer der
Aminosäuresequenzen SEQ ID NO: 1 bis SEQ ID NO: 3, welcher mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 6 der in SEQ ID NO: 1 bis SEQ ID NO: 3 genannten Aminosäuren umfasst, und einem Derivat einer der
Aminosäuresequenzen SEQ ID NO:1 bis SEQ ID NO: 3 oder dass das Aptamer auf Basis der Zielstruktur eines Peptids hergestellt wird» wobei das Peptid ausgewählt wird, aus der Aminosäuresequenz SEQ ID NO: 1 , der Aminosäuresequenz
SEQ ID NO: 2, der Aminosäuresequenz SEQ ID NO: 3, einer Permutation einer der Aminosäuresequenzen SEQ ID NO: 1 bis SEQ ID NO: 3, einem Teil einer der
Aminosäuresequenzen SEQ ID NO: 1 bis SEQ ID NO: 3, welcher mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 6 der in SEQ ID NO: 1 bis SEQ ID NO: 3 genannten Aminosäuren umfasst, und einem Derivat einer der
Aminosäuresequenzen SEQ ID NO: 1 bis SEQ ID NO: 3. Dabei sind Verbindungen ausgenommen, bei denen das Peptid aus einer Aminosäuresequenz der SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101 oder SEQ ID NO: 102, und/oder aus einem Teil einer der Aminosäuresequenzen SEQ ID NO: 98 bis SEQ ID NO: 102, welcher mindestens 6 der in SEQ ID NO: 98 bis SEQ ID NO: 102 genannten Aminosäuren umfasst und/oder aus einem Derivat der Aminosäuresequenzen SEQ ID NO: 98 bis 102 besteht und/oder bei denen ein Peptidmimetikum aus einer am
Peptidrückgrat modifizierten Aminosäuresequenz besteht, welche ausgewählt wird aus der Gruppe, bestehend aus SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101 und SEQ ID NO: 102, und/oder bei denen ein Aptamer auf Basis der Zielstruktur eines Peptids hergestellt wird, wobei das Peptid ausgewählt wird aus der Gruppe, bestehend aus SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100 SEQ ID NO: 101 und SEQ ID NO: 102.
Dabei ist die Verbindung bevorzugt isoliert. Ebenso ist die Verbindung im
Wesentlichen gereinigt. Dies bedeutet insbesondere, dass die Verbindung in einer hoch reinen Form von höher als 95 % Reinheit, besonders bevorzugt höher als 99 % Reinheit bereitgestellt wird.
Ethylensignalkette
Die Ethylensignalkette wurde bisher in der Modelpflanze Arabidopsis thaliana näher untersucht. Hierbei konnte das Membranprotein„Ethylene insensitive 2" (EIN2) als ein zentrales Element dieser Kette identifiziert werden (J. M. Alonso, T. Hiryama, G.
Roman, S. Nourizadeh, J. R. Ecker, EIN2, a bifunctional transducer of ethylene and stress responses in Arabidopsis, Science: 284, 2148-2152; 1999). Es konnten bisher direkte Wechselwirkungen zwischen den unterschiedlichen Ethylenrezeptoren und dem in der Signalkette nachgeordneten Protein EIN2 nachgewiesen werden (M. M. A. Bisson, A. Bleckmann, S. Allekotte, G. Groth, EIN2, the central reguilator of ethylene Signalling, is localized at the ER membrane where it interacts with the ethylene receptor ETR1 , Biochem J: 424, 1-6; 2009 u d M. M. A. Bisson, G. Groth, New insight in ethylene signaling: autokinase activity of ETR1 modulates the interaction of receptors and EIN2, Molecular Plant: 5,882-889, 2010). Als Ethylenrezeptoren, welche in Arabidopsis thaliana identifiziert wurden, sind„Ethylene resistant 1" (ETR1 ), „Ethylene resistant 2" (ETR2),„Ethylene response sensor" (ERS1),„Ethylene response sensor 2" (ERS2) und .Ethylene insensitive 4" (EIN4) bekannt (M. M. Bisson, G. Groth, New paradigm in ethylene signaling, Plant Signal & Behav 6: 164-166; 2011 ). Dennoch sind die genaue Rolle von EIN2 und der zu Grunde liegende molekulare Mechanismus der Signaltransduktion an der ER Membran noch unbekannt.
Es konnte gezeigt werden, dass das Verfahren der vorliegenden Erfindung zu einer Störung der für die Signaltransduktion wichtigen Interaktion des Rezeptorproteins ETR1 oder seiner Isoformen ERS1 , ETR2, ERS2, EIN4 oder eines homologen oder orthologen Proteins davon mit dem Protein EIN2 oder eines orthologen Proteins davon führt. Durch die erfindungsgemäße Unterbrechung dieses Signalweges ist es gelungen, den Reifungsprozess, Seneszenzprozess und/oder die Stresstoleranz von Pflanzen und/oder ihrer Früchte zu beeinflussen.
Homologe und orthologe Proteine sind dadurch gekennzeichnet, dass sie die gleiche biologische Aktivität in einer anderen Spezies aufweisen wie ein spezielles Protein (beispielsweise ETR1 ) in einer speziellen Spezies (beispielsweise Arabidopsis).
Im Sinne dieser Erfindung wird unter einem„homologen Protein" ein Protein mit signifikanter struktureller Homologie zu dem Protein ETR1 verstanden. Insbesondere wird hiermit eine Identität von über 70 %, bevorzugt über 75 %, besonders bevorzugt über 80 % und ganz besonders bevorzugt über 90 % mit dem Protein ETR1
verstanden. Methoden zur Bestimmung der Homologie von Proteinen sind dem
Fachmann bekannt. Häufig erfolgt eine Identifizierung homologer Proteine anhand einer statistisch signifikanten Anzahl von Aminosäuren. Dabei kann insbesondere der BLAST(Basic Local Alignment Search Tool)-Algorithmus verwendet werden (S. F.
Altschul, W. Gish, W. Miller, E. W. Myers, D. J. Lipman, Basic local alignment search tool. J, Mol. Biol. 215, 403-410; 1990). Hierbei werden Regionen identifiziert, weiche lokale Ähnlichkeiten zwischen Sequenzen aufweisen. Das Programm vergleicht die Proteinsequenz mit Sequenzen in Datenbanken und berechnet die statistische Signifikanz der Übereinstimmung.
Spezies, welche solche Identitäten aulweisen, sind in der folgenden Tabelle 1 dargestellt (siehe dazu auch Figur 1 ). Sie sind in bekannten Datenbanken (YDR PDR protein database, UniProt oder NCBi (National Center for Biotechnology Information)) unter den angegebenen Einträgen hinterlegt:
Tabelle 2: Homologe Proteine des ETR1
Organismus % Identität zu AminosäuresequenzHinterlegung
Arabidopsis nummer (Datenbank Accession
ETR1 No.)
Arabidopsis 100 SEQ ID NO: 5 UniProtKB/Swiss-Prot thaliana P49333
Malus x 83.33 SEQ ID NO: 6 GenBank: AAC31 123.1 domestica
Brassica 96.46 SEQ ID NO: 7 UniProtKB/Swiss-Prot: oleracea 049230.1
Citrus hybrid 84.42 SEQ ID NO: 8 GenBank: ADB25217.1 cultivar
Coffea 81.98 SEQ ID NO: 9 GenBank: ABL63471.1 canephora
Cucumis sativus 82.25 SEQ ID NO: 10 UniProtKB/Swiss-Prot:
Q9SSY6.1
Dimocarpus 86.18 SEQ ID NO: 11 GenBank: ACL81480.3 longan
Diospyros kaki 80.08 SEQ ID NO: 12 GenBank: BAE46932.1
Pelargonium x 81.03 SEQ ID NO: 13 UniProtKB/Swiss-Prot: hortum Q9XH58.1
Hevea 81.71 SEQ ID NO: 14 GenBank:AAW31759.1 brasiliensis
Actin idia 84.15 SEQ ID NO: 15 GenBank: ABY28264.1 deliciosa Organismus % Identität zu AminosäuresequenzHinterlegung
Arabidopsis nummer (Datenbank Accession
ETR1 No.)
Lactuca sativa 78.83 SEQ ID NO: 16 GenBank: AAQ15122.1
Mangifera indica 82.79 SEQ ID NO: 17 GenBank;: AAF61919.1
Cucumis melo 82.79 SEQ ID NO: 18 GenBank: AAC99645.1 var.
cantalupensis
Oryza sativa 72.17 SEQ ID NO: 19 GenBank: ABF98411.1
Passiflora edulis 62.60 SEQ ID NO: 20 UniProtKB/Swiss-Prot:
Q9ZWL6.1
Prunus persica 67.34 SEQ ID NO: 21 UniProtKB/Swiss-Prot:
Q9M7M1.1
Petunia x 81.28 SEQ ID NO: 22 GenBank: AAL40902.1 hybrida
Prunus salicina 84.82 SEQ ID NO: 23 GenBank: ABU68266.1
Ricinus 40.51 SEQ ID NO: 24 NCBI Reference communis Sequence:
XP_002529316.1
Glycine max 81.02 SEQ ID NO: 25 GenBank: ABR67685.1
Fragaria x 84.01 SEQ ID NO: 26 GenBank: CAC48384.1 |
Nicotiana 81.79 SEQ ID NO: 27 UniProtKB/Swiss-Prot: tabacum 048929.1
Solanum 81.44 SEQ ID NO: 28 GenBank: AAC02213.1 iypersicum
Vitis vinifera 83.06 SEQ ID NO: 29 NCBI Reference
Sequence:
XP_002277460.1
Zea mays 37.80 SEQ ID NO: 30 GenBank: AAR25569.1
Besonders bevorzugt werden homologe Proteine des ETR1 ausgewählt aus der Gruppe, bestehend aus SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11 , SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21 , SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 24, SEQ ID NO: 25» SEQ ID NO: 26, SEQ ID NO: 27, SEQ ID NO: 28,
SEQ ID NO: 29 und SEQ ID NO: 30. Unter einem "orthologen Protein" wird ein Protein verstanden, das das funktionelle Gegenstück eines anderen Proteins (ETR1 oder EIN2) in einer anderen Spezies darstellt. Sequenzunterschiede zwischen den Orthologen sind das Ergebnis von Artbildung. Methoden zur Identifizierung von orthologen Proteinen sind dem Fachmann bekannt. Häufig erfolgt eine Identifizierung orthologer Proteine anhand des
BLAST(Basic Local Alignment Search Tool)-Algorithmus. Weitere Methoden sind beschrieben in Chen.F., Mackey ,A.J.f Vermunt.J.K., Roos.D.S. (2007) Assessing Performance of Orthology Detection Strategies Applied to Eukaryotic Genomes, PLoS ONE, 2, e383; Tatusov.R.L, Fedorova.N.D., Jackson.J.D., Jacobs.A.R., Kiryutin.B., Koonin.E.V., Krylov.D.M., Mazumder.R., Mekhedov.S.L., Nikolskaya.A.N., et al. (2003) The COG database: an updated version includes eukaryotes. BMC Bioinformatics, 4, 41 ; Tatusov.R.L, Koonin.E.V. and Lipman.D.J. (1997) A genomic perspective on protein famiiies, Science, 278, 631 ; Altschul, S. F., Madden.T.L, Schaffer, A.A.,
Zhang.J., Miller.W. and Lipman.D.J. (1997) Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res, 25, 3389;
Chen.F., Mackey.A.J., Stoeckert.C.J. Jr and Roos.D.S. (2006) OrthoMCL-DB: querying a comprehensive multi-species collect ion of ortholog groups.Nucleic Acids Res, 34, D363; Sonnhammer.E.L. and Koonin.E.V. (2002) Orthology, paralogy and proposed Classification for paralog subtypes.Trends Genet, 18, 619; O'Brien.K.P., Remm.M. and Sonnhammer.E.L. (2005) Inparanoid: a comprehensive database of eukaryotic orthologs.Nucleic Acids Res, 33, D476; Wheeler.D.L., Barrett.T., Benson.D.A.,
Bryant.S.H., Canese.K., Chetvernin.V., Church.D.M., DiCuccio.M., Edgar.R.,
Federhen.Set al.(2005) Database resources of the National Center for Biotechnology Information, Nucleic Acids Res, 33, D3; Wood.V. (2006) /Schizosaccharomyces pombe/ comparative genomics; from sequence to Systems. In Sunnerhagen.P., Piskur.J. (eds.) /Comparative Genomics Using Fungi as Models (Series: Topics in Current Genetics). Vol. 15, pp.233 und S. Bandyopadhyay, R. Sharan, T. Ideker, Systematic identfification of functional orthologs based on protein network comparison, Genome Res. 16. 428-435 (2006). Besonders bevorzugt umfassen die orthologen Proteine des E1N2
Aminosäuresequenzen, welche ausgewählt werden aus der Gruppe, bestehend aus SEQ ID NO: 31 , SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 38, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 41 , SEQ ID NO: 42, SEQ ID NO: 43, SEQ ID NO: 44, SEQ ID NO: 45, SEQ ID NO: 46, SEQ ID NO: 47, SEQ ID NO: 48, SEQ ID NO: 49, SEQ ID NO: 50, SEQ ID NO: 51 , SEQ ID NO: 52 und SEQ ID NO: 53.
Die genannten Aminosäuresequenzen sind in bekannten Datenbänken (YDR PDR protein database, UniProt oder NCBI (National Center for Biotechnoiogy Information)) unter den angegebenen Einträgen hinterlegt:
Tabelle 3: orthologe Proteine des EI 2
Organismus AminosäuresequenzHinterlegung
nummer (Datenbank Accession
No. )
Arabidopsis thaliana SEQ ID NO: 31 NCBI Reference
Sequence: NP_195948.1
Arabidopsis lyrata subsp. SEQ ID NO: 32 NCBI Reference
lyrata Sequence:
XP_002871021.1
Ricinus communis SEQ ID NO: 33 NCBI Reference
Sequence:
XP_002519522.1
Populus trichocarpa SEQ ID NO: 34 NCBI Reference
Sequence:
XP_002322882.1
Vitis vinifera SEQ ID NO: 35 NCBI Reference
Sequence:
XP_002276399.1
Glycine max SEQ ID NO: 36 NCBI Reference
Sequence: Organismus AminosäuresequenzHinterlegung
nummer (Datenbank Accession
No. )
XP_003542536.1
Prunus persica SEQ ID NO: 37 GenBank: ACY78397.1
Cucumis meto SEQ ID NO: 38 GenBank: ADV90799.1
Medicago truncatula SEQ ID NO: 39 NCBI Reference
Sequence:
XP_003625647.1
Petunia x hybrida SEQ ID NO: 40 GenBank: AAR08678.1
Solanum lycopersicum SEQ ID NO: 41 NCBI Reference
Sequence:
NP_001234518.1
Dianthus caryophyllus SEQ ID NO: 42 GenBank: ADR31357.1
Sorghum bicolor SEQ ID NO: 43 NCBI Reference
Sequence:
XP_002457112.1
Zea mays SEQ ID NO: 44 GenBank: AAR25570.1
Oryza sativa Japonica Group SEQ ID NO: 45 GenBank: AAQ95276.1
Oryza sativa Indica Group SEQ ID NO: 46 GenBank: EEC81537.1
Brachypodium distachyon SEQ ID NO: 47 NCBI Reference
Sequence:
XP_003575571.1
Triticum aestivum SEQ ID NO: 48 GenBank: ADP02171.1
Malus x domestica SEQ ID NO: 49 GenBank: ABI33219.1
Brassica rapa subsp. SEQ ID NO: 50 GenBank: ADD14032.1 chinensis
Hordeum vulgare subsp. SEQ ID NO: 51 GenBank: BAJ87351.1 vulgare
Chlamydomonas reinhardtii SEQ ID NO: 52 NCBI Reference
Sequence:
XP_ 001700793.1
Nicotiana tabacum SEQ ID NO: 53 GenBank: AEI87996.1 Besonders bevorzugt umfassen die orthologen Proteine des ETR1 oder seiner Isoformen eine Aminosäuresequenz, welche ausgewählt wird aus der Gruppe, bestehend aus SEQ iD NO: 54, SEQ iD NO: 55, SEQ ID NO: 56, SEQ iD NO: 57, SEQ ID NO: 58, SEQ iD NO: 59, SEQ ID NO: 60, SEQ iD NO: 61 , SEQ ID NO: 62, SEQ ID NO: 63, SEQ iD NO: 64, SEQ ID NO: 65, SEQ ID NO: 66, SEQ iD NO: 67, SEQ ID NO: 68, SEQ ID NO: 69, SEQ ID NO: 70, SEQ ID NO: 71 , SEQ iD NO: 72, SEQ ID NO: 73, SEQ ID NO: 74, SEQ ID NO: 75, SEQ ID NO: 76, SEQ ID NO: 77, SEQ iD NO: 78, SEQ ID NO: 79, SEQ ID NO: 80, SEQ ID NO: 81 , SEQ ID NO: 82, SEQ ID NO: 83, SEQ iD NO: 84, SEQ ID NO: 85, SEQ ID NO: 86, SEQ ID NO: 87, SEQ ID NO: 88, SEQ ID NO: 89, SEQ ID NO: 90, SEQ ID NO: 91 , SEQ ID NO: 92, SEQ iD NO: 93, SEQ ID NO: 94, SEQ ID NO: 95 und SEQ iD NO: 96.Die genannten Aminosäuresequenzen sind in bekannten Datenbänken (YDR PDR protein database, UniProt oder NCBI (National Center for Biotech nology Information)) unter den angegebenen Einträgen hinterlegt:
Tabelle 4: orthologe Proteine des ETR1
Organismus AminosäuresequenzHinterlegung
nummer (Datenbank Accession
No.)
Arabidopsis lyrata subsp. SEQ ID NO: 54 NCBI Reference
lyrata Sequence:
XP_002887022.1
Brassica oieracea SEQ ID NO: 7 UniProtKB/Swiss-Prot:
049230.1
Dimocarpus longan SEQ ID NO: 11 GenBank: ACL81480.3
Prunus domestica subsp. SEQ ID NO: 55 GenBank: CAI64505.1 insititia
Citrus sinensis SEQ ID NO: 8 GenBank: ADB25217.1
Prunus salicina SEQ ID NO: 23 GenBank: ABU68266.1
Prunus persica SEQ ID NO: 21 UniProtKB/Swiss-Prot:
Q9 7M1.1 Organismus AminosäuresequenzHinterlegung
nummer (Datenbank Accession
No.)
Popuius trichocarpa ETR4 SEQ ID NO: 56 NCBI Reference
Sequence:
XP_002327419.1
Ricinus communis SEQ ID NO: 57 NCBI Reference
Sequence:
XP_002533252.1
Fragaria x ananassa SEQ ID NO: 26 GanBank: CAC48384.1
Pyrus communis SEQ ID NO: 58 GenBank: AAL66191.1
Malus x domestica SEQ ID NO: 6 GenBank: AAC31123.1
Pyrus pyrifolia SEQ ID NO: 59 GenBank: BAD61001.1
Populus trichocarpa ETR 3 SEQ ID NO: 60 NCBI Reference
Sequence:
XP_002299688.1
Actinidia deliciosa ETR1 SEQ ID NO: 61 GenBank: ABY28264.1
Pyrus pyrifolia ETR3 SEQ ID NO: 62 GenBank: ABS57008.1
Coffea canephora SEQ ID NO: 63 GenBank: ABL63474.1
Pelargonium x hortorum SEQ ID NO: 64 UniProtKB/Swiss-Prot: ETR2 Q9XH57.1
Coffea liberica var. dewevrei SEQ ID NO: 65 GenBank: ABL63472.1
Mangifera indica SEQ ID NO: 17 GenBank: AAF61919.1
Cucumis melo var. SEQ ID NO: 18 GenBank: AAC99645.1 cantalupensis
Passiflora edulis SEQ ID NO: 66 UniProtKB/Swiss-Prot:
Q9ZWL6.1
Pelargonium x hortorum SEQ ID NO: 13 UniProtKB/Swiss-Prot:
Q9XH58.1
Vitis vinrfera SEQ ID NO: 29 NCBI Reference
Sequence:
XP_ 002277460.1
Petunia x hybrida SEQ ID NO: 67 GenBank: AAL40901.1 Organismus AminosäuresequenzHinterlegung
nummer (Datenbank Accession
No.)
Coffea pseudozanguebariae SEQ ID NO: 68 GenBank: ABL63473.1
Catharanthus roseus SEQ ID NO: 69 GenBank: AAQ10679.1
Ziziphus jujuba SEQ ID NO: 70 GenBanK: ABB77560.1
Cucumis sativus SEQ ID NO: 10 UniProtKB/Swiss-Prot:
Q9SSY6.1
Nicotiana tabacum SEQ ID NO: 27 UniProtKB/Swiss-Prot:
048929.1
Solanum lycopersicum SEQ ID NO: 71 UniProtKB/Swiss-Prot:
Q41342.1
Medicago truncatula SEQ ID NO: 72 NCBI Reference
Sequence:
XP_003605421.1
Hevea brasiliensis SEQ ID NO: 14 GenBank: AAW31759.1
Diospyros kaki SEQ ID NO: 12 GenBank: BAE46932.1
Glycine max SEQ ID NO: 25 GenBank: ABR67685.1
Lactuca sativa SEQ ID NO: 16 GenBank: AAQ15122.1
Solanum lycopersicum ETR2 SEQ ID NO: 73 NCBI Reference
Sequence:
NP_001234153.1
Eriobotrya japonica SEQ ID NO: 74 GenBank : ACM89298.1
Lilium formosanum x Lilium SEQ ID NO: 75 GenBank : ABD66593.1 longiflorum
Musa acuminata AAA Group SEQ ID NO: 76 GenBank: AAQ13533.1
Gladiolus hybrid cultivar SEQ ID NO: 77 GenBank: BAD20704.1
Papilionanthe hookeriana x SEQ ID NO: 78 GenBank: AEE69544.1 Papilionanthe teres
Oncidium Gower Ramsey SEQ ID NO: 79 GenBank: AAQ14309.1
Phalaenopsis hybrid cultivar SEQ ID NO: 80 GenBank: AAD04949.1 ERS
Dendrobium hybrid cultivar SEQ ID NO: 81 GenBank: ABJ91124.1 Organismus AminosäuresequenzHinterlegung
nummer (Datenbank Accession
No.)
Phalaenopsis hybrid cultivar SEQ ID NO: 82 GenBank: AAD26899.1
Phalaenopsis equestris SEQ ID NO: 83 GenBank: CAD91247.1
Sorghum bicolor SEQ ID NO: 84 NCBI Reference
Sequence:
XP .002464032.1
Dendrobium hybrid cultivar SEQ ID NO: 85 GenBank: ACN22272.1
Oryza sativa Japonica Group SEQ ID NO: 19 GenBank: ABF98411.1
Oryza sativa SEQ ID NO: 86 GenBank: AAB72193.1
Hordeum vulgare subsp. SEQ ID NO: 87 GenBank: BAJ87109.1 vulgare
Zea mays SEQ ID NO: 88 GenBank: AAR25566.1
Saccharum hybrid cultivar SEQ ID NO: 89 GenBank: ADJ66722.1 ROC20
Delphinium 'MagicFountains SEQ ID NO: 90 GenBank: BAB84569.1 dark blue'
Triticum aestivum ERS SEQ ID NO: 91 GenBank: ADJ67795.1
Triticum aestivum ERS3 SEQ ID NO: 92 GenBank: ADK23798.2
Triticum aestivum ERS2 SEQ ID NO: 93 GenBank: ADK23797.2
Delphinium x belladonna SEQ ID NO: 94 GenBank: BAD89291.1
Actinidia deliciosa ERS1 SEQ ID NO: 95 GenBank: ABY28263.1
Populus trichocarpa SEQ ID NO: 96 NCBI Reference
Sequence:
XP_002302732.1
In der Ethylensignaikette wechselwirkt das Rezeptorprotein ETR1 oder seine Isoform ERS1 , ETR2, ERS2, EIN4 oder ein homologes oder orthologes Protein davon mit dem EIN2 Protein. Der Bereich der Aminosäuresequenz des ETR1 oder seiner Isoformen ERS1 , ETR2, ERS2, EIN4 oder eines homologen oder orthologen Proteins davon, welcher mit dem EIN2 oder einem orthologen Protein davon wechselwirkt, wird im Folgenden gelegentlich auch als die Kontaktdomäne des ETRi , welche mit EIN2 oder einem orthologen Protein davon interagiert, oder auch nur als Kontaktdomäne des
ETR1 bezeichnet. Pflanzen und/oder deren Früchte
Die Pflanzen des erfindungsgemäßen Verfahrens werden vorzugsweise ausgewählt aus der Gruppe, bestehend aus Nutzpflanzen und Zierpflanzen. Deren Früchte werden entsprechend vorzugsweise ausgewählt aus der Gruppe bestehend aus den Früchten von Nutzpflanzen und Zierpflanzen.
Der Begriff Nutzpflanzen, wie hier verwendet, bezeichnet Kulturpflanzen, die als Pflanzen für die Gewinnung von Nahrungsmitteln, Futtermitteln, Treibstoffe oder für technische Zwecke eingesetzt werden. Unter Zierpflanzen werden insbesondere ein- und mehrjährige Pflanzen wie Schnittblumen und/oder deren Pflanzenteiieverstanden.
Bevorzugt werden die Nutzpflanzen ausgewählt aus der Gruppe der folgenden
Pflanzenarten: Triticale, Durum (Hartweizen), Turf, Reben, Getreide, beispielsweise Weizen, Gerste, Roggen, Hafer, Reis, Mais und Hirse; Rüben, beispielsweise
Zuckerrüben und Futterrüben; Früchte, beispielsweise Kernobst, Steinobst und
Beerenobst, beispielsweise Äpfel, Birnen, Pflaumen, Pfirsiche, Mandeln, Kirschen und Beeren, z. B. Erdbeeren, Himbeeren, Brombeeren oder auch Mango, Datteln und Feigen; Hülsenfrüchte, beispielsweise Bohnen, Linsen, Erbsen und Sojabohnen;
Ölkulturen, beispielsweise Raps, Senf, Mohn, Oliven, Sonnenblumen, Kokos,
Castorölpflanzen, Kakaobohnen und Erdnüsse; Gurkengewächse, beispielsweise Kürbis, Gurken und Melonen; Fasergewächse, beispielsweise Baumwolle, Flachs, Hanf und Jute; Citrusfrüchte, beispielsweise Orangen, Zitronen, Pampelmusen und Mandarinen; Gemüsesorten, beispielsweise Spinat, (Kopf)-Salat, Spargel, Kohlarten, Möhren, Zwiebeln, Tomaten, Kartoffeln und Paprika; Lorbeergewächse, beispielsweise Avocado, Cinnamomum, Kampfer, oder ebenso Pflanzen wie Tabak, Nüsse, Kaffee, Aubergine, Zuckerrohr, Tee, Pfeffer, Weinreben, Hopfen, Bananen,
Naturkautschukgewächse sowie Zierpflanzen, beispielsweise Blumen und Sträucher. Diese Aufzählung stellt keine Limitierung dar. Als besonders geeignete Zielkulturen für die Anwendung des erfindungsgemäßen
Verfahrens sind folgende Pflanzen anzusehen: Hafer, Roggen, Triticale, Durum, Baumwolle, Aubergine, Turf, Kernobst, Steinobst, Beerenobst, Mais, Weizen, Gerste, Gurke, Tabak, Reben, Reis, Getreide, Birne, Pfeffer, Bohnen, Sojabohnen, Raps, Tomate, Paprika, Melonen, Kohl, Kartoffel und Apfel.
Als Schnittblumen und/ oder deren Pflanzenteile, welche nach dem
erfindungsgemäßen Verfahren behandelt werden können, können beispielsweise Rosen, Nelken, Gerbera, Lilien, Margeriten, Chrysanthemen, Tulpen, Narzissen, Anemonen, Mohn, Amyrillis, Dahlien, Azaleen, Malven, aber auch z.B. Beetpflanzen,
Topfpflanzen und Stauden, wie beispielsweise Rosen, Tagetes, Stiefmütterchen, Geranien, Fuchsien, Hibiscus, Chrysanthemen, Fleissige Lieschen, Alpenveilchen, Ursambaraveilchen, Sonnenblumen, Begonien verstanden werden. In einer Ausführungsform des erfindungsgemäßen Verfahrens handelt es sich bei den Pflanzen um transgene Pflanzen.
Besonders bevorzugt können die transgenen Pflanzen ausgewählt werden aus der Gruppe, bestehend aus herbizidtoleranten Pflanzen, insektenresistente Pflanzen, Pflanzen mit erhöhter Stresstoleranz, Pflanzen, welche eine veränderte Menge, Qualität und/oder Lagerfähigkeit des Ernteproduktes und/oder veränderte
Eigenschaften von bestimmten Bestandteilen des Ernteproduktes aufweisen, Pflanzen mit veränderten Fasereigenschaften und Pflanzen mit veränderter
Ölzu sa m me n setzu ng .
Pflanzen oder Pflanzensorten (die mit Methoden der Pflanzenbiotechnologie, wie der Gentechnik, erhalten werden), die im erfindungsgemäßen Verfahren Anwendung finden können, sind herbizidtolerante Pflanzen, d. h. Pflanzen, die gegenüber einem oder mehreren vorgegebenen Herbiziden tolerant gemacht worden sind. Solche Pflanzen können entweder durch genetische Transformation oder durch Selektion von Pflanzen, die eine Mutation enthalten, die solch eine Herbizidtoleranz verleiht, erhalten werden. Herbizidtolerante Pflanzen sind zum Beispiel glyphosatetolerante Pflanzen, d. h.
Pflanzen» die gegenüber dem Herbizid Glyphosate oder dessen Salzen tolerant gemacht worden sind. So können zum Beispiel glyphosatetolerante Pflanzen durch Transformation der Pflanze mit einem Gen, das für das Enzym 5-Enolpyruvylshikimat- 3-phosphatsynthase (EPSPS) kodiert, erhalten werden. Beispiele für solche EPSPS- Gene sind das AroA-Gen (Mutante CT7) des Bakterium Salmonella typhimurium (Comai et ai., Science (1983), 221 , 370-371 ), das GP4-Gen des Bakteriums
Agrobacterium sp. (Barry et ai., Curr. Topics Plant Physioi. (1992), 7, 139-145), die Gene, die für eine EPSPS aus der Petunie (Shah et al., Science (1986), 233, 478- 481 ), für eine EPSPS aus der Tomate (Gasser et al., J. Biol. Chem. (1988), 263, 4280- 4289) oder für eine EPSPS aus Eleusine (WO 01/66704) kodieren. Es kann sich auch um eine mutierte EPSPS handeln, wie sie zum Beispiel in EP-A 0837944, WO
00/066746, WO 00/066747 oder WO 02/026995 beschrieben ist. Glyphosatetolerante Pflanzen können auch dadurch erhalten werden, dass man ein Gen exprimiert, das für ein Glyphosate-Oxidoreduktase-Enzym, wie es in US 5,776,760 und US 5,463,175 beschrieben ist, kodiert. Glyphosatetolerante Pflanzen können auch dadurch erhalten werden, dass man ein Gen exprimiert, das für ein Glyphosate-acetyltransferase- Enzym, wie es in z. B. WO 02/036782, WO 03/092360, WO 05/012515 und WO 07/024782 beschrieben ist, kodiert. Glyphosatetolerante Pflanzen können auch dadurch erhalten werden, dass man Pflanzen, die natürlich vorkommende Mutationen der oben erwähnten Gene, wie sie zum Beispiel in WO 01/024615 oder WO
03/013226 beschrieben sind, enthalten, selektiert.
Sonstige herbizidresistente Pflanzen sind zum Beispiel Pflanzen, die gegenüber Herbiziden, die das Enzym Glutaminsynthase hemmen, wie Bialaphos, Phosphinotricin oder Glufosinate, tolerant gemacht worden sind. Solche Pflanzen können dadurch erhalten werden, dass man ein Enzym exprimiert, das das Herbizid oder eine Mutante des Enzyms Glutaminsynthase, das gegenüber Hemmung resistent ist, entgiftet. Solch ein wirksames entgiftendes Enzym ist zum Beispiel ein Enzym, das für ein
Phosphinotricin-acetyltransferase kodiert (wie zum Beispiel das bar- oder pat-Protein aus Streptomyces-Arten). Pflanzen, die eine exogene Phosphinotricin- acetyltransferase exprimieren, sind zum Beispiel in US 5,561 ,236; US 5,648,477; US 5,646,024; US 5,273,894; US 5,637,489; US 5,276,268; US 5,739,082; US 5,908,810 und US 7,1 12,665 beschrieben. Weitere herbizidtolerante Pflanzen sind auch Pflanzen, die gegenüber den Herbiziden, die das Enzym Hydroxyphenylpyruvatdioxygenase (HPPD) hemmen, tolerant gemacht worden sind. Bei den Hydroxyphenylpyruvatdioxygenasen handelt es sich um Enzyme, die die Reaktion, in der para-Hydroxyphenylpyruvat (HPP) zu Homogentisat umgesetzt wird, katalysieren. Pflanzen, die gegenüber HPPD-Hemmern tolerant sind, können mit einem Gen, das für ein natürlich vorkommendes resistentes HPPD-Enzym kodiert, oder einem Gen, das für ein mutiertes HPPD-Enzym gemäß WO 96/038567, WO 99/024585 und WO 99/024586 kodiert, transformiert werden. Eine Toleranz gegenüber HPPD-Hemmern kann auch dadurch erzielt werden, dass man Pflanzen mit Genen transformiert, die für gewisse Enzyme kodieren, die die Bildung von Homogentisat trotz Hemmung des nativen HPPD-Enzyms durch den HPPD-Hemmer ermöglichen. Solche Pflanzen und Gene sind in WO 99/034008 und WO 2002/36787 beschrieben. Die Toleranz von Pflanzen gegenüber HPPD-Hemmern kann auch dadurch verbessert werden, dass man Pflanzen zusätzlich zu einem Gen, das für ein HPPD-toIerantes Enzym kodiert, mit einem Gen transformiert, das für ein Prephenatdehydrogenase- Enzym kodiert, wie dies in WO 2004/024928 beschrieben ist.
Weitere herbizidresistente Pflanzen sind Pflanzen, die gegenüber Acetolactatsynthase (ALS)-Hemmern tolerant gemacht worden sind. Zu bekannten ALS-Hemmern zählen zum Beispiel Sulfonylharnstoff, Imidazolinon, Triazolopyrimidine,
Pyrim id i nyloxy(th io )benzoate und/oder Sulfonylaminocarbonyl-triazolinon-Herbizide. Es ist bekannt, dass verschiedene Mutationen im Enzym ALS (auch als
Acetohydroxysäure-Synthase, AHAS, bekannt) eine Toleranz gegenüber
unterschiedlichen Herbiziden bzw. Gruppen von Herbiziden verleihen, wie dies zum Beispiel bei Tranel und Wright, Weed Science (2002), 50, 700-712, jedoch auch in US 5,605,01 1 , US 5,378,824, US 5,141 ,870 und US 5,013,659, beschrieben ist. Die Herstellung von sulfonylhamstofftoleranten Pflanzen und imidazolinontoleranten
Pflanzen ist in US 5,605,011 ; US 5,013,659; US 5,141 ,870; US 5,767,361 ; US
5,731 ,180; US 5,304,732; US 4,761 ,373; US 5,331 ,107; US 5,928,937; und US
5,378,824; sowie in der internationalen Veröffentlichung WO 96/033270 beschrieben. Weitere imidazolinontolerante Pflanzen sind auch in z. B. WO 2004/040012, WO
2004/106529, WO 2005/020673, WO 2005/093093, WO 2006/007373, WO
2006/015376, WO 2006/024351 und WO 2006/060634 beschrieben. Weitere Sulfonylharnstoff- und imidazolinontolerante Pflanzen sind auch in z.B. WO
2007/024782 beschrieben.
Weitere Pflanzen, die gegenüber ALS-Inhibitoren, insbesondere gegenüber
Imidazolinonen, Sulfonylharnstoffen und/oder Sulfamoylcarbonyltriazolinonen tolerant sind, können durch induzierte M utagenese, Selektion in Zellkulturen in Gegenwart des Herbizids oder durch Mutationszüchtung erhalten werden, wie dies zum Beispiel für die Sojabohne in US 5,084,082, für Reis in WO 97/41218, für die Zuckerrübe in US 5,773,702 und WO 99/057965, für Salat in US 5,198,599 oder für die Sonnenblume in WO 2001/065922 beschrieben ist.
Pflanzen oder Pflanzensorten (die nach Methoden der pflanzlichen Biotechnologie, wie der Gentechnik, erhalten wurden), die ebenfalls im erfindungsgemäßen Verfahren Anwendung finden können, sind insektenresistente transgene Pflanzen, d.h. Pflanzen, die gegen Befall mit gewissen Zielinsekten resistent gemacht wurden. Solche Pflanzen können durch genetische Transformation oder durch Selektion von Pflanzen, die eine Mutation enthalten, die solch eine Insektenresistenz verleiht, erhalten werden.
Der Begriff "insektenresistente transgene Pflanze" umfasst im vorliegenden
Zusammenhang jegliche Pflanze, die mindestens ein Transgen enthält, das eine Kodiersequenz umfasst, die für folgendes kodiert:
1 ) ein Insektizides Kristallprotein aus Bacillus thuringiensis oder einen Insektiziden Teil davon, wie die Insektiziden Kristallproteine, die von Crickmore et al., Microbiology and Molecular Biology Reviews (1998), 62, 807-813, zusammengestellt wurden, von Crickmore et al. (2005) in der Bacillus thuringiensis-Toxinnomenklatur aktualisiert (online bei: http://www.lifesci. sussex.ac.uk/Home/NeiLCrickmore/Bt/), oder insektizide Teile davon, z.B. Proteine der Cry-Proteinklassen CrylAb, CrylAc, Cry1 F, Cry2Ab, Cry3Ae oder Cry3Bb oder insektizide Teile davon; oder
2) ein Kristallprotein aus Bacillus thuringiensis oder einen Teil davon, der in Gegenwart eines zweiten, anderen Kristallproteins als Bacillus thuringiensis oder eines Teils davon insektizid wirkt, wie das binäre Toxin, das aus den Kristallproteinen Cy34 und Cy35 besteht (Moellenbeck et al., Nat. Biotechnol. (2001 ), 19, 668-72; Schnepf et al., Applied Environm. Microb. (2006), 71 , 1765-1774); oder 3) ein Insektizides Hybrid protein, das Teile von zwei unterschiedlichen Insektiziden Kristallproteinen aus Bacillus thuringiensis umfaßt, wie zum Beispiel ein Hybrid aus den Proteinen von 1 ) oben oder ein Hybrid aus den Proteinen von 2) oben, z. B. das Protein Cry1A.105, das von dem Mais-Event MON98034 produziert wird (WO
2007/027777); oder
4) ein Protein gemäß einem der Punkte 1 ) bis 3) oben, in dem einige, insbesondere 1 bis 10, Aminosäuren durch eine andere Aminosäure ersetzt wurden, um eine höhere Insektizide Wirksamkeit gegenüber einer Zielinsektenart zu erzielen und/oder um das Spektrum der entsprechenden Zielinsektenarten zu erweitern und/oder wegen
Veränderungen, die in die Kodier- DNA während der Klonierung oder Transformation induziert wurden, wie das Protein Cry3Bb1 in Mais-Events MON863 oder MON88017 oder das Protein Cry3A im Mais-Event MIR 604; oder
5) ein Insektizides sezerniertes Protein aus Bacillus thuringiensis oder Bacillus cereus oder einen Insektiziden Teil davon, wie die vegetativ wirkenden insektentoxischen
Proteine (vegetative insecticidal proteins, VIP), die unter folgendem Link angeführt sind, z. B. Proteine der Proteinklasse VIP3Aa:
http://wwwJifesci.sussex.ac.ulc/Home/Neil_Crickmore/Bt vip.html oder 6) ein sezerniertes Protein aus Bacillus thuringiensis oder Bacillus cereus, das in Gegenwart eines zweiten sezernierten Proteins aus Bacillus thuringiensis oder B. cereus insektizid wirkt, wie das binäre Toxin, das aus den Proteinen VIP1A und VIP2A besteht (WO 94/21795); oder 7) ein Insektizides Hybrid protein, das Teile von verschiedenen sezernierten Proteinen von Bacillus thuringiensis oder Bacillus cereus umfaßt, wie ein Hybrid der Proteine von 1 ) oder ein Hybrid der Proteine von 2) oben; oder 8) ein Protein gemäß einem der Punkte 1 ) bis 3) oben, in dem einige, insbesondere 1 bis 10, Aminosäuren durch eine andere Aminosäure ersetzt wurden, um eine höhere Insektizide Wirksamkeit gegenüber einer Zielinsektenart zu erzielen und/oder um das Spektrum der entsprechenden Zielinsektenarten zu erweitern und/oder wegen
Veränderungen, die in die Kodier- DNA während der Klonierung oder Transformation induziert wurden (wobei die Kodierung für ein Insektizides Protein erhalten bleibt), wie das Protein VIP3Aa im Baumwoll-Event COT 102.
Natürlich zählt zu den insektenresistenten transgenen Pflanzen im vorliegenden Zusammenhang auch jegliche Pflanze, die eine Kombination von Genen umfasst, die für die Proteine von einer der oben genannten Klassen 1 bis 8 kodieren. In einer Ausführungsform enthält eine insektenresistente Pflanze mehr als ein Transgen, das für ein Protein nach einer der oben genannten 1 bis 8 kodiert, um das Spektrum der entsprechenden Zielinsektenarten zu erweitern oder um die Entwicklung einer
Resistenz der Insekten gegen die Pflanzen dadurch hinauszuzögern, dass man verschiedene Proteine einsetzt, die für dieselbe Zielinsektenart insektizid sind, jedoch eine unterschiedliche Wirkungsweise, wie Bindung an unterschiedliche
Rezeptorbindungsstellen im Insekt, aufweisen. Pflanzen oder Pflanzensorten (die nach Methoden der pflanzlichen Biotechnologie, wie der Gentechnik, erhalten wurden), die ebenfalls im erfindungsgemäßen Verfahren Anwendung finden können, sind gegenüber abiotischen Stressfaktoren tolerant.
Solche Pflanzen können durch genetische Transformation oder durch Selektion von Pflanzen, die eine Mutation enthalten, die solch eine Stressresistenz verleiht, erhalten werden. Zu besonders nützlichen Pflanzen mit Stresstoleranz zählen folgende: a. Pflanzen, die ein Transgen enthalten, das die Expression und/oder Aktivität des Gens für die Poly(ADP-ribose)polymerase (PARP) in den Pflanzenzellen oder
Pflanzen zu reduzieren vermag, wie dies in WO 2000/004173 oder EP 04077984.5 oder EP 06009836.5 beschrieben ist. b.Pflanzen, die ein streßtoleranzfördemdes Transgen enthalten, das die Expression und/oder Aktivität der für PARP kodierenden Gene der Pflanzen oder Pflanzenzellen zu reduzieren vermag, wie dies z.B. in WO 2004/090140 beschrieben ist; 80 c.Pflanzen, die ein streßtoleranzförderndes Transgen enthalten, das für ein in Pflanzen funktionelles Enzym des Nicotinamidadenindinukleotid-Salvage-Biosynthesewegs kodiert, darunter Nicotinamidase, Nicotinatphosphoribosyltransferase,
Nicotinsäuremononukleotid-adenyltransferase,
Nicotinamidadenindinukleotidsynthetase oder Nicotinamidphosphoribosyl-transferase, wie dies z. B. in EP 04077624.7 oder WO 2006/133827 oder PCT/EP07/002433 beschrieben ist. Pflanzen oder Pflaozensorten (die nach Methoden der pflanzlichen Biotechnologie, wie der Gentechnik, erhalten wurden), die ebenfalls im erfindungsgemäßen Verfahren Anwendung finden können, weisen eine veränderte Menge, Qualität und/oder
Lagerfähigkeit des Ernteprodukts und/oder veränderte Eigenschaften von bestimmten Bestandteilen des Ernteprodukts auf, wie zum Beispiel:
1 ) Transgene Pflanzen, die eine modifizierte Stärke synthetisieren, die bezüglich ihrer chemisch-physikalischen Eigenschaften, insbesondere des Amylosegehalts oder des Amyiose/Amylopektin-Verhältnisses, des Verzweigungsgrads, der durchschnittlichen Kettenlänge, der Verteilung der Seitenketten, des Viskositätsverhaltens, der
Gelfestigkeit, der Stärkekorngröße und/oder Stärkekornmorphologie im Vergleich mit der synthetisierten Stärke in Wiidtyppflanzenzellen oder -pflanzen verändert ist, so dass sich diese modifizierte Stärke besser für bestimmte Anwendungen eignet. Diese transgenen Pflanzen, die eine modifizierte Stärke synthetisieren, sind zum Beispiel in EP 0571427, WO 95/004826, EP 0719338, WO 96/15248, WO 96/19581 , WO
96/27674, WO 97/1 1188, WO 97/26362, WO 97/32985, WO 97/42328, WO 97/44472, WO 97/45545, WO 98/27212, WO 98/40503, WO 99/58688, WO 99/58690, WO 99/58654, WO 2000/008184, WO 2000/008185, WO 2000/28052, WO 2000/77229, WO 2001/12782, WO 2001/12826, WO 2002/101059, WO 2003/071860, WO
2004/056999, WO 2005/030942, WO 2005/030941 , WO 2005/095632, WO
2005/095617, WO 2005/095619, WO 2005/095618, WO 2005/123927, WO
2006/018319, WO 2006/103107, WO 2006/108702, WO 2007/009823, WO
2000/22140, WO 2006/063862, WO 2006/072603, WO 2002/034923, EP 06090134.5, EP 06090228.5, EP 06090227.7, EP 07090007.1 , EP 07090009.7, WO 2001/14569, WO 2002/79410, WO 2003/33540, WO 2004/078983, WO 2001/19975, WO 95/26407, 81
WO 96/34968, WO 98/20145, WO 99/12950, WO 99/66050, WO 99/53072, US 6,734,341 , WO 2000/11192, WO 98/22604, WO 98/32326, WO 2001/98509, WO 2001/98509, WO 2005/002359, US 5,824,790, US 6,013,861 , WO 94/004693, WO 94/009144, WO 94/11520, WO 95/35026 bzw. WO 97/20936 beschrieben.
2) Transgene Pflanzen, die N ichtstärkeko h lenhyd ratpoiy m ere synthetisieren, oder Nichtstärkekohlenhydratpolymere, deren Eigenschaften im Vergleich zu
Wildtyppflanzen ohne genetische Modifikation verändert sind. Beispiele sind Pflanzen, die Polyfructose, insbesondere des Inulin- und Levantyps, produzieren, wie dies in EP 0663956, WO 96/001904, Wo 96/021023, WO 98/039460 und WO 99/024593 beschrieben ist, Pflanzen, die alpha-1 ,4-Glucane produzieren, wie dies in WO
95/031553, US 2002/031826, US 6,284,479, US 5,712,107, WO 97/047806, WO 97/047807, WO 97/047808 und WO 2000/14249 beschrieben ist, Pflanzen, die alpha- 1 ,6-verzweigte alpha-1 ,4-Glucane produzieren, wie dies in WO 2000/73422
beschrieben ist, und Pflanzen, die Alternan produzieren, wie dies in WO 2000/047727, EP 06077301.7, US 5,908,975 und EP 0728213 beschrieben ist.
3) Transgene Pflanzen, die Hyaluronan produzieren, wie dies zum Beispiel in WO 06/032538, WO 2007/039314, WO 2007/039315, WO 2007/039316, JP 2006/304779 und WO 2005/012529 beschrieben ist.
Pflanzen oder Pflanzensorten (die nach Methoden der pflanzlichen Biotechnologie, wie der Gentechnik, erhalten wurden), die ebenfalls im erfindungsgemäßen Verfahren Anwendung finden können, sind Pflanzen wie Baumwollpflanzen mit veränderten Fasereigenschaften. Solche Pflanzen können durch genetische Transformation oder durch Selektion von Pflanzen, die eine Mutation enthalten, die solche veränderten Fasereigenschaften verleiht, erhalten werden; dazu zählen: a) Pflanzen wie Baumwollpflanzen, die eine veränderte Form von
Cellulosesynthasegenen enthalten, wie dies in WO 98/000549 beschrieben ist, b) Pflanzen wie Baum wollpflanzen , die eine veränderte Form von rsw2- oder rsw3- homologen Nukleinsäuren enthalten, wie dies in WO 2004/053219 beschrieben ist; c) Pflanzen wie Baumwollpflanzen mit einer erhöhten Expression der
Saccharosephosphatsynthase, wie dies in WO 2001/017333 beschrieben ist; d) Pflanzen wie Baumwollpflanzen mit einer erhöhten Expression der
Saccharosesynthase, wie dies in WO 02/45485 beschrieben ist; e) Pflanzen wie Baumwollpflanzen bei denen der Zeitpunkt der Durchlaßsteuerung der Plasmodesmen an der Basis der Faserzelle verändert ist, z. B. durch
Herunterreguiieren der faserselektiven ß-1 ,3-Glucanase, wie dies in WO 2005/017157 beschrieben ist; f) Pflanzen wie Baumwollpflanzen mit Fasern mit veränderter Reaktivität, z. B. durch Expression des N-Acetylglucosamintransferasegens, darunter auch nodC, und von Chitinsynthasegenen, wie dies in WO 2006/136351 beschrieben ist.
Pflanzen oder Pflanzensorten (die nach Methoden der pflanzlichen Biotechnologie, wie der Gentechnik, erhalten wurden), die ebenfalls im erfindungsgemäßen Verfahren Anwendung finden können, sind Pflanzen wie Raps oder verwandte Brassica-Pflanzen mit veränderten Eigenschaften der Ölzusammensetzung. Solche Pflanzen können durch genetische Transformation oder durch Selektion von Pflanzen, die eine Mutation enthalten, die solche veränderten Öleigenschaften verleiht, erhalten werden; dazu zählen: a) Pflanzen wie Rapspflanzen, die Öl mit einem hohen Ölsäuregehalt produzieren, wie dies zum Beispiel in US 5,969,169, US 5,840,946 oder US 6,323,392 oder US 6,063,
947 beschrieben ist; b) Pflanzen wie Rapspflanzen, die Öl mit einem niedrigen Linolensäuregehalt produzieren, wie dies in US 6,270828, US 6,169,190 oder US 5,965,755 beschrieben ist. c) Pflanzen wie Rapspflanzen, die Öl mit einem niedrigen gesättigten Fettsäuregehalt produzieren, wie dies z. B. in US 5,434,283 beschrieben ist. Besonders nützliche transgene Pflanzen, die im erfindungsgemäßen Verfahren Anwendung finden können, sind Pflanzen, die Transformations-Events, oder eine Kombination von Transformations-Events, enthalten und die zum Beispiel in den Dateien von verschiedenen nationalen oder regionalen Behörden angeführt sind.
Besonders nützliche transgene Pflanzen, die im erfindungsgemäßen Verfahren Anwendung finden können, sind beispielhaft Pflanzen mit einem oder mehreren Genen, die für ein oder mehrere Toxine kodieren, sind die transgenen Pflanzen, die unter den folgenden Handelsbezeichnungen angeboten werden: YIELD GARD® (zum Beispiel Mais, Baumwolle, Sojabohnen), KnockOut® (zum Beispiel Mais), BiteGard® (zum Beispiel Mais), BT-Xtra® (zum Beispiel Mais), StarLink® (zum Beispiel Mais), Bollgard® (Baumwolle), Nucotn® (Baumwolle), Nucotn 33B® (Baumwolle), NatureGard® (zum Beispiel Mais), Protecta® und Ne Leaf® (Kartoffel). Herbizidtolerante Pflanzen, die zu erwähnen sind, sind zum Beispiel Maissorten, Baumwollsorten und
Sojabohnensorten, die unter den folgenden Handelsbezeichnungen angeboten werden: Roundup Ready® (Glyphosatetoleranz, zum Beispiel Mais, Baumwolle, Sojabohne), Liberty Link® (Phosphinotricintoleranz, zum Beispiel Raps), IMI®
(Imidazolinontoleranz) und SCS® (Sylfonylharnstofftoleranz), zum Beispiel Mais. Zu den herbizidresistenten Pflanzen (traditionell auf Herbizidtoleranz gezüchtete
Pflanzen), die zu erwähnen sind, zählen die unter der Bezeichnung Clearfield® angebotenen Sorten (zum Beispiel Mais).
Behandlung der Pflanzen und/oder ihrer Früchte Besonders bevorzugt werden die Pflanzen und/oder ihre Früchte im
erfindungsgemäßen Verfahren mit der die Interaktion hemmenden Verbindung zur Beeinflussung ihres Reifungsprozesses, ihres Seneszenzprozesses und/oder ihrer Stresstoleranz behandelt. Dabei schließt der Begriff "Behandlung" alle Maßnahmen ein, die zu einem Kontakt zwischen diesen Wirkstoffen und mindestens einem
Pflanzen- beziehungsweise Fruchtteil führen.
Die erfindungsgemäßen die Interaktion hemmende Verbindung kann auf verschiedene Art formuliert werden, je nachdem welche biologischen und/oder chemisch
physikalischen Parameter vorgegeben sind. Als Formulierungsmöglichkeiten kommen beispielsweise in Frage: Spritzpulver (WP), wasserlösliche Pulver (SP), wasserlösliche Konzentrate, emulgierbare Konzentrate (EC), Emulsionen (EW), wie Öl in Wasser und Wasser in Öl Emulsionen, versprühbare Lösungen, Suspensionskonzentrate (SC), Dispersionen auf Öl oder Wasserbasis, ölmischbare Lösungen, Kapseisuspensionen (CS), Stäubemittel (DP), Beizmittel, Granulate für die Streuapplicaktion, Granulate (GR) in Form von Mikro , Sprüh , Aufzugs und Adsorptionsgranulaten,
wasserdispergierbare Granulate (WG), wasserlösliche Granulate (SG), ULV
Formulierungen, Mikrokapseln und Wachse. Diese einzelnen Formulierungstypen sind im Prinzip bekannt und werden
beispielsweise beschrieben in: Winnacker Küchler, "Chemische Technologie",
Band 7, C. Hanser Verlag München, 4. Aufl. 1986; Wade van Valkenburg, "Pesticide Formulations", Marcel Dekker, N.Y., 1973; K. Martens, "Spray Drying" Handbook, 3rd Ed. 1979, G. Goodwin Ltd. London.
Die notwendigen Formulierungshilfsmitte! wie Inertmaterialien, Tenside, Lösungsmittel, Hilfsstoffe und weitere Zusatzstoffe sind ebenfalls bekannt und werden beispielsweise beschrieben in: Watkins, "Handbook of Insecticide Dust Diluents and Carriers", 2nd Ed., Darland Books, Caldwell N.J., H.v. Olphen, "Introduction to Clay Colloid
Chemistry"; 2nd Ed., J. Wiley & Sons, N.Y.; C. Marsden, "Solvente Guide"; 2nd Ed., Interscience, N.Y. 1963; McCutcheon's "Detergents and Emulsrfiers Annual", MC Publ. Corp., Ridgewood N.J.; Sisley and Wood, "Encyclopedia of Surface Active Agents", Chem. Publ. Co. Inc., N.Y. 1964; Schönfeldt, "Grenzflächenaktive
Äthylenoxidaddukte", Wiss. Verlagsgesell., Stuttgart 1976; Winnacker Küchler,
"Chemische Technologie", Band 7, C. Hanser Verlag München, 4. Aufl. 1986.
Spritzpulver sind in Wasser gleichmäßig dispergierbare Präparate, die neben der die Interaktion hemmenden Verbindung außer einem Verdünnung s- oder Inertstoff noch Tenside ionischer und/oder nichtionischer Art (Netzmittel, Dispergiermittel), z.B.
polyoxyethylierte Alkylphenole, polyoxethylierte Fettalkohole, polyoxethylierte
Fettamine, Fettalkoholpolyglykolethersulfate, Alkansuifonate, Alkylbenzolsulfonate, ligninsulfonsaures Natrium, 2,2' dinaphthylmethan 6,6' disulfonsaures Natrium, dibutylnaphthalin sulfonsaures Natrium oder auch oleoylmethyltaurinsaures Natrium enthalten. Zur Herstellung der Spritzpulver werden die die Interaktion hemmenden Verbindungen beispielsweise in üblichen Apparaturen wie Hammermühlen,
Gebläsemühlen und Luftstrahlmühlen feingemahlen und gleichzeitig oder
anschließend mit den Formulierungshilfsmitteln vermischt Stäubemittel erhält man durch Vermählen der die Interaktion hemmenden Verbindung mit fein verteilten festen Stoffen, z.B. Talkum, natürlichen Tonen, wie Kaolin, Bentonit und Pyrophyllit, oder Diatomeenerde.
Suspensionskonzentrate können auf Wasser oder Ölbasis sein. Sie können
beispielsweise durch Nass Vermahlung mittels handelsüblicher Perlmühlen und gegebenenfalls Zusatz von Tensiden, wie sie z.B. oben bei den arideren
Formulierungstypen bereits aufgeführt sind, hergestellt werden.
Emulsionen, z.B. Öl in Wasser Emulsionen (EW), lassen sich beispielsweise mittels Rührern, Kolloidmühlen und/oder statischen Mischern unter Verwendung von wäßrigen organischen Lösungsmitteln und gegebenenfalls Tensiden, wie sie z.B. oben bei den anderen Formulierungstypen bereits aufgeführt sind, herstellen.
Granulate können entweder durch Verdüsen der die Interaktion hemmenden
Verbindung auf adsorptionsfähiges, granuliertes Inertmaterial hergestellt werden oder durch Aufbringen von Konzentraten mittels Klebemitteln, z.B. Polyvinylalkohol, poiyacrylsaurem Natrium oder auch Mineralölen, auf die Oberfläche von Trägerstoffen wie Sand, Kaolinite oder von granuliertem Inertmaterial. Wasserdispergierbare Granulate werden in der Regel nach den üblichen Verfahren wie Sprühtrocknung, Wirbelbett Granulierung, Teller Granulierung, Mischung mit Hochgeschwindigkeitsmischern und Extrusion ohne festes Inertmaterial hergestellt.
Zur Herstellung von Teller , Fließbett , Extruder und Sprühgranulate siehe z.B.
Verfahren in "Spray Dryirtg Handbook" 3rd ed. 1979, G. Goodwin Ltd., London; J.E. Browning, "Agglomeration", Chemical and Engineering 1967, Seiten 147 ff; "Perry's Chemical Engineer's Handbook", 5th Ed., McGraw Hill, New York 1973, S. 8 57. Die erfindungsgemäßen Zubereitungen enthalten in der Regel 0.1 bis 99 Gew. %, insbesondere 0.1 bis 95 Gew. der die Interaktion hemmenden Verbindung. In
Spritzpulvern beträgt die Konzentration z.B. etwa 10 bis 90 Gew. %, der Rest zu 100 Gew. % besteht aus üblichen Formulierungsbestandteilen. Bei emulgierbaren
Konzentraten kann die Konzentration der die Interaktion hemmenden Verbindung etwa 1 bis 90, vorzugsweise 5 bis- 80 Gew. % betragen. Staubförmige Formulierungen enthalten 1 bis 30 Gew. % der die Interaktion hemmenden Verbindung, vorzugsweise meistens 5 bis 20 Gew. % der die Interaktion hemmenden Verbindung, versprühbare Lösungen enthalten etwa 0.05 bis 80, vorzugsweise 2 bis 50 Gew. % der die
Interaktion hemmenden Verbindung. Bei wasserdispergierbaren Granulaten hängt der Gehalt der die Interaktion hemmenden Verbindung zum Teil davon ab, ob die wirksame Verbindung flüssig oder fest vorliegt und welche Granulierhilfsmitte!,
Füllstoffe usw. verwendet werden. Bei den in Wasser dispergierbaren Granulaten liegt der Gehalt an der die Interaktion hemmenden Verbindung beispielsweise zwischen 1 und 95 Gew. %, vorzugsweise zwischen 10 und 80 Gew. %.
Daneben enthalten die genannten Formulierungen gegebenenfalls die jeweils üblichen Haft , Netz , Dispergier , Emulgier , Penetrations , Konservierungs , Frostschutz und Lösungsmittel, Füll , Träger und Farbstoffe, Entschäumer, Verdunstungshemmer und den pH Wert und die Viskosität beeinflussende Mittel.
In einer bevorzugten Ausführungsform wird die die Interaktion hemmende Verbindung, in Form einer wässrigen Lösung in die Pflanzen und/oder Früchte auf die Oberfläche der Pflanzen und/oder Früchte aufgetragen.
Weiterhin bevorzugt wird die die Interaktion hemmende Verbindung auf die Oberfläche der Pflanzen und/oder Früchte aufgesprüht oder aufgetragen wird oder dass die Pflanzen und/oder Früchte in der wässrigen Lösung der die Interaktion hemmenden Verbindung eingetaucht. Besonders bevorzugt wird dabei die die Interaktion
hemmende Verbindung in Form einer wässrigen Lösung verwendet.
Die vorliegende Erfindung betrifft daher darüber hinaus auch eine Sprühformulierung der die Interaktion hemmenden Verbindung zur Beeinflussung des Reifungsprozesses, des Seneszenzprozesses und/oder der Stresstoleranz von Pflanzen und/oder ihrer Früchte. Im Folgenden wird eine Sprühformulierung näher beschrieben:
Die Formulierungen zur Sprühapplikation werden in bekannter Weise hergestellt, z.B. durch Vermischen der erfindungsgemäß zu verwendenden, die Interaktion
hemmenden Verbindung mit Streckmitteln» also flüssigen Lösungsmitteln und/oder festen Trägerstoffen, gegebenenfalls unter Verwendung -von oberflächenaktiven Mitteln, also Emulgiermitteln und/oder Dispergiermitteln und/oder schaumerzeugenden Mitteln. Weitere übliche Zusatzstoffe, wie zum Beispiel übliche Streckmittel sowie Lösungs- oder Verdünnungsmittel, Farbstoffe, Netzmittel, Dispergiermittel,
Emulgatoren, Entschäumer, Konservierungsmittel, sekundäre Verdickungsmittel, Kleber, Gibberelline und auch Wasser, können gegebenenfalls auch verwendet werden. Die Herstellung der Formulierungen erfolgt entweder in geeigneten Anlagen oder auch vor oder während der Anwendung.
Als Hilfsstoffe können solche Stoffe Verwendung finden, die geeignet sind, dem Mittel selbst oder und/oder davon abgeleitete Zubereitungen (z.B. Spritzbrühen) besondere Eigenschaften zu verleihen, wie bestimmte technische Eigenschaften und/oder auch besondere biologische Eigenschaften. Als typische Hilfsmittel kommen in Frage:
Streckmittel, Lösemittel und Trägerstoffe.
Als Streckmittel eignet sich insbesondere Wasser. Als Netzmittel, die in den
erfindungsgemäß verwendbaren Formulierungen enthalten sein können, kommen alle zur Formulierung von agrochemischen Wirkstoffen üblichen, die Benetzung fördernden Stoffe in Frage. Vorzugsweise verwendbar sind Alkylnaphthalin-Sulfonate, wie
Diisopropyl- oder Diisobutylnaphthalin-Sulfonate.
Als Dispergiermittel und/oder Emulgatoren, die in den erfindungsgemäß verwendbaren Formulierungen enthalten sein können, kommen alle zur Formulierung von agro- chemischen Wirkstoffen üblichen nichtionischen, anionischen und kationischen Dispergiermittel in Betracht. Vorzugsweise verwendbar sind nichtionische oder anionische Dispergiermittel oder Gemische von nichtionischen oder anionischen Dispergiermitteln. Als geeignete nichtionische Dispergiermittel sind insbesondere Ethylenoxid- Propylenoxid-Blockpolymere, Alkylphenolpolyglykolether sowie Tristryrylphenol- polyglykolether und deren phosphatierte oder sulfatierte Derivate zu nennen.
Geeignete anionische Dispergiermittel sind insbesondere Ligninsulfonate,
Polyacryisäuresalze und Arylsulfonat-Formaldehydkondensate.
Als Entschäumer können in den erfindungsgemäß verwendbaren Formulierungen alle zur Formulierung von agrochemischen Wirkstoffen üblichen schaumhemmenden Stoffe enthalten sein. Vorzugsweise verwendbar sind Silikonentschäumer und
Magnesium-stearat.
Als Konservierungsmittel können in den erfindungsgemäß verwendbaren
Formulierungen alle für derartige Zwecke in agrochemischen Mitteln einsetzbaren Stoffe vorhanden sein.
Als sekundäre Verdickungsmittel, die in den erfindungsgemäß verwendbaren Formulierungen enthalten sein können, kommen alle für derartige Zwecke in agrochemischen Mitteln einsetzbaren Stoffe in Frage. Vorzugsweise in Betracht kommen Cellulose- derivate, Acrylsäurederivate, Xanthan, modifizierte Tone und hochdisperse
Kieselsäure.
Als Kleber, die in den erfindungsgemäß verwendbaren Formulierungen enthalten sein können, kommen alle üblichen in Beizmitteln einsetzbaren Bindemittel in Frage.
Vorzugsweise genannt seien Polyvinylpyrrolidon, Polyvinylacetat, Polyvinylalkohol und Tylose.
Wertere Additive können Duftstoffe, mineralische oder vegetabilische gegebenenfalls modifizierte Öle, Wachse und Nährstoffe (auch Spurennährstoffe), wie Salze von Eisen, Mangan, Bor, Kupfer, Kobalt, Molybdän und Zink sein. Weiterhin enthalten sein können Stabilisatoren wie Kältestabilisatoren, Oxidationsschutzmittel, Lichtschutzmittel oder andere die chemische und / oder physikalische Stabilität verbessernde Mittel.
Die Formulierungen enthalten im Allgemeinen zwischen 0,01 und 98 Gew.-%, vorzugsweise zwischen 0,5 und 90 %, der die Interaktion hemmenden Verbindung. 89
In einem weiteren Aspekt der vorliegenden Erfindung wird ein Mittel zur Beeinflussung des Reifungsprozesses, des Seneszenzprozesses und/oder der Stresstoleranz von Pflanzen und/oder ihrer Früchte bereitgestellt, welches mindestens eine Verbindung umfasst, welche ausgewählt wird aus der Gruppe, beste end aus einem Peptid, einem Peptidmimetikum, einem Aptamer, einem Antikörper und/oder seiner Fragmente, dadurch gekennzeichnet, dass das Peptid oder der Antikörper und/oder dessen Fragmente eine Aminosäuresequenz umfasst, welche ausgewählt wird aus der Gruppe, bestehend aus der Aminosäuresequenz SEQ ID NO: 1 , der
Aminosäuresequenz SEQ ID NO: 2, der Aminosäuresequenz SEQ ID NO: 3, einer Permutation einer der Aminosäuresequenzen SEQ ID NO: 1 bis SEQ ID NO: 3, einem Teil einer der Aminosäuresequenzen SEQ ID NO: 1 bis SEQ ID NO: 3, welcher mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 6 der in SEQ ID NO: 1 bis SEQ ID NO: 3 genannten Aminosäuren umfasst, und einem Derivat einer der Aminosäuresequenzen SEQ ID NO: 1 bis SEQ ID NO: 3, dass das
Peptidmimetikum mindestens eine am Peptid rückgrat modifizierte Aminosäuresequenz umfasst, welche ausgewählt wird aus der Gruppe, bestehend aus der
Aminosäuresequenz SEQ ID NO: 1 , der Aminosäuresequenz SEQ ID NO: 2, der Aminosäuresequenz SEQ ID NO: 3, einer Permutation einer der
Aminosäuresequenzen SEQ ID NO: 1 bis SEQ ID NO: 3, einem Teil einer der
Aminosäuresequenzen SEQ ID NO: 1 bis SEQ ID NO: 3, welcher mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 6 der in SEQ ID NO: 1 bis SEQ ID NO: 3 genannten Aminosäuren umfasst, und einem Derivat einer der
Aminosäuresequenzen SEQ ID NO:1 bis SEQ ID NO: 3 oder dass das Aptamer auf Basis der Zielstruktur eines Peptids hergestellt wird, wobei das Peptid ausgewählt wird, aus der Aminosäuresequenz SEQ ID NO: 1 , der Aminosäuresequenz
SEQ ID NO: 2, der Aminosäuresequenz SEQ ID NO: 3, einer Permutation einer der Aminosäuresequenzen SEQ ID NO: 1 bis SEQ ID NO: 3, einem Teil einer der
Aminosäuresequenzen SEQ ID NO: 1 bis SEQ ID NO: 3, welcher mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 6 der in SEQ ID NO: 1 bis SEQ ID NO: 3 genannten Aminosäuren umfasst, und einem Derivat einer der
Aminosäuresequenzen SEQ ID NO: 1 bis SEQ ID NO: 3. Dabei sind Verbindungen ausgenommen, bei denen das Peptid und/oder der Antikörper und/oder dessen
Fragmente eine Aminosäuresequenz der SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101 oder SEQ ID NO: 102, und/oder einen Teil einer der Aminosäuresequenzen SEQ ID NO: 98 bis SEQ ID NO: 102, welcher mindestens 6 der in SEQ ID NO: 98 bis SEQ ID NO: 102 genannten Aminosäuren umfasst und/oder eine Derivat der Aminosäuresequenzen SEQ ID NO: 98 bis 102 umfasst und/oder bei denen ein Peptidmimetikum aus einer am Peptid rückgrat modifizierten
Aminosäuresequenz besteht, welche ausgewählt wird aus der Gruppe, bestehend aus SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101 und SEQ ID NO: 102, und/oder bei denen ein Aptamer auf Basis der Zielstruktur eines Peptids hergestellt wird, wobei das Peptid ausgewählt wird aus der Gruppe, bestehend aus SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100 SEQ ID NO: 101 und SEQ ID NO: 102.
Ebenso wird ein Mittel zur Beeinflussung des Reifungsprozesses, des
Seneszenzprozesses und/oder der Stresstoleranz von Pflanzen und/oder ihrer Früchte bereitgestellt umfassend mindestens eine Verbindung, welche ausgewählt wird aus der Gruppe, bestehend aus einem Peptid, einem Peptidmimetikum, einem Aptamer, einem Antikörper und/oder seiner Fragmente, dadurch gekennzeichnet, dass das Peptid oder der Antikörper und/oder dessen Fragmente die Aminosäuresequenz SEQ ID NO: 103, einen Teil der Aminosäuresequenz SEQ ID NO: 103, welcher mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 6 der in SEQ ID NO: 102 genannten Aminosäuren umfasst, oder ein Derivat der Aminosäuresequenz SEQ ID NO: 103 umfasst, dass das Peptidmimetikum die am Peptid rückgrat modifizierte Aminosäuresequenz SEQ ID NO: 103, einen Teil einer am Peptidrückgrat
modifizierten Aminosäuresequenz SEQ ID NO: 103, welcher mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 8 der in SEQ ID NO: 103 genannten Aminosäuren umfasst, oder ein Derivat einer am Peptidrückgrat modifizierten
Aminosäuresequenz SEQ ID NO:103 umfasst oder dass das Aptamer auf Basis der Zielstruktur eines Peptids hergestellt wird, wobei das Peptid ausgewählt wird, aus der Aminosäuresequenz SEQ ID NO: 103, einem Teil einer der Aminosäuresequenzen SEQ ID NO: 103, welcher mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 6 der in SEQ ID NO: 103 genannten Aminosäuren umfasst, und einem Derivat der Aminosäuresequenz SEQ ID NO: 103, wobei, wenn die
Aminosäuresequenz SEQ ID NO: 103 an einer Position Alanin umfasst, keine der anderen Aminosäuren der SEQ ID NO: 103 Alanin ist. Dieses Mittel kann auch die oben beschriebenen bevorzugten Ausgestaltungen der Verbindungen, welche ausgewählt werden aus der Gruppe, bestehend aus dem erfindungsgemäßen Peptid, dem erfindungsgemäßen Antikörper und/oder seiner Fragmente, dem erfindungsgemäßen Peptidmimetikum, dem erfindungsgemäßen Aptamer und Kombinationen dieser erfindungsgemäßen Verbindungen umfassen.
Dabei ist das Mittel insbesondere, dadurch gekennzeichnet, dass es die Interaktion des Proteins EIN2 (Ethylene Insensitive 2) oder eines orthologen Proteins davon mit dem Rezeptorprotein ETR1 (Ethylene resistent 1 ), seiner Isoformen ERS1 , ETR2, ERS2, EIN4 oder homologen oder orthologen Proteinen davon durch die Interaktion mit einer Kontaktdomäne des Ethylenrezeptors ETR1 oder seiner Isoformen ERS1 , ETR2, ERS2, EIN4 oder eines homologen oder orthologen Proteins davon hemmt.
In einer bevorzugten Ausführungsform umfasst das Mittel mindestens eine weitere Verbindung, welche dazu geeignet ist, den Reifungsprozess, den Seneszenzprozess und/oder der Stresstoleranz von Pflanzen und/oder ihrer Früchte zu beeinflussen. Dabei handelt es sich bevorzugt um einen Ethylenantagonisten.
In einer weiteren, bevorzugten Ausführungsform umfasst das Mittel zusätzlich mindestens ein Formulierungsmittel, welches ausgewählt wird aus der Gruppe, bestehend aus Inertmaterialien, Tensiden, Lösungsmitteln und Hilfsstoffen.
Bevorzugte Ausführungsformen Ausführungsform 1 : Verfahren zur Beeinflussung des Reifungsprozesses, des
Seneszenzprozesses und/oder der Stresstoleranz von Pflanzen und/oder ihrer
Früchte, dadurch gekennzeichnet, dass in den Pflanzen und/oder Früchten die
Interaktion des Proteins EIN2 (Ethylene Insensitive 2) oder eines orthologen Proteins davon mit dem Rezeptorprotein ETR1 (Ethylene resistent 1 ) seiner Isoformen ERS1 , ETR2, ERS2, EIN4 oder homologen oder orthologen Proteinen davon durch die
Interaktion einer Verbindung, welche ausgewählt wird aus der Gruppe, bestehend aus einem Peptid, einem Peptidmimetikum und Mischungen dieser Verbindungen mit einer Kontaktdomäne des Ethylenrezeptors ETR1 oder seiner Isoformen ERS1 , ETR2, ERS2, EIN4 oder eines homologen oder orthologen Proteins davon gehemmt wird, wobei die Kontaktdomäne diejenige ist, welche mit EIN2 oder einem orthoiogen Protein davon interagiert.
Beschreibung der Bilder
Figur 1 : Darstellung von Spezies, welche ein zu ETR1 homologes Protein aufweisen teilweise mit Angabe des Grades der Übereinstimmung
Figur 2: Ergebnisse des Beispiels 1 : Bestimmung der in vitro ETR1-EIN2 Interaktion auf Basis der Tryptophan-Fiuoreszenz durch die Zugabe von NLSOP-1 (Peptid, welches in der Lage ist, mit der Kontaktdomäne des ETR1 zu interagieren) und ROP-1 {Peptid mit zufälliger Aminosäuresequenz» als Kontrolle)
Figur 3: Ergebnisse des Beispiels 2: Bestimmung der in planta FRET Effizienz eines GFP markierten E1N2 und mCherry markierten ETR1 unter Zugabe von NLSOP-1 (Peptid, welches in der Lage ist, mit der Kontaktdomäne des ETR1 zu interagieren) und ROP-1 (Peptid mit zufälliger Aminosäuresequenz, als Kontrolle)
Figur 4: Ergebnisse des Beispiels 3: der Bestimmung der Hypokotyllänge von
Arabidopsis unter Verwendung von NLSOP-1 in unterschiedlichen Konzentrationen (Peptid, welches in der Lage ist, mit der Kontaktdomäne des ETR1 zu interagieren) und ROP-1 (Peptid mit zufälliger Aminosäuresequenz, Kontrolle); * bedeutet: P<0,005 im Vergleich zur positiven Kontrolle (nur ACC)
Figur 5: Ergebnisse des Beispiels 5: Bestimmung der in vitro ETR1 -EIN2 Interaktion auf Basis der FRET Effizienz eines Alexa Fluor 568 markierten EIN2479"1297 und eines Alexa Fluor 488 markierten ETR1 unter Zugabe unterschiedlicher Peptide
Figur 6: Ergebnisse des Beispiels 6: Bestimmung der in vitro ETR1-EIN2 Interaktion auf Basis der FRET Effizienz eines Alexa Fluor 568 markierten E1N2479"1297 und eines Alexa Fluor 488 markierten ETR1 unter Zugabe unterschiedlicher Sequenzvarianten des Peptids SEQ ID NO: 4
Figur 7: Ergebnisse des Beispiels 7: Bestimmung der in vitro ETR1-E1N2 Interaktion auf Basis der FRET Effizienz eines Alexa Fluor 568 markierten E1 2479"1297 und eines Alexa Fluor 488 markierten ETR1 unter Zugabe unterschiedlicher Aptamervarianten des Peptids SEQ ID NO: 4 Figur 8: Darstellung des Homologiemodels nach 4f5x.pdb (vorhanden in RCSB Protein Data Bank) (siehe auch Tabelle 1 ) Beispiele
Beispiel 1 ; In vitro Interaktionsstudie von EIN2 und ETR1
Zum Nachweis der Störung der Interaktion von EIN2 und ETR1 wurden zwei unterschiedliche Peptide synthetisiert. Das Peptid, welches im Folgenden mit NLSOP- 1 bezeichnet wird (nuclear localization Signal octapeptide), umfasst einen Bereich, welcher zur Interaktion mit ETR1 geeignet ist. NLSOP-1 weist die Äminosäuresequenz SEQ ID NO: 4 auf, welche der Sequenz H2N-LKRYKRRL-COOH entspricht. Das zweite Peptid, welches im Folgenden als ROP-1 bezeichnet wird (random
octapeptide), beinhaltet eine zufällige Sequenz, welche bestimmt wurde durch ExPASy Random Protein Sequence Generator (http://web.expasy.org/randseq) und wurde als negative Kontrolle verwendet. ROP-1 weist die Aminosäuresequenz SEQ ID NO: 97 auf, welche der Sequenz H2N-EFLYMSVN-COOH entspricht. Die Synthese beider Peptide erfolgte durch Festphasenpeptidsynthese mit dem Gerät „Peptide Synthesizer 433A" von Applied Biosystems.
Der Effekt dieser beiden Peptide auf die EIN2-ETR1 Interaktion wurde durch ein quantitatives Verfahren, basierend auf der Fluoreszenz des Tryptophans, mit den gereinigten, rekombinanten Proteinen untersucht. Hierbei werden von einem Protein, welches an der Interaktion beteiligt ist, alle endogenen Tryptophan-Reste entfernt. Durch die Zugabe von diesem tryptophanfreien Protein zum Wechselwirkungspartner wird dessen intrinsische Fluoreszenz lokal an der Stelle der Wechselwirkung gequencht, da sich hier die Umgebung des Wechselwirkungspartners ändert. Dieses Quenching kann genutzt werden, um die Stabilität der Wechselwirkung und die
Dissoziationskonstante des Komplexes zu bestimmen.
Dieses Verfahren wie auch das Verfahren zur Herstellung des ETR1
Expressionsvektors wird in M. M. A. Bisson, A. Bleckmann, S. Allekotte, G. Groth, EIN2, the central regulator of ethylene Signalling, is localized at the ER membrane where it interacts with the ethylene receptor ETR1 , Brachem J: 424, 1 -6; 2009 und M. M. A. Bisson, G. Groth, New insight in ethylene signaling: autokinase activity of ETR1 modulates the interaction of receptors and EIN2, Molecular Plant: 5,882-889, 2010 beschrieben. Ebenso wird in erst genannter Publikation das Verfahren zur Expression und Aufreinigung des rekombinanten ETR1 in voller Länge (amino acid 1 -738) und E1N2479"1294ÄW, welches tryptop hanfrei ist und den carboxyterminalen Bereich des Proteins aufweist (amino acid 479-1294), beschrieben. Beide rekombinanten Proteine wurden aus Arabidopsis thaliana isoliert, geklont und in Escherichia coli exprimiert.
Zu einer Mischung aus dem Protein ETR1 und entweder dem Peptid NLSOP-1 oder ROP-1 in jeweils unterschiedlichen Konzentrationen wurde das gereinigte
tryptophanfreie EIN2479~1294AW schrittweise titriert. Dabei wurde die Tryptophan- Fluoreszenz des ETR1 bei 348 nm mit einer Anregungswellenlänge von 295 nm betrachtet. Die resultierende Quenchung der Fluoreszenz wurde gegen die
Konzentration des entsprechenden Peptids aufgetragen und die
Dissoziationskonstante mit dem Programm GraFit (Erithacus Software Ltd.) berechnet. Dabei wurde eine Kurvenanpassung verwendet, welche das Model zu Grunde legte, dass eine einzige Bindungssteile pro Wechselwirkungspartner vorhanden ist. Die in Figur 2 angegebenen Dissoziationskonstanten wurden durch drei unabhängige
Messungen bestimmt und die Fehlerbalken zeigen die Standardabweichung dieser drei Messungen.
In Figur 2 ist die Dissoziationskonstante des Komplexes EI 2 ra"1Z94ÄW mit ETR1 in Abhängigkeit von der Konzentration der Peptide NLSOP-1 und ROP-1 gezeigt. Es ist zu sehen, dass ROP-1 selbst bei hohen Konzentrationen des Peptids nahezu keinen Effekt auf die Dissoziationskonstante des Komplexes ausübt. Im Gegensatz dazu, ist eine stark ausgeprägte Reduzierung der Affinität von ETR1 zu EIN2 unter Verwendung von NLSOP-1 zu beobachten. Die Inhibierung der EIN2-ETR1 Komplexbildung ist proportional zur NLSOP-1 Konzentration. Die Dissoziationskonstanten werden vervierfacht bei 10 μΜ NSLOP-1 und verdreißigfacht bei 200 μΜ NLSOP-1 , wodurch eine kompetitive Verdrängung des EIN2 durch NLSOP-1 nahegelegt wird. Diese Ergebnisse zeigen, dass durch die Interaktion einer Verbindung» welche mit der Kontaktdomäne des ETR1 interagieren kann (NLSOP-1 ), die Interaktion des ETR1 mit EIN2 gehemmt wird. Beispiel 2: In planta Interaktionsstudie von EIN2 und ETR1
Hierzu wurden die Peptide, welche in Beispiel 1 näher beschrieben wurden,
verwendet. Die Interaktion eines GFP-markierten EIN2 als Donor und einem mCherry- markierten ETR1 (siehe Shaner, Nathan C; Campbell, Robert E; Stein bach, Paul A; Giepmans, Ben N G; Palmer, Amy E; Tsien, Roger Y (2004). "Improved monomeric red, orange and yellow fluorescent proteins derived from Discosoma sp. Red fluorescent protein". Nature Biotechnology 22 (12): 1587-72) als Akzeptor wurde über den Fluoreszenz-Resonanz-Energie-Transfer (FREI) mittels konfokalen Mikroskops gemessen. Dabei wurde das Akzeptorfluorophor an das C-terminale Ende des EIN2 gebunden und der Donor an das C-terminale Ende des ETR1. Die transiente
Expression in Epidermiszellen der Blätter von Nicotiana benthamiana wurde verfolgt, wie in M. M. A. Bisson, A. Bleckmann, S. Allekotte, G. Groth, EIN2, the central regulator of ethylene signalling, is locaiized at the ER membrane where it interacts with the ethylene receptor ETR1 , Biochem J: 424, 1-8; 2009 und M, M. A. Bisson, G. Groth, New insight in ethylene signaling: autokinase activity of ETR1 modulates the
interaction of receptors and EIN2, Molecular Plant: 5,882-889, 2010 beschrieben. Die Blätter wurden 1 h bevor mit der Messung begonnen wurde mit 100 μΜ NLSOP-1 oder 100 μΜ ROP-1 inkubiert. Ein Tandemkonstrukt von GFP und mCherry an EIN2
(ASEQ ID NO: 4) (d. h. ein EIN2, welches die SEQ ID NO: 4 nicht aufweist) wurde als positive Kontrolle verwendet. Die Ergebnisse stellen Mittelwerte mit
Standardabweichungen, wobei n = 15 Zellen war, dar.
Die Ergebnisse der FRET Studie sind in Figur 3 gezeigt. Die FRET Effizienz zwischen EIN2 und ETR1 , welche in Anwesenheit von ROP-1 erhalten wird, beträgt 12,0 ± 2,1 %. Sie ähnelt damit dem Wert der positiven Kontrolle (16.9 %) und dem Wert, welcher in Abwesenheit eines Peptids erhalten wird. Damit weist ROP-1 nahezu keinen Effekt auf die EIN2-ETR1 Komplexbildung auf. Im Gegensatz dazu wird der Energietransfer auf 2,2 ± 1 ,0 % reduziert, wenn NLSOP-1 verwendet wird. Dieser Wert ist nur unwesentlich über dem Wert des Hintergrundrauschens (1 ,9 %). Diese Ergebnisse zeigen, dass durch die Interaktion einer Verbindung, welche mit der Kontaktdomäne des ETR1 interagieren kann (NLSOP-1 ), die Interaktion des ETR1 mit EIN2 auch in planta gehemmt wird.
Beispiel 3: Hemmung der Ethylenantwort in Arabidopsis
Zur Bestimmung der Ethylenantwort in lebenden Pflanzen wurde die Dreifachantwort von im Dunkeln aufgezogenen Arabidopsis thaliana untersucht. Dazu wurden
Wildtyppflanzen von Arabidopsis thaliana (Ökotyp Columbia) verwendet, wie sie in M. M. A. Bisson, G. Groth, New insight in ethylene signaling: autokinase acttvity of ETR1 modulates the interaction of receptors and EIN2, Molecular Plant: 5,882-889, 2010 beschrieben sind. Die Peptide des Beispiels 1 wurden zum Agar in unterschiedlichen Konzentrationen gegeben, bevor die Samen gepflanzt wurden. Als Ethylenprecursor wurde 1 -Aminocylopropan-1 -carboxylsäure (ACC) verwendet. Das
Hypokotylwachstum der Pflanzen wurde bestimmt als ein charakteristisches Merkmal der Dreifachantwort. Dazu wurde die Hypokotyl länge einer Pflanze, welche in
Abwesenheit von ACC wuchs auf 100 % gesetzt (negative Kontrolle; erste Spalte von links in Figur 4, bezeichnet mit„Air") und alle anderen gemessenen Längen auf diese Länge bezogen. Die Ergebnisse werden als Mittelwert von 40 Messungen mit
Standardabweichung in Figur 4 dargestellt.
Die maximale Dreifachantwort wurde bei Pflanzen, welche in Anwesenheit von ACC gezogen wurden, beobachtet, welche als positive Kontrolle gesetzt wurde (zweiter Balken von links in Figur 4, bezeichnet mit„ACC"). Die Pflanzen, welche mit ansteigender Konzentration von NSLOP-1 und ACC behandelt wurden, zeigten eine inhibierte Ethylenantwort (Balken 3 bis 8 von links in Figur 4, wobei die Konzentration an NLSOP-1 jeweils angegeben ist). Der Grad der Inhibierung korreliert mit der Konzentration des angewendeten NLSOP-1. Die Länge des Hypokotyls einer Pflanze, welche in Anwesenheit von 200 μΜ ROP-1 und ACC gezogen wurde, entspricht der positiven Kontrolle (Balken 9 von links in Figur 4).
Die Ergebnisse zeigen, dass unter Verwendung des Proteins NLSOP-1 die
Dreifachantwort inhibiert werden konnte. Beispiel 4: Hemmung der Ethyienantwort in Tomaten
Der Einfluss des in Beispiel 1 beschriebenen Peptids NLSOP-1 auf die Hemmung der Ethyienantwort wurde an Hand der Reifung von Tomaten untersucht. Dazu wurden grüne, unreife Tomaten durch zwei verschiedene Behandlungsmethoden mit dem Peptid inkubiert. Die behandelten Tomaten und auch unbehandelte Kontrolltomaten wurden in Probenröhrchen, welche mit einer Alufolie verschlossen wurden, bis zu 20 Tage bei Raumtemperatur in einem fensterlosen, dunklen Raum gelagert. Der Reifungsprozess wurde zu unterschiedlichen Zeitpunkten mit einer Digitalkamera dokumentiert.
Zur Applikation von NLSOP-1 auf die Tomaten wurden die folgenden Verfahren verwendet:
Applikation 1 : Oberflächenbehandlung
Eine Tomate wurde mit Hilfe eines Pinsels mit einer 200 μΜ NLSOP-1 -Lösung (gelöst in Reinstwasser) einmalig bestrichen.
Applikation 2: Inkubation
Eine Tomate wurde etwa 30 Minuten in eine 200 μΜ NLSOP-1 -Lösung (gelöst in Reinstwasser) eingetaucht.
Es wurden insgesamt zwei Messreihen durchgeführt. Die visuell ermittelten
Ergebnisse einer Messreihe (Farbe der Tomaten) mit den unterschiedlichen
Applikationsarten zu unterschiedlichen Zeitpunkten wurden gemittelt und diese Ergebnisse können wie folgt zusammengefasst werden (visuelle Beschreibung der Farbe der Tomate; Skala von grün über gelb bis rot, wobei rot eine reife Tomate darstellt):
Tabelle 5: Ergebnisse der visuellen Beschreibung der Farbe der behandelten Tomaten Inkubationszeit Kontrolle
Applikation 1 Applikation 2
in Tagen nach Kein NLSOP- NLSOP-1 NLSOP-1
der Inkubation 1
0 grün grün grün
5 grün grün grün bis gelb
gelb bis
10 grün grün
hellrot
15 grün grün rot
20 hellgelb gelb rot
Diese Ergebnisse zeigen, dass durch die Applikation des Peptids NLSOP-1 bei jeder Art der Applikation die Reifung der Tomaten verzögert werden kann. Dabei ist insbesondere die äußerliche Behandlung der Tomate (Applikation 1 ) vorteilhaft.
Beispiel 5:ln vitro Interaktionsstudie von EIN2 und ETR1 - unterschiedliche Peptide
Zum Nachweis der Störung der Interaktion von EIN2 und ETR1 wurden zusätzlich zum Beispiel 1 weitere Peptide synthetisiert, welche einen Bereich umfassen, der zur Interaktion mit ETR1 geeignet ist.
Die folgende Tabelle fasst die Daten der synthetisierten Peptide zusammen: Tabelle 8: in Beispiel 5 verwendete Peptide
Figure imgf000080_0001
COOH
H2N-
YSOP-2 LKRKFRRL- 113 8 1116,8 -1,363 12,31
COOH
H2N-
YSOP-3 LKRKNRRL- 109 8 1084,4 -2,150 12,31
COOH
H2N-
YSOP-4 LKRLSRRL- 100 8 1041 ,7 -0,850 12,3
COOH
H2N-
YSOP-5 LKRKLRRL- 112 8 1083,4 -1 ,238 12,31
COOH
H2N-
YSOP-6 LKRKTRRL- 99 8 1070,7 -1 ,800 12,31
COOH
H2N-
YSOP-7 LKRRKRRL- 101 8 1126,1 -2,275 12,48
COOH
H2N-
AOP* -1 LDEYDEEL- 98 8 1025,5 -1 ,400 3,39
COOH
H2N-
NLSOP*5/NOP
»1 LKRYKRRL- 4 8 1131 ,8 -1 ,875 11 ,73
COOH
H2N-
NLSOP/NOP-2 LKVYKRRL- 111 8 1075,6 -0,787 11 ,1
COOH
H2N-
NLSHP*6/NHP- KRYKRR- 116 6 906,6 -3,767 11 ,73 1
COOH
* R-K-Inversion-Octapeptide
*2 Substitution-against-H-Octapeptide
*3 Y-Substitution-Octapeptide
*4 acidic Octapeptide
*5 nuclear localization Signal Octapeptide
*6 nuclear localization Signal Hexapeptide
Die Synthese der Peptide erfolgte durch Festphasenpeptidsynthese (Fmoc-Strategie) und wurden kommerziell von Thermo Scientific (Deutschland) erworben. .
Wie in Voet van Vormizeele J & Groth G (2003) Heterologous expression and single- step purification of the ethyiene receptor protein ETR1 from Arabidopsis thaliana. Protein Expr. Purtf. 32; 89-94 und Scharein B, Voet van Vormizeele J & Groth G (2008) Ethyiene signaiing: identifaction of a putative ETR1-AHP1 phosphorelay complex by fluorescence spectroscopy. Anal. Biochem. 377; 72-76 beschrieben, wurde rekombinantes ETR1 (in voller Länge) aus Arabidopsis thaliana isoliert, geklont, in Escherichia coli heterolog exprimiert und isoliert. Ebenso wurde rekombinantes EIN2479"1294 welches den carboxyterminalen Bereich des Proteins aufweist (amino acid 479-1294) gemäß Bissen MMA, Bleckmann A, Allekotte S & Groth G (2009) EIN2, the central regulator of ethylene signaling, is localized at the ER membrane where it interacts with ethylene receptor ETR1. Biochem. J. 424; 1-6 aus Arabidopsis thaliana isoliert, geklont, in Escherichia coli heterolog exprimiert und isoliert. Das ETR1 Protein wurden mit Alexa Fluor 488 als Donorfarbstoff und das EIN2479"1294 mit Alexa Fluor 588 als Akzeptorfarbstoff markiert (beide Farbstoffe sind kommerziell von Molecular Probes, Inc. erhältlich und dem Fachmann bekannt). Die
Proteinmarkierung wurde in einem Puffersystem gemäß den Angaben des Herstellers durchgeführt (50 mM Kaliumphosphat pH 8,0; 300 mM NaCI; 0,1 % ß-Dodecyimaltosid; 0,002 % RMSF).
Im Anschluss wurde der Grad der Markierung (DOL; degree of fabeling) photometrisch berechnet. Die markierten Proteine wurden für den folgenden FRET-Test verwendet, wenn ein Protein:Farbstoff-Verhäitnis von 1 :1 erreicht wurde. Die markierten ETR1 und EIN2479"1294 Proteine wurden zu einem funktionalen
Proteinkomplex vermischt. Die Proteinkomplexlösung wurde in eine weiße 384
Mikrotiterplatte gegeben und die Fluoreszenz wurde unter Verwendung eines Infinite M200pro Mikrotiterplattenlesers (Tecan Deutschland GmbH, Craislheim, Deutschland) bestimmt. Die Donorfluoreszenz wurde bei 455 nm angeregt und die Akzeptoremission wurde bei einer Wellenlänge zwischen 570 nm und 650 nm gemessen. Die Bildung des ETR1-EiN2-Komplexes führte zu einem Förster-Transfer zwischen dem Donorund dem Akzeptorfarbstoff. Dadurch konnte eine gesteigerte Akzeptoremission beobachtet werden.
Bei der Vermessung des Effekts der oben gezeigten Peptide der Tabelle 5 wurde der ETR1 -EIN2-Protein-Komplex zunächst mit der jeweiligen Verbindung bei einer
Endkonzentrationen von 0,1 mM für 10 min bei Raumtemperatur inkubiert. Die
Inhibierung der ETR1-EIN2:Kompiexbildung wurde durch Vermessung der Akzeptorfluoreszenz bestimmt. Je niedriger die Emission war, desto weniger
Kompiexbildung konnte beobachtet werden.
Figur 5 zeigt die Ergebnisse der Vermessung der unterschiedlichen Verbindungen bei einer Endkonzentration von 0,1 mM des jeweiligen Peptids (dargestellt ist die prozentuale Abnahme der Akzeptorfluoreszenz im Vergleich zu einer Lösung ohne Zusatz eines Peptids).
Die Ergebnisse zeigen, dass die Verbindungen der SEQ ID NO: 109 bis 1 16 die Interaktion des ETR1 mit EIN2 hemmen. Hierbei konnte insbesondere gezeigt werden, dass auch ein erfindungsgemäßes Hexapeptid (SEQ ID NO: 116) die genannte
Interaktion hemmt. Des Weiteren zeigen auch die unterschiedlichen
erfindungsgemäßen Oktapeptide, dass sie besonders geeignet sind als Wirkmolekül, die Komplexbildung zwischen ETR1 und EIN2 zu hemmen.
Beispiel 6:ln vitro Interaktionsstudie von EIN2 und ETR1 - Sequenzvarianten
Zur Untersuchung des Einflusses einer bestimmten Aminosäure des Peptids der SEQ ID NO. 4 (NLSOP-1 ) auf die Inhibierung der ETR1-EIN2-Komplexbildung wurde eine systematische Alanin Scanning Mutagenese durchgeführt und jeder der Reste des Peptids der SEQ ID NO. 4 jeweils gegen die Aminosäure Alanin ausgetauscht (siehe beispielsweise Morrison KL, Weiss GA (June 2001 j. "Combinatorial alanine-scanning". Curr Opln Chem Bio! 5 (3): 302- 7; die Methode gehört zum Wissen des Fachmanns.)
Dabei wurden die folgenden Peptide erhalten:
Tablle 7: Peptide der Alanin Scanning Mutagenese
Name Sequenz SEQ ID NO:
NLSOP-1 H2N-LKRYKRRL-COOH 4
AP1_ L H2N-AKRYKRRL-COOH 117
AP2_K H2N-LARYKRRL-COOH 118
AP3_R H2N-LKAYKRRL-COOH 1 19 AP4_Y H2N-LKRAKRRL-COOH 120
AP5_K H2N-LKRYARRL-COOH 121
AP6_R H2N-LKRYKARL-COOH 122
AP7_R H2N-LKRYKRAL-COOH 123
AP8 L H2N-LKRYKRRA-COOH 124
ROP-1 H2N-EFLYMSVN-COOH 97
Zur Analyse der Inhibierung der ETR1 -EIN2-Komplexbildung wurde das in Beispiel 5 beschriebene FRET-basierte in vitro Verfahren verwendet. Die Peptide wurden im Assay in einer Konzentration von 100 μΜ eingesetzt, da diese dem IC50-Wert für die Hemmung der ETR1 -EIN2 Interaktion durch das Ausgangspeptid NLSOP-1 (SEQ ID NO: 4) entsprach. Als Negativkontrolle diente das Peptid ROP-1 (SEQ ID NO: 97).
Die Ergebnisse sind in Abbildung 6 dargestellt. Alle Alanin-Substitutionspeptide zeigen ähnliche Wirkungen wie das Peptide der SEQ ID NO: 4. Daher ist es ersichtlich, dass der Austausch einzelner Reste gegen Alanin die Gesamtwirkung des Peptids nicht beeinflusst.
Beispiel 7: In vitro Interaktionsstudie von EIN2 und ETR1 - Aptamervarianten Es wurden zwei Aptamervarianten des Peptids der SEQ ID NO: 4 hergestellt und mit Hilfe des in Beispiel 5 beschriebenen FRET-basierten in vitro Testsystems auf ihren Effekt auf die Interaktion von ERT1 und EIN2 untersucht. (Hierbei wurde bei der Vermessung des Effekts der Aptamere der ETR1 -EIN2-Protein-Komplex zunächst mit der jeweiligen Verbindung bei einer Endkonzentrationen von 0,03 mM für 10 min bei Raumtemperatur inkubiert). Als Basis für das Aptamer wurde Thioredoxin A aus E. coli mit der Sequenz (MSDKIIHLTD DSFDTDVLKA DGAILVDFWA EWCGPCKMIA
PILDEIADEY QGKLTVAKLNIDQNPGTAPK YGIRGIPTLL LFKNGEVASA TKVGALSKGQ LKEFLDANLA; SEQ ID NO: 125) genutzt. Die Aptamerseq uenzen wurden nach dem Aminosäurerest P35 eingefügt.
Die folgenden Aptamere wurden hergestellt: Aptamer 1 (SEQ ID NO: 126)
MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPPNLASVLKRYKRRLSENGPCKM IAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVASATKVGALSK
GQLKEFLDANLA
Aptamer 2 (SEQ ID NO: 127):
MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPPSVLKRYKRRLSNGFQFENGPC KMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVASATKVGAL SKGQLKEFLDANLA
Beide Aptamervarianten wurden heterolog in E. co// exprimiert und aus dem
bakteriellen Expressionssystem gereinigt. Als Negativkontrolle diente Thioredoxin A (Trx) ohne NLS-Sequenz. Zunächst wurden die Aptamere 1 und 2 und bei der Negativkontrolle Trx in einer festen Konzentration von 30 μΜ bei den Messungen eingesetzt. Wie aus der Figur 6 ersichtlich, kommt es in Gegenwart der Aptamere zu einer verringerten Energieübertragung und somit zu einer Störung der ETR1-EIN2 Interaktion, während Trx ohne NLS-Sequenz die Interaktion von ETR1 und EIN2 nicht beeinflusst.
In Messungen, in denen die Konzentration von Trx und der beiden Aptamere variiert wurde, konnte gezeigt werden, dass die Hemmung der ETR1-EIN2 Interaktion durch die beiden Aptamere konzentrationsabhängig ist.
Beispiel 8: Hemmung der Ethylenantwort in Tomaten - weitere Peptide Der Einfluss der in Beispiel 5 und 6 beschriebenen Peptide auf die Hemmung der Ethylenantwort wurde an Hand der Reifung von Tomaten untersucht. Dazu wurden, wie in Beispiel 4 beschrieben, grüne, unreife Tomaten durch die Applikationsmethode 1 mit dem Peptid inkubiert. Es wurden insgesamt drei Messreihen durchgeführt. Die visuell ermittelten Ergebnisse einer Messreihe (Farbe der Tomaten) zu den unterschiedlichen Zeitpunkten wurden gemittelt und diese Ergebnisse können wie folgt zusammengefasst werden (visuelle Beschreibung der Farbe der Tomate; Skala von grün über gelb bis rot und dunkelrot, wobei rot eine reife Tomate darstellt): Tabelle 8: Ergebnisse der visuellen Beschreibung der Farbe der behandelten Tomaten
Figure imgf000086_0001
Diese Ergebnisse zeigen, dass durch die Applikation der erfindungsgemäßen Peptide die Reifung der Tomaten verzögert werden kann. _

Claims

Ansprüche
1. Mittel zur Beeinflussung des Reifungsprozesses, des Seneszenzprozesses und/oder der Stresstoieranz von Pflanzen und/oder ihrer Früchte umfassend mindestens eine Verbindung, welche ausgewählt wird aus der Gruppe, bestehend aus einem Peptid, einem Peptidmimetikum, einem Antikörper und/oder seiner Fragmente und einem Aptamer, dadurch gekennzeichnet, dass das Peptid oder der Antikörper und/oder dessen Fragmente eine Aminosäuresequenz umfasst, welche ausgewählt wird aus der Gruppe, bestehend aus der
Aminosäuresequenz SEQ ID NO: 1 , der Aminosäuresequenz SEQ ID NO: 2, der Aminosäuresequenz SEQ ID NO: 3, einer Permutation einer der
Aminosäuresequenzen SEQ ID NO: 1 bis SEQ ID NO: 3, einem Teil einer der
Aminosäuresequenzen SEQ ID NO: 1 bis SEQ ID NO: 3, welcher mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 6 der in SEQ ID NO: 1 bis SEQ ID NO: 3 genannten Aminosäuren umfasst, und einem Derivat einer der
Aminosäuresequenzen SEQ ID NO: 1 bis SEQ ID NO: 3, dass das Peptidmimetikum mindestens eine am Peptid rückgrat modifizierte
Aminosäuresequenz umfasst, welche ausgewählt wird aus der Gruppe, bestehend aus der Aminosäuresequenz SEQ ID NO: 1 , der Aminosäuresequenz SEQ ID NO: 2, der Aminosäuresequenz SEQ ID NO: 3, einer Permutation einer der
Aminosäuresequenzen SEQ ID NO: 1 bis SEQ ID NO: 3, einem Teil einer der
Aminosäuresequenzen SEQ ID NO: 1 bis SEQ ID NO: 3, welcher mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 6 der in SEQ ID NO: 1 bis SEQ ID NO: 3 genannten Aminosäuren umfasst, und einem Derivat einer der
Aminosäuresequenzen SEQ ID NO:1 bis SEQ ID NO: 3, oder dass das Aptamer auf Basis der Zielstruktur eines Peptids hergestellt wird, wobei das Peptid ausgewählt wird, aus der Aminosäuresequenz SEQ ID NO: 1 , der Aminosäuresequenz SEQ ID NO: 2, der Aminosäuresequenz SEQ ID NO: 3, einer Permutation einer der Aminosäuresequenzen SEQ ID NO: 1 bis SEQ ID NO: 3, einem Teil einer der
Aminosäuresequenzen SEQ ID NO: 1 bis SEQ ID NO: 3, welcher mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 6 der in SEQ ID NO: 1 bis SEQ ID NO: 3 genannten Aminosäuren umfasst, und einem Derivat einer der
Aminosäuresequenzen SEQ ID NO: 1 bis SEQ ID NO: 3, wobei Verbindungen ausgenommen sind, bei denen das Peptid oder der Antikörper und/oder dessen Fragmente eine Aminosäuresequenz der SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101 oder SEQ ID NO: 102, und/oder einen Teil einer der Aminosäuresequenzen SEQ ID NO: 98 bis SEQ ID NO: 102, welcher mindestens 6 der in SEQ ID NO: 98 bis SEQ ID NO: 102 genannten Aminosäuren umfasst und/oder ein Derivat der Aminosäuresequenzen SEQ ID NO: 98 bis 102 umfasst und/oder bei denen ein Peptidmimetikum aus einer am Peptidrückgrat modifizierten Aminosäuresequenz besteht, welche ausgewählt wird aus der Gruppe, bestehend aus SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101 und SEQ ID NO: 02, und/oder bei denen ein Aptamer auf Basis der Zielstruktur eines Peptids hergestellt wird, wobei das Peptid ausgewählt wird aus der Gruppe, bestehend aus SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100 SEQ ID NO: 101 und SEQ ID NO: 102.
2. Mittel zur Beeinflussung des Reifungsprozesses, des Seneszenzprozesses und/oder der Stresstoleranz von Pflanzen und/oder ihrer Früchte umfassend
mindestens eine Verbindung, welche ausgewählt wird aus der Gruppe, bestehend aus einem Peptid, einem Peptidmimetikum, einem Aptamer, einem Antikörper und/oder seiner Fragmente, dadurch gekennzeichnet, dass das Peptid oder der Antikörper und/oder dessen Fragmente die Aminosäuresequenz SEQ ID NO: 103, einen Teil der Aminosäuresequenz SEQ ID NO: 103, welcher mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 6 der in SEQ ID NO: 103 genannten Aminosäuren umfasst, oder ein Derivat der
Aminosäuresequenz SEQ ID NO: 103 umfasst, dass das Peptidmimetikum die am Peptidrückgrat modifizierte Aminosäuresequenz SEQ ID NO: 103, einen Teil einer am Peptidrückgrat modifizierten
Aminosäuresequenz SEQ ID NO: 103, welcher mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 6 der in SEQ ID NO: 103 genannten Aminosäuren umfasst, oder ein Derivat einer am Peptidrückgrat modifizierten Aminosäuresequenz SEQ ID NO: 103 umfasst oder dass das Aptamer auf Basis der Zielstruktur eines Peptids hergestellt wird, wobei das Peptid ausgewählt wird, aus der Aminosäuresequenz SEQ ID NO: 103, einem Teil einer der Aminosäuresequenzen SEQ ID NO: 103, welcher mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 6 der in SEQ ID NO: 103 genannten
Aminosäuren umfasst, und einem Derivat der Aminosäuresequenz SEQ ID NO: 103, wobei, wenn die Aminosäuresequenz SEQ ID NO: 103 an einer Position Alanin umfasst, keine der anderen Aminosäuren der SEQ ID NO: 103 Alanin ist.
3. Mittel nach Anspruch einem der Ansprüche 1 oder 2, dadurch gekennzeichnet, dass das Mittel die Interaktion des Proteins EIN2 (Ethylene Insensitive 2) oder eines orthologen Proteins davon mit dem Rezeptorprotein ETR1 (Ethylene resistant 1 ), seiner Isoformen ERS1 , ETR2, ERS2, EIN4 oder homologen oder orthologen
Proteinen davon durch die Interaktion mit einer Kontaktdomäne des Ethylenrezeptors ETR1 oder seiner Isoformen ERS1 , ETR2, ERS2, EIN4 oder eines homologen oder orthologen Proteins davon hemmt.
4. Mittel nach einem der Ansprüche 1 bis 3, dadurch gekennzeichnet, dass das Mittel mindestens eine weitere Verbindung umfasst, welche dazu geeignet ist, den Reifungsprozess, den Seneszenzprozess und/oder der Stresstoleranz von Pflanzen und/oder ihrer Früchte zu beeinflussen.
5. Mittel nach Anspruch 4, dadurch gekennzeichnet, dass die mindestens eine weitere Verbindung ein Ethylenantagonist ist.
6. Verbindung, welche ausgewählt wird aus der Gruppe, bestehend aus einem Peptid, einem Peptidmimetikum und einem Aptamer, dadurch gekennzeichnet, dass das Peptid aus einer Aminosäuresequenz besteht, welche ausgewählt wird aus der Gruppe, bestehend aus der Aminosäuresequenz SEQ ID NO: 1 , der
Aminosäuresequenz SEQ ID NO: 2, der Aminosäuresequenz SEQ ID NO: 3, einer Permutation einer der Aminosäuresequenzen SEQ ID NO: 1 bis SEQ ID NO: 3, einem Teil einer der Aminosäuresequenzen SEQ ID NO: 1 bis SEQ ID NO: 3, welcher mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 6 der in SEQ ID NO: 1 bis SEQ ID NO: 3 genannten Aminosäuren umfasst, und einem Derivat einer der Aminosäuresequenzen SEQ ID NO: 1 bis SEQ ID NO: 3, dass das
Peptidmimetikum aus einer am Peptidrückgrat modifizierten Aminosäuresequenz besteht, welche ausgewählt wird aus der Gruppe, bestehend aus der
Aminosäuresequenz SEQ ID NO: 1 , der Aminosäuresequenz SEQ ID NO: 2, der Aminosäuresequenz SEQ ID NO: 3, einer Permutation einer der
Aminosäuresequenzen SEQ ID NO: 1 bis SEQ ID NO: 3, einem Teil einer der
Aminosäuresequenzen SEQ ID NO: 1 bis SEQ ID NO: 3, welcher mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 6 der in SEQ ID NO: 1 bis SEQ ID NO: 3 genannten Aminosäuren umfasst, und einem Derivat einer der
Aminosäuresequenzen SEQ ID NO:1 bis SEQ ID NO: 3 oder dass das Aptamer auf Basis der Zielstruktur eines Peptids hergesteilt wird, wobei das Peptid ausgewählt wird, aus der Aminosäuresequenz SEQ ID NO: 1 , der Aminosäuresequenz
SEQ ID NO: 2, der Aminosäuresequenz SEQ ID NO: 3, einer Permutation einer der Aminosäuresequenzen SEQ ID NO: 1 bis SEQ ID NO: 3, einem Teil einer der
Aminosäuresequenzen SEQ ID NO: 1 bis SEQ ID NO: 3, welcher mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 6 der in SEQ ID NO: 1 bis SEQ ID NO: 3 genannten Aminosäuren umfasst, und einem Derivat einer der
Aminosäuresequenzen SEQ ID NO: 1 bis SEQ ID NO: 3, wobei Verbindungen ausgenommen sind, bei denen das Peptid aus einer
Aminosäuresequenz der SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101 oder SEQ ID NO: 102, und/oder aus einem Teil einer der
Aminosäuresequenzen SEQ ID NO: 98 bis SEQ ID NO: 102, welcher mindestens 6 der in SEQ ID NO: 98 bis SEQ ID NO: 102 genannten Aminosäuren umfasst und/oder aus einem Derivat der Aminosäuresequenzen SEQ ID NO: 98 bis 102 besteht und/oder bei denen ein Peptidmimetikum aus einer am Peptidrückgrat modifizierten Aminosäuresequenz besteht, welche ausgewählt wird aus der Gruppe, bestehend aus SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101 und SEQ ID NO: 02, und/oder bei denen ein Aptamer auf Basis der Zielstruktur eines Peptids hergestellt wird, wobei das Peptid ausgewählt wird aus der Gruppe, bestehend aus SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100 SEQ ID NO: 101 und SEQ ID NO: 102.
7. Verbindung, welche ausgewählt wird aus der Gruppe, bestehend aus einem Peptid, einem Peptidmimetikum einem Antikörper und/oder seiner Fragmente und einem Aptamer, dadurch gekennzeichnet, dass das Peptid und/oder der Antikörper und/oder seine Fragmente die Aminosäuresequenz SEQ ID NO: 103, oder einen Teil der Aminosäuresequenz SEQ ID NO: 103, welcher mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 6 der in SEQ ID NO: 103 genannten Aminosäuren umfasst, oder ein Derivat der Aminosäuresequenz SEQ ID NO: 103 umfasst oder dass das Peptidmimetikum die am Peptidrückgrat modifizierten
Aminosäuresequenz SEQ ID NO: 103 oder einen Teil der am Peptidrückgrat modifizierten Aminosäuresequenz SEQ ID NO: 103, welcher mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 6 der in SEQ ID NO: 103 genannten Aminosäuren umfasst, oder ein Derivat der am Peptidrückgrat modifizierten
Aminosäuresequenz SEQ ID NO:103 umfasst oder dass das Aptamer auf Basis der Zielstruktur eines Peptids hergestellt wird, wobei das Peptid ausgewählt wird, aus der Aminosäuresequenz SEQ ID NO: 103, einem Teil der Aminosauresequenz SEQ ID NO: 103, welcher mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 6 der in SEQ ID NO: 03 genannten Aminosäuren umfasst, und einem Derivat der Aminosäuresequenz SEQ ID NO: 103, wobei, wenn die
Aminosäuresequenz SEQ ID NO: 103 an einer Position Alanin umfasst, keine der anderen Aminosäuren der SEQ ID NO: 103 Alanin ist.
8. Verbindung nach Anspruch 7, dadurch gekennzeichnet, dass das Peptid, der Antikörper und/oder seine Fragmente mindestens eine
Aminosäuresequenz, welche ausgewählt wird aus der Gruppe, bestehend aus SEQ ID NO: 4, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 111 , SEQ ID NO: 112, SEQ ID NO: 113, SEQ ID NO: 114, SEQ ID NO: 115, SEQ ID NO: 116, SEQ ID NO: 117, SEQ ID NO: 118, SEQ ID NO: 119, SEQ ID NO: 120, SEQ ID NO: 121 , SEQ ID NO: 122, SEQ ID NO: 123 und SEQ ID NO: 124, einer Permutation einer der
Aminosäuresequenzen SEQ ID NO: 4, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 111 , SEQ ID NO: 112, SEQ ID NO: 113, SEQ ID NO: 114, SEQ ID NO: 115, SEQ ID NO: 116, SEQ ID NO: 117, SEQ ID NO: 118, SEQ ID NO: 119, SEQ ID NO: 120, SEQ ID NO: 121 , SEQ ID NO: 122, SEQ ID NO: 123 und SEQ ID NO: 124, einem Teil einer der Aminosäuresequenzen SEQ ID NO: 4, SEQ ID NO: 109, SEQ ID NO: 1 10, SEQ ID NO: 1 11 , SEQ ID NO: 112, SEQ ID NO: 113, SEQ ID NO: 114, SEQ ID NO: 1 15, SEQ ID NO: 116, SEQ ID NO: 1 17, SEQ ID NO: 118, SEQ ID NO: 119, SEQ ID NO: 120, SEQ ID NO: 121 , SEQ ID NO: 122, SEQ ID NO: 123 und SEQ ID NO: 124, welcher mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 6 der in SEQ ID NO: 4, SEQ ID NO: 109 bis SEQ ID NO: 124 genannten Aminosäuren umfasst, und einem Derivat einer der Aminosäuresequenzen SEQ ID NO: 4, SEQ ID NO: 109, SEQ ID NO: 1 10, SEQ ID NO: 11 1 , SEQ ID NO: 112, SEQ ID NO: 113, SEQ ID NO: 114, SEQ ID NO: 1 15, SEQ ID NO: 116, SEQ ID NO: 117, SEQ ID NO: 1 18, SEQ ID NO: 1 19, SEQ ID NO: 120, SEQ ID NO: 121 , SEQ ID NO: 122, SEQ ID NO: 123 und SEQ ID NO: 124, oder das Peptidmimetikum ein Peptoid oder D-Peptid darstellt, welche eine ähnliche biologische Aktivität wie eine Aminosäuresequenz aufweisen, welche ausgewählt wird aus der Gruppe, bestehend aus SEQ ID NO: 4, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 11 1 , SEQ ID NO: 112, SEQ ID NO: 113, SEQ ID NO: 114, SEQ ID NO: 115, SEQ ID NO: 116, SEQ ID NO: 1 17, SEQ ID NO: 118, SEQ ID NO: 1 19, SEQ ID NO: 120, SEQ ID NO: 121 , SEQ ID NO: 122, SEQ ID NO: 123 und SEQ ID NO: 124, einer Permutation einer der Aminosäuresequenzen SEQ ID NO: 4, SEQ ID NO: 109, SEQ ID NO: 1 10, SEQ ID NO: 11 1 , SEQ ID NO: 112, SEQ ID NO: 113, SEQ ID NO: 114, SEQ ID NO: 1 15, SEQ ID NO: 116, SEQ ID NO: 1 17, SEQ ID NO: 118, SEQ ID NO: 1 19, SEQ ID NO: 120, SEQ ID NO: 121 , SEQ ID NO: 122, SEQ ID NO: 123 und SEQ ID NO: 124, einem Teil einer der Aminosäuresequenzen SEQ ID NO: 4, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 111 , SEQ ID NO: 1 12, SEQ ID NO: 1 13, SEQ ID NO: 114, SEQ ID NO: 115, SEQ ID NO: 116, SEQ ID NO: 1 17, SEQ ID NO: 1 18, SEQ ID NO: 1 19, SEQ ID NO: 120, SEQ ID NO: 121 , SEQ ID NO: 122, SEQ ID NO: 123 und SEQ ID NO: 24, welcher mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 6 der in SEQ ID NO: 4, SEQ ID NO: 109 bis SEQ ID NO: 124 genannten Aminosäuren umfasst, und einem Derivat einer der Aminosäuresequenzen SEQ ID NO: 4, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 1 11 , SEQ ID NO: 112, SEQ ID NO: 1 13, SEQ ID NO: 114, SEQ ID NO: 1 15, SEQ ID NO: 1 16, SEQ ID NO: 117, SEQ ID NO: 1 18, SEQ ID NO: 1 19, SEQ ID NO: 120, SEQ ID NO: 121 , SEQ ID NO: 122, SEQ ID NO: 123 und SEQ ID NO: 124, oder das Aptamer auf Basis der Zielstruktur eines Peptids hergestellt, wobei das Peptid ausgewählt wird, aus der Gruppe, bestehend aus SEQ ID NO: 4, SEQ ID NO: 109, SEQ ID NO: 1 10, SEQ ID NO: 11 1 , SEQ ID NO: 1 12, SEQ ID NO: 113, SEQ ID NO: 114, SEQ ID NO: 115, SEQ ID NO: 116, SEQ ID NO: 117, SEQ ID NO: 118, SEQ ID NO: 119, SEQ ID NO: 120, SEQ ID NO: 121 , SEQ ID NO: 122, SEQ ID NO: 123 und SEQ ID NO: 124, einer Permutation einer der Amiriosäuresequenzen SEQ ID NO: 4, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 1 11 , SEQ ID NO: 112, SEQ ID NO: 113, SEQ ID NO: 1 14, SEQ ID NO: 115, SEQ ID NO: 116, SEQ ID NO: 117, SEQ ID NO: 1 18, SEQ ID NO: 119, SEQ ID NO: 120, SEQ ID NO: 121 , SEQ ID NO: 122, SEQ ID NO: 123 und SEQ ID NO: 124, einem Teil einer der Amiriosäuresequenzen SEQ ID NO: 4, SEQ ID NO: 109, SEQ ID NO: 1 10, SEQ ID NO: 1 11 , SEQ ID NO: 1 12, SEQ ID NO: 113, SEQ ID NO: 1 14, SEQ ID NO: 1 15, SEQ ID NO: 116, SEQ ID NO: 117, SEQ ID NO: 1 18, SEQ ID NO: 119, SEQ ID NO: 120, SEQ ID NO: 121 , -SEQ ID NO: 122, SEQ ID NO: 123 und SEQ ID NO: 124, welcher mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 6 der in SEQ ID NO: 4, SEQ ID NO: 109 bis SEQ ID NO: 124 genannten Aminosäuren umfasst, und einem Derivat einer der
Aminosäuresequenzen SEQ ID NO: 4, SEQ ID NO: 109, SEQ ID NO: 1 10, SEQ ID NO: 111 , SEQ ID NO: 1 12, SEQ ID NO: 1 13, SEQ ID NO: 1 14, SEQ ID NO: 1 15, SEQ ID NO: 1 16, SEQ ID NO: 117, SEQ ID NO: 118, SEQ ID NO: 1 19, SEQ ID NO: 120, SEQ ID NO: 121 , SEQ ID NO: 122, SEQ ID NO: 123 und SEQ ID NO: 124.
9. Verfahren zur Beeinflussung des Reifungsprozesses, des
Seneszenzprozesses und/oder der Stresstoleranz von Pflanzen und/oder ihrer Früchte, dadurch gekennzeichnet, dass in den Pflanzen und/oder Früchten die
Interaktion des Proteins EIN2 (Ethylene Insensitive 2) oder eines orthologen Proteins davon mit dem Rezeptorprotein ETR1 (Ethylene resistant 1 ), seiner Isoformen ERS1 , ETR2, ERS2, EIN4 oder homologen oder orthologen Proteinen davon durch die
Interaktion einer Verbindung, welche ausgewählt wird aus der Gruppe, bestehend aus einem Peptid, einem Peptidmimetikum, einem Aptamer, einem Antikörper und/oder seiner Fragmente und Mischungen dieser Verbindungen mit einer Kontaktdomäne des Ethylenrezeptors ETR1 oder seiner Isoformen ERS1 , ETR2, ERS2, EIN4 oder eines homologen oder orthologen Proteins davon gehemmt wird, wobei die Kontaktdomäne diejenige ist, welche mit EIN2 oder einem orthologen
Protein davon interagiert, und wobei das Peptid, der Antikörper und/oder seine Fragmente mindestens eine
Aminosäuresequenz umfasst, welche ausgewählt wird aus der Gruppe, bestehend aus der Aminosäuresequenz SEQ ID NO: 1 , der Aminosäuresequenz SEQ ID NO: 2, der Aminosäuresequenz SEQ ID NO: 3, einer Permutation einer der
Aminosäuresequenzen SEQ ID NO: 1 bis SEQ ID NO: 3, einem Teil einer der
Aminosäuresequenzen SEQ ID NO: 1 bis SEQ ID NO: 3, welcher mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 6 der in SEQ ID NO: 1 bis SEQ ID NO: 3 genannten Aminosäuren umfasst, und einem Derivat einer der
Aminosäuresequenzen SEQ ID NO: 1 bis SEQ ID NO: 3, das Peptidmimetikum mindestens eine am Peptidrückgrat modifizierte
Aminosäuresequenz umfasst, welche ausgewählt wird aus der Gruppe, bestehend aus der Aminosäuresequenz SEQ ID NO: 1 , der Aminosäuresequenz SEQ ID NO: 2, der Aminosäuresequenz SEQ ID NO: 3, einer Permutation einer der
Aminosäuresequenzen SEQ ID NO: 1 bis SEQ ID NO: 3, einem Teil einer der
Aminosäuresequenzen SEQ ID NO: 1 bis SEQ ID NO: 3, welcher mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 6 der in SEQ ID NO: 1 bis SEQ ID NO: 3 genannten Aminosäuren umfasst, und einem Derivat einer der
Aminosäuresequenzen SEQ ID NO:1 bis SEQ ID NO: 3, oder das Aptamer auf Basis der Zielstruktur eines Peptids hergestellt wird, wobei das Peptid ausgewählt wird, aus der Aminosäuresequenz SEQ ID NO: 1 , der Aminosäuresequenz SEQ ID NO: 2, der Aminosäuresequenz SEQ ID NO: 3, einer Permutation einer der Aminosäuresequenzen SEQ ID NO: 1 bis SEQ ID NO: 3, einem Teil einer der
Aminosäuresequenzen SEQ ID NO: 1 bis SEQ ID NO: 3, welcher mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 6 der in SEQ ID NO: 1 bis SEQ ID NO: 3 genannten Aminosäuren umfasst, und einem Derivat einer der
Aminosäuresequenzen SEQ ID NO: 1 bis SEQ ID NO: 3, wobei Verbindungen ausgenommen sind, bei denen das Peptid oder der Antikörper und/oder dessen Fragmente eine Aminosäuresequenz der SEQ ID NO: 98, SEQ ID
NO: 99, SEQ ID NO: 100, SEQ ID NO: 101 oder SEQ iD NO: 102, und/oder einen Teil einer der Aminosäuresequenzen SEQ iD NO: 98 bis SEQ ID NO: 102, welcher mindestens 8 der in SEQ ID NO: 98 bis SEQ ID NO: 102 genannten Aminosäuren umfasst und/oder ein Derivat der Amiriosäuresequenzen SEQ ID NO: 98 bis 102 umfasst und/oder bei denen ein Peptidmimetikum aus einer am Peptidrückgrat modifizierten Aminosäuresequenz besteht, welche ausgewählt wird aus der Gruppe, bestehend aus SEQ ID NO: 98, SEQ iD NO: 99, SEQ ID NO: 100, SEQ ID NO: 101 und SEQ iD NO: 102, und/oder bei denen ein Aptamer auf Basis der Zielstruktur eines Peptids hergestellt wird, wobei das Peptid ausgewählt wird aus der Gruppe, bestehend aus SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100 SEQ ID NO: 101 und SEQ ID NO: 102.
10. Verfahrens zur Beeinflussung des Reifungsprozesses, des
Seneszenzprozesses und/oder der Stresstoleranz von Pflanzen und/oder ihrer
Früchte, dadurch gekennzeichnet, dass in den Pflanzen und/oder Früchten die
Interaktion des Proteins EIN2 (Ethylene Insensitive 2) oder eines orthoiogen Proteins davon mit dem Rezeptorprotein ETR1 (Ethylene resistant 1 ), seiner Isoformen ERS1 , ETR2, ERS2, EIN4 oder homologen oder orthoiogen Proteinen davon durch die Interaktion einer Verbindung, welche ausgewählt wird aus der Gruppe, bestehend aus einem Peptid, einem Peptidmimetikum, einem Aptamer, einem Antikörper und/oder seiner Fragmente, kleinen Molekülen und Mischungen dieser Verbindungen mit einer Kontaktdomäne des Ethylenrezeptors ETR1 oder seiner Isoformen ERS1 , ETR2, ERS2, EIN4 oder eines homologen oder orthoiogen Proteins davon gehemmt wird, wobei die Kontaktdomäne diejenige ist, welche mit EIN2 oder einem orthoiogen Protein davon interagiert und wobei das Peptid, der Antikörper und/oder seine Fragmente mindestens eine
Aminosäuresequenz SEQ ID NO: 103, einen Teil der Aminosäuresequenz SEQ ID NO: 103, welcher mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 6 der in SEQ ID NO: 03 genannten Aminosäuren umfasst, oder ein Derivat der Aminosäuresequenz SEQ ID NO: 103 umfasst, das Peptidmimetikum mindestens eine am Peptid rückgrat modifizierte
Aminosäuresequenz SEQ ID NO: 103, einen Teil der am Peptidrückgrat modifizierten Aminosäuresequenz SEQ ID NO: 103, welcher mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 6 der in SEQ ID NO: 103 genannten Aminosäuren umfasst, oder ein Derivat der am Peptidrückgrat modifizierten Aminosäuresequenz SEQ ID NO: 103 umfasst oder das Aptamer auf Basis der Zieistruktur eines Peptids hergestellt wird, wobei das Peptid ausgewählt wird, aus der Aminosäuresequenz SEQ ID NO: 103, einem Teil der
Aminosäuresequenz SEQ ID NO: 103, welcher mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 6 der in SEQ ID NO: 103 genannten Aminosäuren umfasst, und einem Derivat der Aminosäuresequenz SEQ ID NO: 103, wobei, wenn die Aminosäuresequenz SEQ ID NO: 103 an einer Position Alanin umfasst, keine der anderen Aminosäuren der SEQ ID NO: 103 Alanin ist.
11. Verfahren nach einem der Ansprüche 9 oder 10, dadurch gekennzeichnet, dass die Verbindung, welche ausgewählt wird aus der Gruppe, bestehend aus einem Peptid, einem Peptidmimetikum, einem Aptamer, einem Antikörper und/oder seiner Fragmente und Mischungen dieser Verbindungen, eine Wasserlöslichkeit von bei pH = 7 und 20 °C von mindestens 1 g/L aufweist.
12. Verfahren nach Anspruch 9, dadurch gekennzeichnet, dass das Peptid aus einer Aminosäuresequenz besteht, welche ausgewählt wird aus der Gruppe,
bestehend aus der Aminosäuresequenz SEQ ID NO: 3, einer Permutation der
Aminosäuresequenz SEQ ID NO: 3, einem Teil der Aminosäuresequenz SEQ ID NO: 3, welcher mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 6 der in SEQ ID NO: 3 genannten Aminosäuren umfasst, und einem Derivat der
Aminosäuresequenzen SEQ ID NO: 3 oder dass das Peptidmimetikum aus einer am Peptidrückgrat modifizierten Aminosäuresequenz besteht, welche ausgewählt wird aus der Gruppe, bestehend aus der Aminosäuresequenz SEQ ID NO: 3, einer Permutation der Aminosäuresequenz SEQ ID NO: 3, einem Teil der Aminosäuresequenz
SEQ ID NO: 3, welcher mindestens 4, bevorzugt mindestens 5, besonders bevorzugt mindestens 6 der in SEQ ID NO: 3 genannten Aminosäuren umfasst, und einem Derivat der Aminosäuresequenzen SEQ ID NO: 3.
13. Verfahren nach einem der Ansprüche 10 bis 12, dadurch gekennzeichnet, dass das orthologe Protein des EIN2 eine Aminosäuresequenz, welche ausgewählt wird aus der Gruppe, bestehend aus SEQ ID NO: 31 , SEQ ID NO: 32, SEQ ID NO: 33,
SEQ ID NO: 34, SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 38, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 41 , SEQ ID NO: 42, SEQ ID NO: 43, SEQ ID NO: 44, SEQ ID NO: 45, SEQ ID NO: 46, SEQ ID NO: 47, SEQ ID NO: 48, SEQ ID NO: 49, SEQ ID NO: 50, SEQ ID NO: 51 , SEQ ID NO: 52 und SEQ ID NO: 53 umfasst.
14. Verfahren nach einem der Ansprüche 10 bis 13, dadurch gekennzeichnet, dass das orthologe Protein des ETR1 oder seine Isoformen eine Aminosäuresequenz, welche ausgewählt wird aus der Gruppe, bestehend aus SEQ ID NO: 54,
SEQ ID NO: 55, SEQ ID NO: 56, SEQ ID NO: 57, SEQ ID NO: 58, SEQ ID NO: 59, SEQ ID NO: 60, SEQ ID NO: 61 , SEQ ID NO: 62, SEQ ID NO: 63, SEQ ID NO: 64, SEQ ID NO: 65, SEQ ID NO: 66, SEQ ID NO: 67, SEQ ID NO: 68, SEQ ID NO: 69, SEQ ID NO: 70, SEQ ID NO: 71 , SEQ ID NO: 72, SEQ ID NO: 73, SEQ ID NO: 74, SEQ ID NO: 75, SEQ ID NO: 76, SEQ ID NO: 77, SEQ ID NO: 78, SEQ ID NO: 79, SEQ ID NO: 80, SEQ ID NO: 81 , SEQ ID NO: 82, SEQ ID NO: 83, SEQ ID NO: 84, SEQ ID NO: 85, SEQ ID NO: 86, SEQ ID NO: 87, SEQ ID NO: 88, SEQ ID NO: 89, SEQ ID NO: 90, SEQ ID NO: 91 , SEQ ID NO: 92, SEQ ID NO: 93, SEQ ID NO: 94, SEQ ID NO: 95 und SEQ ID NO: 96 umfasst oder dass das homologe Protein des ETR1 eine Aminosäuresequenz, welche ausgewählt wird aus der Gruppe, bestehend aus SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11 , SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21 , SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 27, SEQ ID NO: 28 SEQ ID NO: 29 und SEQ ID NO: 30 umfasst.
15. Verfahren nach einem der Ansprüche 10 bis 14, dadurch gekennzeichnet, dass die Pflanzen ausgewählt werden aus der Gruppe, bestehend aus Nutzpflanzen und Zierpflanzen und deren Früchte ausgewählt werden aus der Gruppe, bestehend aus den Früchten von Nutzpflanzen und Zierpflanzen.
PCT/EP2013/074428 2012-11-23 2013-11-22 Selektive inhibition der ethylensignaltransduktion Ceased WO2014079957A1 (de)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
EP12194024 2012-11-23
EP12194024.1 2012-11-23

Publications (1)

Publication Number Publication Date
WO2014079957A1 true WO2014079957A1 (de) 2014-05-30

Family

ID=47216145

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2013/074428 Ceased WO2014079957A1 (de) 2012-11-23 2013-11-22 Selektive inhibition der ethylensignaltransduktion

Country Status (1)

Country Link
WO (1) WO2014079957A1 (de)

Citations (152)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4761373A (en) 1984-03-06 1988-08-02 Molecular Genetics, Inc. Herbicide resistance in plants
US5013659A (en) 1987-07-27 1991-05-07 E. I. Du Pont De Nemours And Company Nucleic acid fragment encoding herbicide resistant plant acetolactate synthase
US5084082A (en) 1988-09-22 1992-01-28 E. I. Du Pont De Nemours And Company Soybean plants with dominant selectable trait for herbicide resistance
US5198599A (en) 1990-06-05 1993-03-30 Idaho Resarch Foundation, Inc. Sulfonylurea herbicide resistance in plants
EP0571427A1 (de) 1991-02-13 1993-12-01 Hoechst Schering AgrEvo GmbH Plasmide, die die DNA-Sequenzen für die Veränderung des Kohlenhijdrats bzw. Komposition in Pflanzen enthalten, sowie eine Pflanze...
US5273894A (en) 1986-08-23 1993-12-28 Hoechst Aktiengesellschaft Phosphinothricin-resistance gene, and its use
US5276268A (en) 1986-08-23 1994-01-04 Hoechst Aktiengesellschaft Phosphinothricin-resistance gene, and its use
WO1994004693A2 (en) 1992-08-26 1994-03-03 Zeneca Limited Novel plants and processes for obtaining them
US5304732A (en) 1984-03-06 1994-04-19 Mgi Pharma, Inc. Herbicide resistance in plants
WO1994009144A1 (en) 1992-10-14 1994-04-28 Zeneca Limited Novel plants and processes for obtaining them
WO1994011520A2 (en) 1992-11-09 1994-05-26 Zeneca Limited Novel plants and processes for obtaining them
US5331107A (en) 1984-03-06 1994-07-19 Mgi Pharma, Inc. Herbicide resistance in plants
WO1994021795A1 (en) 1993-03-25 1994-09-29 Ciba-Geigy Ag Novel pesticidal proteins and strains
US5378824A (en) 1986-08-26 1995-01-03 E. I. Du Pont De Nemours And Company Nucleic acid fragment encoding herbicide resistant plant acetolactate synthase
WO1995004826A1 (en) 1993-08-09 1995-02-16 Institut Für Genbiologische Forschung Berlin Gmbh Debranching enzymes and dna sequences coding them, suitable for changing the degree of branching of amylopectin starch in plants
US5434283A (en) 1990-04-04 1995-07-18 Pioneer Hi-Bred International, Inc. Edible endogenous vegetable oil extracted from rapeseeds of reduced stearic and palmitic saturated fatty acid content
EP0663956A1 (de) 1992-08-12 1995-07-26 Hoechst Schering AgrEvo GmbH Dna sequenzen, die zur bildung von polyfructanen (levanen) führen, plasmide mit entsprechenden sequenzen, sowie ein verfahren zur herstellung transgener pflanzen
WO1995026407A1 (en) 1994-03-25 1995-10-05 National Starch And Chemical Investment Holding Corporation Method for producing altered starch from potato plants
US5463175A (en) 1990-06-25 1995-10-31 Monsanto Company Glyphosate tolerant plants
WO1995031553A1 (en) 1994-05-18 1995-11-23 Institut Für Genbiologische Forschung Berlin Gmbh DNA SEQUENCES CODING FOR ENZYMES CAPABLE OF FACILITATING THE SYNTHESIS OF LINEAR α-1,4 GLUCANS IN PLANTS, FUNGI AND MICROORGANISMS
WO1995035026A1 (en) 1994-06-21 1995-12-28 Zeneca Limited Novel plants and processes for obtaining them
WO1996001904A1 (en) 1994-07-08 1996-01-25 Stichting Scheikundig Onderzoek In Nederland Production of oligosaccharides in transgenic plants
WO1996015248A1 (de) 1994-11-10 1996-05-23 Hoechst Schering Agrevo Gmbh Dna-moleküle codierend enzyme, die an der stärkesynthese beteiligt sind, vektoren, bakterien, transgene pflanzenzellen und pflanzen enthaltend diese moleküle
WO1996019581A1 (en) 1994-12-22 1996-06-27 Hoechst Schering Agrevo Gmbh Dna molecules coding for debranching enzymes derived from plants
EP0719338A1 (de) 1993-09-09 1996-07-03 Hoechst Schering AgrEvo GmbH Dna-sequenzen kombination, die die bildung von modifizierter stärke in pflanzenzellen und pflanzen ermögliht
WO1996021023A1 (en) 1995-01-06 1996-07-11 Centrum Voor Plantenveredelings- En Reproduktieonderzoek (Cpro - Dlo) Dna sequences encoding carbohydrate polymer synthesizing enzymes and method for producing transgenic plants
EP0728213A1 (de) 1993-11-09 1996-08-28 E.I. Du Pont De Nemours And Company Transgene fruktan - anreichernde nutzpflanzen und verfahren zu ihrer herstellung
WO1996027674A1 (de) 1995-03-08 1996-09-12 Hoechst Schering Agrevo Gmbh Modifizierte stärke aus pflanzen, pflanzen, die diese synthetisieren, sowie verfahren zu ihrer herstellung
US5561236A (en) 1986-03-11 1996-10-01 Plant Genetic Systems Genetically engineered plant cells and plants exhibiting resistance to glutamine synthetase inhibitors, DNA fragments and recombinants for use in the production of said cells and plants
WO1996033270A1 (en) 1995-04-20 1996-10-24 American Cyanamid Company Structure-based designed herbicide resistant products
WO1996034968A2 (en) 1995-05-05 1996-11-07 National Starch And Chemical Investment Holding Corporation Improvements in or relating to plant starch composition
WO1996038567A2 (fr) 1995-06-02 1996-12-05 Rhone-Poulenc Agrochimie Sequence adn d'un gene de l'hydroxy-phenyl pyruvate dioxygenase et obtention de plantes contenant un gene de l'hydroxy-phenyl pyruvate dioxygenase, tolerantes a certains herbicides
US5605011A (en) 1986-08-26 1997-02-25 E. I. Du Pont De Nemours And Company Nucleic acid fragment encoding herbicide resistant plant acetolactate synthase
WO1997011188A1 (de) 1995-09-19 1997-03-27 Planttec Biotechnologie Gmbh Pflanzen, die eine modifizierte stärke synthetisieren, verfahren zu ihrer herstellung sowie modifizierte stärke
US5637489A (en) 1986-08-23 1997-06-10 Hoechst Aktiengesellschaft Phosphinothricin-resistance gene, and its use
WO1997020936A1 (en) 1995-12-06 1997-06-12 Zeneca Limited Modification of starch synthesis in plants
WO1997026362A1 (de) 1996-01-16 1997-07-24 Planttec Biotechnologie Gmbh Nucleinsäuremoleküle aus pflanzen codierend enzyme, die an der stärkesynthese beteiligt sind
WO1997032985A1 (de) 1996-03-07 1997-09-12 Planttec Biotechnologie Gmbh Forschung & Entwicklung Nucleinsäuremoleküle, codierend debranching-enzyme aus mais
WO1997041218A1 (en) 1996-04-29 1997-11-06 Board Of Supervisors Of Louisiana State University And Agricultural And Mechanical College Herbicide resistant rice
WO1997042328A1 (de) 1996-05-06 1997-11-13 Planttec Biotechnologie Gmbh Nucleinsäuremoleküle, die debranching-enzyme aus kartoffel codieren
WO1997044472A1 (de) 1996-05-17 1997-11-27 Planttec Biotechnologie Gmbh Nucleinsäuremoleküle codierend lösliche stärkesynthasen aus mais
WO1997045545A1 (en) 1996-05-29 1997-12-04 Hoechst Schering Agrevo Gmbh Nucleic acid molecules encoding enzymes from wheat which are involved in starch synthesis
WO1997047808A1 (en) 1996-06-12 1997-12-18 Pioneer Hi-Bred International, Inc. Substitutes for modified starch in paper manufacture
WO1997047807A1 (en) 1996-06-12 1997-12-18 Pioneer Hi-Bred International, Inc. Substitutes for modified starch in paper manufacture
WO1997047806A1 (en) 1996-06-12 1997-12-18 Pioneer Hi-Bred International, Inc. Substitutes for modified starch in paper manufacture
WO1998000549A1 (en) 1996-06-27 1998-01-08 The Australian National University MANIPULATION OF CELLULOSE AND/OR β-1,4-GLUCAN
US5712107A (en) 1995-06-07 1998-01-27 Pioneer Hi-Bred International, Inc. Substitutes for modified starch and latexes in paper manufacture
US5731180A (en) 1991-07-31 1998-03-24 American Cyanamid Company Imidazolinone resistant AHAS mutants
US5739082A (en) 1990-02-02 1998-04-14 Hoechst Schering Agrevo Gmbh Method of improving the yield of herbicide-resistant crop plants
EP0837944A2 (de) 1995-07-19 1998-04-29 Rhone-Poulenc Agrochimie Mutierte 5-enolpyruvylshikimat-3-phosphat synthase, für dieses protein kodierendes gen und dieses gen enthaltende transformierte pflanzen
WO1998020145A2 (en) 1996-11-05 1998-05-14 National Starch And Chemical Investment Holding Corporation Improvements in or relating to starch content of plants
WO1998022604A1 (en) 1996-11-20 1998-05-28 Pioneer Hi-Bred International, Inc. Methods of producing high-oil seed by modification of starch levels
WO1998027212A1 (en) 1996-12-19 1998-06-25 Planttec Biotechnologie Gmbh Novel nucleic acid molecules from maize and their use for the production of modified starch
US5773702A (en) 1996-07-17 1998-06-30 Board Of Trustees Operating Michigan State University Imidazolinone herbicide resistant sugar beet plants
WO1998032326A2 (en) 1997-01-24 1998-07-30 Pioneer Hi-Bred International, Inc. Methods for $i(agrobacterium)-mediated transformation
WO1998039460A1 (en) 1997-03-04 1998-09-11 MAX-PLANCK-Gesellschaft zur Förderung der Wissenschaften e.V. Nucleic acid molecules from artichoke ($i(cynara scolymus)) encoding enzymes having fructosyl polymerase activity
WO1998040503A1 (en) 1997-03-10 1998-09-17 Planttec Biotechnologie Gmbh Nucleic acid molecules encoding starch phosphorylase from maize
US5824790A (en) 1994-06-21 1998-10-20 Zeneca Limited Modification of starch synthesis in plants
US5840946A (en) 1987-12-31 1998-11-24 Pioneer Hi-Bred International, Inc. Vegetable oil extracted from rapeseeds having a genetically controlled unusually high oleic acid content
WO1999012950A2 (en) 1997-09-06 1999-03-18 National Starch And Chemical Investment Holding Corporation Improvements in or relating to stability of plant starches
WO1999024593A1 (en) 1997-11-06 1999-05-20 MAX-PLANCK-Gesellschaft zur Förderung der Wissenschaften e.V. Nucleic acid molecules which encode proteins having fructosyl transferase activity and methods for producing long-chain inulin
WO1999024586A1 (fr) 1997-11-07 1999-05-20 Aventis Cropscience S.A. Hydroxy-phenyl pyruvate dioxygenase chimere, sequence d'adn et obtention de plantes contenant un tel gene, tolerantes aux herbicides
US5908810A (en) 1990-02-02 1999-06-01 Hoechst Schering Agrevo Gmbh Method of improving the growth of crop plants which are resistant to glutamine synthetase inhibitors
WO1999034008A1 (fr) 1997-12-24 1999-07-08 Aventis Cropscience S.A. Procede de preparation enzymatique d'homogentisate
US5928937A (en) 1995-04-20 1999-07-27 American Cyanamid Company Structure-based designed herbicide resistant products
US5965755A (en) 1993-10-12 1999-10-12 Agrigenetics, Inc. Oil produced from the Brassica napus
US5969169A (en) 1993-04-27 1999-10-19 Cargill, Incorporated Non-hydrogenated canola oil for food applications
WO1999053072A1 (en) 1998-04-09 1999-10-21 E.I. Du Pont De Nemours And Company Starch r1 phosphorylation protein homologs
WO1999058690A2 (de) 1998-05-08 1999-11-18 Aventis Cropscience Gmbh Nucleinsäuremoleküle codierend enzyme aus weizen, die an der stärkesynthese beteiligt sind
WO1999058688A2 (de) 1998-05-08 1999-11-18 Aventis Cropscience Gmbh Nucleinsäuremoleküle codierend enzyme aus weizen, die an der stärkesynthese beteiligt sind
WO1999057965A1 (de) 1998-05-14 1999-11-18 Aventis Cropscience Gmbh Sulfonylharnstoff-tolerante zuckerrübenmutanten
WO1999058654A2 (de) 1998-05-13 1999-11-18 Planttec Biotechnologie Gmbh Forschung & Entwicklung Transgene pflanzen mit veränderter aktivität eines plastidären adp/atp - translokators
WO1999066050A1 (en) 1998-06-15 1999-12-23 National Starch And Chemical Investment Holding Corporation Improvements in or relating to plants and plant products
US6013861A (en) 1989-05-26 2000-01-11 Zeneca Limited Plants and processes for obtaining them
WO2000004173A1 (en) 1998-07-17 2000-01-27 Aventis Cropscience N.V. Methods and means to modulate programmed cell death in eukaryotic cells
WO2000008184A1 (de) 1998-07-31 2000-02-17 Aventis Cropscience Gmbh Pflanzen, die eine modifizierte stärke synthetisieren, verfahren zur herstellung der pflanzen, ihre verwendung sowie die modifizierte stärke
WO2000008185A1 (de) 1998-07-31 2000-02-17 Aventis Cropscience Gmbh Nukleinsäuremoleküle kodierend für beta-amylase, pflanzen, die eine modifizierte stärke synthetisieren, herstellungsverfahren und verwendungen
WO2000011192A2 (en) 1998-08-25 2000-03-02 Pioneer Hi-Bred International, Inc. Plant glutamine: fructose-6-phosphate amidotransferase nucleic acids
WO2000014249A1 (en) 1998-09-02 2000-03-16 Planttec Biotechnologie Gmbh Nucleic acid molecules encoding an amylosucrase
WO2000022140A1 (de) 1998-10-09 2000-04-20 Planttec Biotechnologie Gmbh Forschung & Entwicklung NUCLEINSÄUREMOLEKÜLE CODIEREND EIN VERZWEIGUNGSENZYM AUS BAKTERIEN DER GATTUNG NEISSERIA SOWIE VERFAHREN ZUR HERSTELLUNG VON α-1,6-VERZWEIGTEN α-1,4-GLUCANEN
US6063947A (en) 1996-07-03 2000-05-16 Cargill, Incorporated Canola oil having increased oleic acid and decreased linolenic acid content
WO2000028052A2 (en) 1998-11-09 2000-05-18 Planttec Biotechnologie Gmbh Nucleic acid molecules from rice encoding an r1 protein and their use for the production of modified starch
WO2000047727A2 (en) 1999-02-08 2000-08-17 Planttec Biotechnologie Gmbh Forschung & Entwicklung Nucleic acid molecules encoding alternansucrase
WO2000066747A1 (en) 1999-04-29 2000-11-09 Syngenta Limited Herbicide resistant plants
WO2000066746A1 (en) 1999-04-29 2000-11-09 Syngenta Limited Herbicide resistant plants
WO2000073422A1 (en) 1999-05-27 2000-12-07 Planttec Biotechnologie Gmbh Genetically modified plant cells and plants with an increased activity of an amylosucrase protein and a branching enzyme
WO2000077229A2 (en) 1999-06-11 2000-12-21 Aventis Cropscience Gmbh R1 protein from wheat and the use thereof for the production of modified strach
WO2001012782A2 (de) 1999-08-12 2001-02-22 Aventis Cropscience Gmbh Transgene pflanzenzellen und pflanzen mit veränderter aktivität des gbssi- und des be-proteins
WO2001012826A2 (de) 1999-08-11 2001-02-22 Aventis Cropscience Gmbh Nukleinsäuremoleküle aus pflanzen codierend enzyme, die an der stärkesynthese beteiligt sind
WO2001014569A2 (de) 1999-08-20 2001-03-01 Basf Plant Science Gmbh Erhöhung des polysaccharidgehaltes in pflanzen
WO2001017333A1 (en) 1999-09-10 2001-03-15 Texas Tech University Transgenic fiber producing plants with increased expression of sucrose phosphate synthase
WO2001019975A2 (en) 1999-09-15 2001-03-22 National Starch And Chemical Investment Holding Corporation Plants having reduced activity in two or more starch-modifying enzymes
WO2001024615A1 (en) 1999-10-07 2001-04-12 Valigen (Us), Inc. Non-transgenic herbicide resistant plants
US6270828B1 (en) 1993-11-12 2001-08-07 Cargrill Incorporated Canola variety producing a seed with reduced glucosinolates and linolenic acid yielding an oil with low sulfur, improved sensory characteristics and increased oxidative stability
US6284479B1 (en) 1995-06-07 2001-09-04 Pioneer Hi-Bred International, Inc. Substitutes for modified starch and latexes in paper manufacture
WO2001065922A2 (en) 2000-03-09 2001-09-13 E. I. Du Pont De Nemours And Company Sulfonylurea-tolerant sunflower plants
WO2001066704A2 (en) 2000-03-09 2001-09-13 Monsanto Technology Llc Methods for making plants tolerant to glyphosate and compositions thereof
US6323392B1 (en) 1999-03-01 2001-11-27 Pioneer Hi-Bred International, Inc. Formation of brassica napus F1 hybrid seeds which exhibit a highly elevated oleic acid content and a reduced linolenic acid content in the endogenously formed oil of the seeds
WO2001098509A2 (en) 2000-06-21 2001-12-27 Syngenta Participations Ag Grain processing method and transgenic plants useful therein
WO2002026995A1 (en) 2000-09-29 2002-04-04 Syngenta Limited Herbicide resistant plants
WO2002034923A2 (en) 2000-10-23 2002-05-02 Bayer Cropscience Gmbh Monocotyledon plant cells and plants which synthesise modified starch
WO2002036787A2 (fr) 2000-10-30 2002-05-10 Bayer Cropscience S.A. Plantes tolerantes aux herbicides par contournement de voie metabolique
WO2002036782A2 (en) 2000-10-30 2002-05-10 Maxygen, Inc. Novel glyphosate n-acetyltransferase (gat) genes
WO2002045485A1 (en) 2000-12-08 2002-06-13 Commonwealth Scienctific And Industrial Research Organisation Modification of sucrose synthase gene expression in plant tissue and uses therefor
WO2002079410A2 (en) 2001-03-30 2002-10-10 Basf Plant Science Gmbh Glucan chain length domains
WO2002101059A2 (en) 2001-06-12 2002-12-19 Bayer Cropscience Gmbh Transgenic plants synthesising high amylose starch
WO2003013226A2 (en) 2001-08-09 2003-02-20 Cibus Genetics Non-transgenic herbicide resistant plants
WO2003033540A2 (en) 2001-10-17 2003-04-24 Basf Plant Science Gmbh Starch
WO2003071860A2 (en) 2002-02-26 2003-09-04 Bayer Cropscience Gmbh Method for generating maize plants with an increased leaf starch content, and their use for making maize silage
WO2003092360A2 (en) 2002-04-30 2003-11-13 Verdia, Inc. Novel glyphosate-n-acetyltransferase (gat) genes
WO2004024928A2 (fr) 2002-09-11 2004-03-25 Bayer Cropscience S.A. Plantes transformees a biosynthese de prenylquinones amelioree
US6734341B2 (en) 1999-09-02 2004-05-11 Pioneer Hi-Bred International, Inc. Starch synthase polynucleotides and their use in the production of new starches
WO2004040012A2 (en) 2002-10-29 2004-05-13 Basf Plant Science Gmbh Compositions and methods for identifying plants having increased tolerance to imidazolinone herbicides
WO2004053219A2 (en) 2002-12-05 2004-06-24 Jentex Corporation Abrasive webs and methods of making the same
WO2004056999A1 (en) 2002-12-19 2004-07-08 Bayer Cropscience Gmbh Plant cells and plants which synthesize a starch with an increased final viscosity
WO2004078983A2 (en) 2003-03-07 2004-09-16 Basf Plant Science Gmbh Enhanced amylose production in plants
WO2004090140A2 (en) 2003-04-09 2004-10-21 Bayer Bioscience N.V. Methods and means for increasing the tolerance of plants to stress conditions
WO2004106529A2 (en) 2003-05-28 2004-12-09 Basf Aktiengesellschaft Wheat plants having increased tolerance to imidazolinone herbicides
WO2005002359A2 (en) 2003-05-22 2005-01-13 Syngenta Participations Ag Modified starch, uses, methods for production thereof
WO2005012515A2 (en) 2003-04-29 2005-02-10 Pioneer Hi-Bred International, Inc. Novel glyphosate-n-acetyltransferase (gat) genes
WO2005012529A1 (ja) 2003-07-31 2005-02-10 Toyo Boseki Kabushiki Kaisha ヒアルロン酸生産植物
WO2005017157A1 (en) 2003-08-15 2005-02-24 Commonwealth Scientific And Industrial Research Organisation (Csiro) Methods and means for altering fiber characteristics in fiber-producing plants
WO2005020673A1 (en) 2003-08-29 2005-03-10 Instituto Nacional De Technologia Agropecuaria Rice plants having increased tolerance to imidazolinone herbicides
US20050066389A1 (en) * 2003-06-23 2005-03-24 The Regents Of The University Of California Genes which produce staygreen characteristics in maize and their uses
WO2005030941A1 (en) 2003-09-30 2005-04-07 Bayer Cropscience Gmbh Plants with increased activity of a class 3 branching enzyme
WO2005030942A1 (en) 2003-09-30 2005-04-07 Bayer Cropscience Gmbh Plants with reduced activity of a class 3 branching enzyme
WO2005054285A1 (en) * 2003-12-04 2005-06-16 Protaffin Biotechnologie Ag Gag binding proteins
WO2005093093A2 (en) 2004-03-22 2005-10-06 Basf Aktiengesellschaft Methods and compositions for analyzing ahasl genes
WO2005095617A2 (en) 2004-03-05 2005-10-13 Bayer Cropscience Gmbh Plants with increased activity of a starch phosphorylating enzyme
WO2005095619A1 (en) 2004-03-05 2005-10-13 Bayer Cropscience Gmbh Plants with increased activity of multiple starch phosphorylating enzymes
WO2005095632A2 (en) 2004-03-05 2005-10-13 Bayer Cropscience Gmbh Methods for identifying proteins with starch phosphorylating enzymatic activity
WO2005095618A2 (en) 2004-03-05 2005-10-13 Bayer Cropscience Gmbh Plants with reduced activity of the starch phosphorylating enzyme phosphoglucan, water dikinase
WO2005123927A1 (en) 2004-06-21 2005-12-29 Bayer Cropscience Gmbh Plants that produce amylopectin starch with novel properties
WO2006007373A2 (en) 2004-06-16 2006-01-19 Basf Plant Science Gmbh Polynucleotides encoding mature ahasl proteins for creating imidazolinone-tolerant plants
WO2006015376A2 (en) 2004-08-04 2006-02-09 Basf Plant Science Gmbh Monocot ahass sequences and methods of use
WO2006018319A1 (en) 2004-08-18 2006-02-23 Bayer Cropscience Gmbh Plants with increased plastidic activity of r3 starch-phosphorylating enzyme
WO2006024351A1 (en) 2004-07-30 2006-03-09 Basf Agrochemical Products B.V. Herbicide-resistant sunflower plants, plynucleotides encoding herbicide-resistant acetohydroxy acid synthase large subunit proteins, and methods of use
WO2006032538A1 (en) 2004-09-23 2006-03-30 Bayer Cropscience Gmbh Methods and means for producing hyaluronan
WO2006060634A2 (en) 2004-12-01 2006-06-08 Basf Agrochemical Products, B.V. Novel mutation involved in increased tolerance to imidazolinone herbicides in plants
WO2006063862A1 (en) 2004-12-17 2006-06-22 Bayer Cropscience Ag Transformed plant expressing a dextransucrase and synthesizing a modified starch
WO2006072603A2 (en) 2005-01-10 2006-07-13 Bayer Cropscience Ag Transformed plant expressing a mutansucrase and synthesizing a modified starch
WO2006103107A1 (en) 2005-04-01 2006-10-05 Bayer Cropscience Ag Phosphorylated waxy potato starch
WO2006108702A1 (en) 2005-04-08 2006-10-19 Bayer Cropscience Ag High-phosphate starch
JP2006304779A (ja) 2005-03-30 2006-11-09 Toyobo Co Ltd ヘキソサミン高生産植物
WO2006133827A2 (en) 2005-06-15 2006-12-21 Bayer Bioscience N.V. Methods for increasing the resistance of plants to hypoxic conditions
WO2006136351A2 (en) 2005-06-24 2006-12-28 Bayer Bioscience N.V. Methods for altering the reactivity of plant cell walls
WO2007009823A1 (en) 2005-07-22 2007-01-25 Bayer Cropscience Ag Overexpression of starch synthase in plants
WO2007024782A2 (en) 2005-08-24 2007-03-01 Pioneer Hi-Bred International, Inc. Compositions providing tolerance to multiple herbicides and methods of use thereof
WO2007027777A2 (en) 2005-08-31 2007-03-08 Monsanto Technology Llc Nucleotide sequences encoding insecticidal proteins
WO2007039316A1 (en) 2005-10-05 2007-04-12 Bayer Cropscience Ag Improved methods and means for producings hyaluronan
WO2007039314A2 (en) 2005-10-05 2007-04-12 Bayer Cropscience Ag Plants with increased hyaluronan production
WO2007039315A1 (de) 2005-10-05 2007-04-12 Bayer Cropscience Ag Pflanzen mit gesteigerter produktion von hyaluronan ii

Patent Citations (162)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5331107A (en) 1984-03-06 1994-07-19 Mgi Pharma, Inc. Herbicide resistance in plants
US4761373A (en) 1984-03-06 1988-08-02 Molecular Genetics, Inc. Herbicide resistance in plants
US5304732A (en) 1984-03-06 1994-04-19 Mgi Pharma, Inc. Herbicide resistance in plants
US5561236A (en) 1986-03-11 1996-10-01 Plant Genetic Systems Genetically engineered plant cells and plants exhibiting resistance to glutamine synthetase inhibitors, DNA fragments and recombinants for use in the production of said cells and plants
US5646024A (en) 1986-03-11 1997-07-08 Plant Genetic Systems, N.V. Genetically engineered plant cells and plants exhibiting resistance to glutamine synthetase inhibitors, DNA fragments and recombinants for use in the production of said cells and plants
US7112665B1 (en) 1986-03-11 2006-09-26 Bayer Bioscience N.V. Genetically engineered plant cells and plants exhibiting resistance to glutamine synthetase inhibitors, DNA fragments and recombinants for use in the production of said cells and plants
US5648477A (en) 1986-03-11 1997-07-15 Plant Genetic Systems, N.V. Genetically engineered plant cells and plants exhibiting resistance to glutamine synthetase inhibitors, DNA fragments and recombinants for use in the production of said cells and plants
US5637489A (en) 1986-08-23 1997-06-10 Hoechst Aktiengesellschaft Phosphinothricin-resistance gene, and its use
US5273894A (en) 1986-08-23 1993-12-28 Hoechst Aktiengesellschaft Phosphinothricin-resistance gene, and its use
US5276268A (en) 1986-08-23 1994-01-04 Hoechst Aktiengesellschaft Phosphinothricin-resistance gene, and its use
US5605011A (en) 1986-08-26 1997-02-25 E. I. Du Pont De Nemours And Company Nucleic acid fragment encoding herbicide resistant plant acetolactate synthase
US5378824A (en) 1986-08-26 1995-01-03 E. I. Du Pont De Nemours And Company Nucleic acid fragment encoding herbicide resistant plant acetolactate synthase
US5141870A (en) 1987-07-27 1992-08-25 E. I. Du Pont De Nemours And Company Nucleic acid fragment encoding herbicide resistant plant acetolactate synthase
US5013659A (en) 1987-07-27 1991-05-07 E. I. Du Pont De Nemours And Company Nucleic acid fragment encoding herbicide resistant plant acetolactate synthase
US5840946A (en) 1987-12-31 1998-11-24 Pioneer Hi-Bred International, Inc. Vegetable oil extracted from rapeseeds having a genetically controlled unusually high oleic acid content
US5084082A (en) 1988-09-22 1992-01-28 E. I. Du Pont De Nemours And Company Soybean plants with dominant selectable trait for herbicide resistance
US6013861A (en) 1989-05-26 2000-01-11 Zeneca Limited Plants and processes for obtaining them
US5908810A (en) 1990-02-02 1999-06-01 Hoechst Schering Agrevo Gmbh Method of improving the growth of crop plants which are resistant to glutamine synthetase inhibitors
US5739082A (en) 1990-02-02 1998-04-14 Hoechst Schering Agrevo Gmbh Method of improving the yield of herbicide-resistant crop plants
US5434283A (en) 1990-04-04 1995-07-18 Pioneer Hi-Bred International, Inc. Edible endogenous vegetable oil extracted from rapeseeds of reduced stearic and palmitic saturated fatty acid content
US5198599A (en) 1990-06-05 1993-03-30 Idaho Resarch Foundation, Inc. Sulfonylurea herbicide resistance in plants
US5463175A (en) 1990-06-25 1995-10-31 Monsanto Company Glyphosate tolerant plants
US5776760A (en) 1990-06-25 1998-07-07 Monsanto Company Glyphosate tolerant plants
EP0571427A1 (de) 1991-02-13 1993-12-01 Hoechst Schering AgrEvo GmbH Plasmide, die die DNA-Sequenzen für die Veränderung des Kohlenhijdrats bzw. Komposition in Pflanzen enthalten, sowie eine Pflanze...
US5767361A (en) 1991-07-31 1998-06-16 American Cyanamid Company Imidazolinone resistant AHAS mutants
US5731180A (en) 1991-07-31 1998-03-24 American Cyanamid Company Imidazolinone resistant AHAS mutants
EP0663956A1 (de) 1992-08-12 1995-07-26 Hoechst Schering AgrEvo GmbH Dna sequenzen, die zur bildung von polyfructanen (levanen) führen, plasmide mit entsprechenden sequenzen, sowie ein verfahren zur herstellung transgener pflanzen
WO1994004693A2 (en) 1992-08-26 1994-03-03 Zeneca Limited Novel plants and processes for obtaining them
WO1994009144A1 (en) 1992-10-14 1994-04-28 Zeneca Limited Novel plants and processes for obtaining them
WO1994011520A2 (en) 1992-11-09 1994-05-26 Zeneca Limited Novel plants and processes for obtaining them
WO1994021795A1 (en) 1993-03-25 1994-09-29 Ciba-Geigy Ag Novel pesticidal proteins and strains
US5969169A (en) 1993-04-27 1999-10-19 Cargill, Incorporated Non-hydrogenated canola oil for food applications
WO1995004826A1 (en) 1993-08-09 1995-02-16 Institut Für Genbiologische Forschung Berlin Gmbh Debranching enzymes and dna sequences coding them, suitable for changing the degree of branching of amylopectin starch in plants
EP0719338A1 (de) 1993-09-09 1996-07-03 Hoechst Schering AgrEvo GmbH Dna-sequenzen kombination, die die bildung von modifizierter stärke in pflanzenzellen und pflanzen ermögliht
US5965755A (en) 1993-10-12 1999-10-12 Agrigenetics, Inc. Oil produced from the Brassica napus
US6169190B1 (en) 1993-10-12 2001-01-02 Agrigenetics Inc Oil of Brassica napus
US5908975A (en) 1993-11-09 1999-06-01 E. I. Du Pont De Nemours And Company Accumulation of fructans in plants by targeted expression of bacterial levansucrase
EP0728213A1 (de) 1993-11-09 1996-08-28 E.I. Du Pont De Nemours And Company Transgene fruktan - anreichernde nutzpflanzen und verfahren zu ihrer herstellung
US6270828B1 (en) 1993-11-12 2001-08-07 Cargrill Incorporated Canola variety producing a seed with reduced glucosinolates and linolenic acid yielding an oil with low sulfur, improved sensory characteristics and increased oxidative stability
WO1995026407A1 (en) 1994-03-25 1995-10-05 National Starch And Chemical Investment Holding Corporation Method for producing altered starch from potato plants
WO1995031553A1 (en) 1994-05-18 1995-11-23 Institut Für Genbiologische Forschung Berlin Gmbh DNA SEQUENCES CODING FOR ENZYMES CAPABLE OF FACILITATING THE SYNTHESIS OF LINEAR α-1,4 GLUCANS IN PLANTS, FUNGI AND MICROORGANISMS
US5824790A (en) 1994-06-21 1998-10-20 Zeneca Limited Modification of starch synthesis in plants
WO1995035026A1 (en) 1994-06-21 1995-12-28 Zeneca Limited Novel plants and processes for obtaining them
WO1996001904A1 (en) 1994-07-08 1996-01-25 Stichting Scheikundig Onderzoek In Nederland Production of oligosaccharides in transgenic plants
WO1996015248A1 (de) 1994-11-10 1996-05-23 Hoechst Schering Agrevo Gmbh Dna-moleküle codierend enzyme, die an der stärkesynthese beteiligt sind, vektoren, bakterien, transgene pflanzenzellen und pflanzen enthaltend diese moleküle
WO1996019581A1 (en) 1994-12-22 1996-06-27 Hoechst Schering Agrevo Gmbh Dna molecules coding for debranching enzymes derived from plants
WO1996021023A1 (en) 1995-01-06 1996-07-11 Centrum Voor Plantenveredelings- En Reproduktieonderzoek (Cpro - Dlo) Dna sequences encoding carbohydrate polymer synthesizing enzymes and method for producing transgenic plants
WO1996027674A1 (de) 1995-03-08 1996-09-12 Hoechst Schering Agrevo Gmbh Modifizierte stärke aus pflanzen, pflanzen, die diese synthetisieren, sowie verfahren zu ihrer herstellung
WO1996033270A1 (en) 1995-04-20 1996-10-24 American Cyanamid Company Structure-based designed herbicide resistant products
US5928937A (en) 1995-04-20 1999-07-27 American Cyanamid Company Structure-based designed herbicide resistant products
WO1996034968A2 (en) 1995-05-05 1996-11-07 National Starch And Chemical Investment Holding Corporation Improvements in or relating to plant starch composition
WO1996038567A2 (fr) 1995-06-02 1996-12-05 Rhone-Poulenc Agrochimie Sequence adn d'un gene de l'hydroxy-phenyl pyruvate dioxygenase et obtention de plantes contenant un gene de l'hydroxy-phenyl pyruvate dioxygenase, tolerantes a certains herbicides
US6284479B1 (en) 1995-06-07 2001-09-04 Pioneer Hi-Bred International, Inc. Substitutes for modified starch and latexes in paper manufacture
US5712107A (en) 1995-06-07 1998-01-27 Pioneer Hi-Bred International, Inc. Substitutes for modified starch and latexes in paper manufacture
US20020031826A1 (en) 1995-06-07 2002-03-14 Nichols Scott E. Glucan-containing compositions and paper
EP0837944A2 (de) 1995-07-19 1998-04-29 Rhone-Poulenc Agrochimie Mutierte 5-enolpyruvylshikimat-3-phosphat synthase, für dieses protein kodierendes gen und dieses gen enthaltende transformierte pflanzen
WO1997011188A1 (de) 1995-09-19 1997-03-27 Planttec Biotechnologie Gmbh Pflanzen, die eine modifizierte stärke synthetisieren, verfahren zu ihrer herstellung sowie modifizierte stärke
WO1997020936A1 (en) 1995-12-06 1997-06-12 Zeneca Limited Modification of starch synthesis in plants
WO1997026362A1 (de) 1996-01-16 1997-07-24 Planttec Biotechnologie Gmbh Nucleinsäuremoleküle aus pflanzen codierend enzyme, die an der stärkesynthese beteiligt sind
WO1997032985A1 (de) 1996-03-07 1997-09-12 Planttec Biotechnologie Gmbh Forschung & Entwicklung Nucleinsäuremoleküle, codierend debranching-enzyme aus mais
WO1997041218A1 (en) 1996-04-29 1997-11-06 Board Of Supervisors Of Louisiana State University And Agricultural And Mechanical College Herbicide resistant rice
WO1997042328A1 (de) 1996-05-06 1997-11-13 Planttec Biotechnologie Gmbh Nucleinsäuremoleküle, die debranching-enzyme aus kartoffel codieren
WO1997044472A1 (de) 1996-05-17 1997-11-27 Planttec Biotechnologie Gmbh Nucleinsäuremoleküle codierend lösliche stärkesynthasen aus mais
WO1997045545A1 (en) 1996-05-29 1997-12-04 Hoechst Schering Agrevo Gmbh Nucleic acid molecules encoding enzymes from wheat which are involved in starch synthesis
WO1997047808A1 (en) 1996-06-12 1997-12-18 Pioneer Hi-Bred International, Inc. Substitutes for modified starch in paper manufacture
WO1997047807A1 (en) 1996-06-12 1997-12-18 Pioneer Hi-Bred International, Inc. Substitutes for modified starch in paper manufacture
WO1997047806A1 (en) 1996-06-12 1997-12-18 Pioneer Hi-Bred International, Inc. Substitutes for modified starch in paper manufacture
WO1998000549A1 (en) 1996-06-27 1998-01-08 The Australian National University MANIPULATION OF CELLULOSE AND/OR β-1,4-GLUCAN
US6063947A (en) 1996-07-03 2000-05-16 Cargill, Incorporated Canola oil having increased oleic acid and decreased linolenic acid content
US5773702A (en) 1996-07-17 1998-06-30 Board Of Trustees Operating Michigan State University Imidazolinone herbicide resistant sugar beet plants
WO1998020145A2 (en) 1996-11-05 1998-05-14 National Starch And Chemical Investment Holding Corporation Improvements in or relating to starch content of plants
WO1998022604A1 (en) 1996-11-20 1998-05-28 Pioneer Hi-Bred International, Inc. Methods of producing high-oil seed by modification of starch levels
WO1998027212A1 (en) 1996-12-19 1998-06-25 Planttec Biotechnologie Gmbh Novel nucleic acid molecules from maize and their use for the production of modified starch
WO1998032326A2 (en) 1997-01-24 1998-07-30 Pioneer Hi-Bred International, Inc. Methods for $i(agrobacterium)-mediated transformation
WO1998039460A1 (en) 1997-03-04 1998-09-11 MAX-PLANCK-Gesellschaft zur Förderung der Wissenschaften e.V. Nucleic acid molecules from artichoke ($i(cynara scolymus)) encoding enzymes having fructosyl polymerase activity
WO1998040503A1 (en) 1997-03-10 1998-09-17 Planttec Biotechnologie Gmbh Nucleic acid molecules encoding starch phosphorylase from maize
WO1999012950A2 (en) 1997-09-06 1999-03-18 National Starch And Chemical Investment Holding Corporation Improvements in or relating to stability of plant starches
WO1999024593A1 (en) 1997-11-06 1999-05-20 MAX-PLANCK-Gesellschaft zur Förderung der Wissenschaften e.V. Nucleic acid molecules which encode proteins having fructosyl transferase activity and methods for producing long-chain inulin
WO1999024585A1 (fr) 1997-11-07 1999-05-20 Aventis Cropscience S.A. Hydroxy-phenyl pyruvate dioxygenase mutee, sequence d'adn et obtention de plantes contenant un tel gene, tolerantes aux herbicides
WO1999024586A1 (fr) 1997-11-07 1999-05-20 Aventis Cropscience S.A. Hydroxy-phenyl pyruvate dioxygenase chimere, sequence d'adn et obtention de plantes contenant un tel gene, tolerantes aux herbicides
WO1999034008A1 (fr) 1997-12-24 1999-07-08 Aventis Cropscience S.A. Procede de preparation enzymatique d'homogentisate
WO1999053072A1 (en) 1998-04-09 1999-10-21 E.I. Du Pont De Nemours And Company Starch r1 phosphorylation protein homologs
WO1999058688A2 (de) 1998-05-08 1999-11-18 Aventis Cropscience Gmbh Nucleinsäuremoleküle codierend enzyme aus weizen, die an der stärkesynthese beteiligt sind
WO1999058690A2 (de) 1998-05-08 1999-11-18 Aventis Cropscience Gmbh Nucleinsäuremoleküle codierend enzyme aus weizen, die an der stärkesynthese beteiligt sind
WO1999058654A2 (de) 1998-05-13 1999-11-18 Planttec Biotechnologie Gmbh Forschung & Entwicklung Transgene pflanzen mit veränderter aktivität eines plastidären adp/atp - translokators
WO1999057965A1 (de) 1998-05-14 1999-11-18 Aventis Cropscience Gmbh Sulfonylharnstoff-tolerante zuckerrübenmutanten
WO1999066050A1 (en) 1998-06-15 1999-12-23 National Starch And Chemical Investment Holding Corporation Improvements in or relating to plants and plant products
WO2000004173A1 (en) 1998-07-17 2000-01-27 Aventis Cropscience N.V. Methods and means to modulate programmed cell death in eukaryotic cells
WO2000008185A1 (de) 1998-07-31 2000-02-17 Aventis Cropscience Gmbh Nukleinsäuremoleküle kodierend für beta-amylase, pflanzen, die eine modifizierte stärke synthetisieren, herstellungsverfahren und verwendungen
WO2000008184A1 (de) 1998-07-31 2000-02-17 Aventis Cropscience Gmbh Pflanzen, die eine modifizierte stärke synthetisieren, verfahren zur herstellung der pflanzen, ihre verwendung sowie die modifizierte stärke
WO2000011192A2 (en) 1998-08-25 2000-03-02 Pioneer Hi-Bred International, Inc. Plant glutamine: fructose-6-phosphate amidotransferase nucleic acids
WO2000014249A1 (en) 1998-09-02 2000-03-16 Planttec Biotechnologie Gmbh Nucleic acid molecules encoding an amylosucrase
WO2000022140A1 (de) 1998-10-09 2000-04-20 Planttec Biotechnologie Gmbh Forschung & Entwicklung NUCLEINSÄUREMOLEKÜLE CODIEREND EIN VERZWEIGUNGSENZYM AUS BAKTERIEN DER GATTUNG NEISSERIA SOWIE VERFAHREN ZUR HERSTELLUNG VON α-1,6-VERZWEIGTEN α-1,4-GLUCANEN
WO2000028052A2 (en) 1998-11-09 2000-05-18 Planttec Biotechnologie Gmbh Nucleic acid molecules from rice encoding an r1 protein and their use for the production of modified starch
WO2000047727A2 (en) 1999-02-08 2000-08-17 Planttec Biotechnologie Gmbh Forschung & Entwicklung Nucleic acid molecules encoding alternansucrase
US6323392B1 (en) 1999-03-01 2001-11-27 Pioneer Hi-Bred International, Inc. Formation of brassica napus F1 hybrid seeds which exhibit a highly elevated oleic acid content and a reduced linolenic acid content in the endogenously formed oil of the seeds
WO2000066747A1 (en) 1999-04-29 2000-11-09 Syngenta Limited Herbicide resistant plants
WO2000066746A1 (en) 1999-04-29 2000-11-09 Syngenta Limited Herbicide resistant plants
WO2000073422A1 (en) 1999-05-27 2000-12-07 Planttec Biotechnologie Gmbh Genetically modified plant cells and plants with an increased activity of an amylosucrase protein and a branching enzyme
WO2000077229A2 (en) 1999-06-11 2000-12-21 Aventis Cropscience Gmbh R1 protein from wheat and the use thereof for the production of modified strach
WO2001012826A2 (de) 1999-08-11 2001-02-22 Aventis Cropscience Gmbh Nukleinsäuremoleküle aus pflanzen codierend enzyme, die an der stärkesynthese beteiligt sind
WO2001012782A2 (de) 1999-08-12 2001-02-22 Aventis Cropscience Gmbh Transgene pflanzenzellen und pflanzen mit veränderter aktivität des gbssi- und des be-proteins
WO2001014569A2 (de) 1999-08-20 2001-03-01 Basf Plant Science Gmbh Erhöhung des polysaccharidgehaltes in pflanzen
US6734341B2 (en) 1999-09-02 2004-05-11 Pioneer Hi-Bred International, Inc. Starch synthase polynucleotides and their use in the production of new starches
WO2001017333A1 (en) 1999-09-10 2001-03-15 Texas Tech University Transgenic fiber producing plants with increased expression of sucrose phosphate synthase
WO2001019975A2 (en) 1999-09-15 2001-03-22 National Starch And Chemical Investment Holding Corporation Plants having reduced activity in two or more starch-modifying enzymes
WO2001024615A1 (en) 1999-10-07 2001-04-12 Valigen (Us), Inc. Non-transgenic herbicide resistant plants
WO2001065922A2 (en) 2000-03-09 2001-09-13 E. I. Du Pont De Nemours And Company Sulfonylurea-tolerant sunflower plants
WO2001066704A2 (en) 2000-03-09 2001-09-13 Monsanto Technology Llc Methods for making plants tolerant to glyphosate and compositions thereof
WO2001098509A2 (en) 2000-06-21 2001-12-27 Syngenta Participations Ag Grain processing method and transgenic plants useful therein
WO2002026995A1 (en) 2000-09-29 2002-04-04 Syngenta Limited Herbicide resistant plants
WO2002034923A2 (en) 2000-10-23 2002-05-02 Bayer Cropscience Gmbh Monocotyledon plant cells and plants which synthesise modified starch
WO2002036782A2 (en) 2000-10-30 2002-05-10 Maxygen, Inc. Novel glyphosate n-acetyltransferase (gat) genes
WO2002036787A2 (fr) 2000-10-30 2002-05-10 Bayer Cropscience S.A. Plantes tolerantes aux herbicides par contournement de voie metabolique
WO2002045485A1 (en) 2000-12-08 2002-06-13 Commonwealth Scienctific And Industrial Research Organisation Modification of sucrose synthase gene expression in plant tissue and uses therefor
WO2002079410A2 (en) 2001-03-30 2002-10-10 Basf Plant Science Gmbh Glucan chain length domains
WO2002101059A2 (en) 2001-06-12 2002-12-19 Bayer Cropscience Gmbh Transgenic plants synthesising high amylose starch
WO2003013226A2 (en) 2001-08-09 2003-02-20 Cibus Genetics Non-transgenic herbicide resistant plants
WO2003033540A2 (en) 2001-10-17 2003-04-24 Basf Plant Science Gmbh Starch
WO2003071860A2 (en) 2002-02-26 2003-09-04 Bayer Cropscience Gmbh Method for generating maize plants with an increased leaf starch content, and their use for making maize silage
WO2003092360A2 (en) 2002-04-30 2003-11-13 Verdia, Inc. Novel glyphosate-n-acetyltransferase (gat) genes
WO2004024928A2 (fr) 2002-09-11 2004-03-25 Bayer Cropscience S.A. Plantes transformees a biosynthese de prenylquinones amelioree
WO2004040012A2 (en) 2002-10-29 2004-05-13 Basf Plant Science Gmbh Compositions and methods for identifying plants having increased tolerance to imidazolinone herbicides
WO2004053219A2 (en) 2002-12-05 2004-06-24 Jentex Corporation Abrasive webs and methods of making the same
WO2004056999A1 (en) 2002-12-19 2004-07-08 Bayer Cropscience Gmbh Plant cells and plants which synthesize a starch with an increased final viscosity
WO2004078983A2 (en) 2003-03-07 2004-09-16 Basf Plant Science Gmbh Enhanced amylose production in plants
WO2004090140A2 (en) 2003-04-09 2004-10-21 Bayer Bioscience N.V. Methods and means for increasing the tolerance of plants to stress conditions
WO2005012515A2 (en) 2003-04-29 2005-02-10 Pioneer Hi-Bred International, Inc. Novel glyphosate-n-acetyltransferase (gat) genes
WO2005002359A2 (en) 2003-05-22 2005-01-13 Syngenta Participations Ag Modified starch, uses, methods for production thereof
WO2004106529A2 (en) 2003-05-28 2004-12-09 Basf Aktiengesellschaft Wheat plants having increased tolerance to imidazolinone herbicides
US20050066389A1 (en) * 2003-06-23 2005-03-24 The Regents Of The University Of California Genes which produce staygreen characteristics in maize and their uses
WO2005012529A1 (ja) 2003-07-31 2005-02-10 Toyo Boseki Kabushiki Kaisha ヒアルロン酸生産植物
WO2005017157A1 (en) 2003-08-15 2005-02-24 Commonwealth Scientific And Industrial Research Organisation (Csiro) Methods and means for altering fiber characteristics in fiber-producing plants
WO2005020673A1 (en) 2003-08-29 2005-03-10 Instituto Nacional De Technologia Agropecuaria Rice plants having increased tolerance to imidazolinone herbicides
WO2005030941A1 (en) 2003-09-30 2005-04-07 Bayer Cropscience Gmbh Plants with increased activity of a class 3 branching enzyme
WO2005030942A1 (en) 2003-09-30 2005-04-07 Bayer Cropscience Gmbh Plants with reduced activity of a class 3 branching enzyme
WO2005054285A1 (en) * 2003-12-04 2005-06-16 Protaffin Biotechnologie Ag Gag binding proteins
WO2005095617A2 (en) 2004-03-05 2005-10-13 Bayer Cropscience Gmbh Plants with increased activity of a starch phosphorylating enzyme
WO2005095619A1 (en) 2004-03-05 2005-10-13 Bayer Cropscience Gmbh Plants with increased activity of multiple starch phosphorylating enzymes
WO2005095632A2 (en) 2004-03-05 2005-10-13 Bayer Cropscience Gmbh Methods for identifying proteins with starch phosphorylating enzymatic activity
WO2005095618A2 (en) 2004-03-05 2005-10-13 Bayer Cropscience Gmbh Plants with reduced activity of the starch phosphorylating enzyme phosphoglucan, water dikinase
WO2005093093A2 (en) 2004-03-22 2005-10-06 Basf Aktiengesellschaft Methods and compositions for analyzing ahasl genes
WO2006007373A2 (en) 2004-06-16 2006-01-19 Basf Plant Science Gmbh Polynucleotides encoding mature ahasl proteins for creating imidazolinone-tolerant plants
WO2005123927A1 (en) 2004-06-21 2005-12-29 Bayer Cropscience Gmbh Plants that produce amylopectin starch with novel properties
WO2006024351A1 (en) 2004-07-30 2006-03-09 Basf Agrochemical Products B.V. Herbicide-resistant sunflower plants, plynucleotides encoding herbicide-resistant acetohydroxy acid synthase large subunit proteins, and methods of use
WO2006015376A2 (en) 2004-08-04 2006-02-09 Basf Plant Science Gmbh Monocot ahass sequences and methods of use
WO2006018319A1 (en) 2004-08-18 2006-02-23 Bayer Cropscience Gmbh Plants with increased plastidic activity of r3 starch-phosphorylating enzyme
WO2006032538A1 (en) 2004-09-23 2006-03-30 Bayer Cropscience Gmbh Methods and means for producing hyaluronan
WO2006060634A2 (en) 2004-12-01 2006-06-08 Basf Agrochemical Products, B.V. Novel mutation involved in increased tolerance to imidazolinone herbicides in plants
WO2006063862A1 (en) 2004-12-17 2006-06-22 Bayer Cropscience Ag Transformed plant expressing a dextransucrase and synthesizing a modified starch
WO2006072603A2 (en) 2005-01-10 2006-07-13 Bayer Cropscience Ag Transformed plant expressing a mutansucrase and synthesizing a modified starch
JP2006304779A (ja) 2005-03-30 2006-11-09 Toyobo Co Ltd ヘキソサミン高生産植物
WO2006103107A1 (en) 2005-04-01 2006-10-05 Bayer Cropscience Ag Phosphorylated waxy potato starch
WO2006108702A1 (en) 2005-04-08 2006-10-19 Bayer Cropscience Ag High-phosphate starch
WO2006133827A2 (en) 2005-06-15 2006-12-21 Bayer Bioscience N.V. Methods for increasing the resistance of plants to hypoxic conditions
WO2006136351A2 (en) 2005-06-24 2006-12-28 Bayer Bioscience N.V. Methods for altering the reactivity of plant cell walls
WO2007009823A1 (en) 2005-07-22 2007-01-25 Bayer Cropscience Ag Overexpression of starch synthase in plants
WO2007024782A2 (en) 2005-08-24 2007-03-01 Pioneer Hi-Bred International, Inc. Compositions providing tolerance to multiple herbicides and methods of use thereof
WO2007027777A2 (en) 2005-08-31 2007-03-08 Monsanto Technology Llc Nucleotide sequences encoding insecticidal proteins
WO2007039316A1 (en) 2005-10-05 2007-04-12 Bayer Cropscience Ag Improved methods and means for producings hyaluronan
WO2007039314A2 (en) 2005-10-05 2007-04-12 Bayer Cropscience Ag Plants with increased hyaluronan production
WO2007039315A1 (de) 2005-10-05 2007-04-12 Bayer Cropscience Ag Pflanzen mit gesteigerter produktion von hyaluronan ii

Non-Patent Citations (59)

* Cited by examiner, † Cited by third party
Title
A. SALI; T.L. BLUNDELL: "Comparative protein modelling by satisfaction of spatial restraints", J. MOL. BIOL., vol. 234, 1993, pages 779 - 815, XP024008717, DOI: doi:10.1006/jmbi.1993.1626
ALONSO J M ET AL: "EIN2, a bifunctional transducer of ethylene and stress responses in arabidopsis", SCIENCE, AMERICAN ASSOCIATION FOR THE ADVANCEMENT OF SCIENCE, WASHINGTON, DC; US, vol. 284, 25 June 1999 (1999-06-25), pages 2148 - 2152, XP002957461, ISSN: 0036-8075, DOI: 10.1126/SCIENCE.284.5423.2148 *
ATSCHU,SF; MADDEN,T.L.; SCHAFFER,AA; ZHANG,J.; MILLER,W.; LIPMAN,D.J.: "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", NUCLEIC ACIDS RES, vol. 25, 1997, pages 3389, XP002905950, DOI: doi:10.1093/nar/25.17.3389
B. S. CHAUHAN: "Principles of Biochemistry and Biophysics", 2008, LAXMI PUBLICATIONS, pages: 370
BARRY ET AL., CURR. TOPICS PLANT PHYSIOL., vol. 7, 1992, pages 139 - 145
BLECKMANN A; ALLEKOTTE S; GROTH G: "EIN2, the central regulator of ethylene signaling, is localized at the ER membrane where it interacts with ethylene receptor ETR1", BIOCHEM. J., vol. 424, 2009, pages 1 - 6
C. MARSDEN: "Solvents Guide; 2nd Ed.,", 1963, INTERSCIENCE
C. TUERK; L. GOLD: "Systematic evolution of ligands by exponential enrichment: RNA ligands to bacteriophage T4 DNA polymerase", SCIENCE, vol. 249, 1990, pages 505 - 510, XP002547963, DOI: doi:10.1126/science.2200121
CHEN,F.; MACKEY,A.J.; STOECKERT,C.J. JR; ROOS,D.S.: "OrthoMCL-DB: querying a comprehensive multi-species collection of ortholog groups", NUCLEIC ACIDS RES, vol. 34, 2006, pages D363
CHEN,F.; MACKEY,A.J.; VERMUNT,J.K.; ROOS,D.S.: "Assessing Performance of Orthology Detection Strategies Applied to Eukaryotic Genomes", PLOS ONE, vol. 2, 2007, pages E383
COMAI ET AL., SCIENCE, vol. 221, 1983, pages 370 - 371
CRICKMORE ET AL., MICROBIOLOGY AND MOLECULAR BIOLOGY REVIEWS, vol. 62, 1998, pages 807 - 813
D. W. DROLET; R. D. JENISON; D. E. SMITH; D. PRATT; B. J. HICKE: "A high throughput platform for systematic evolution of ligands by exponential enrichment (SELEX", COMB. CHEM. HIGH THROUGHPUT SCREEN, vol. 2, 1999, pages 271 - 278
DATABASE UniProt [online] 20 May 2008 (2008-05-20), "SubName: Full=DNA binding domain protein, excisionase family;", XP002722326, retrieved from EBI accession no. UNIPROT:B1YMP2 Database accession no. B1YMP2 *
DATABASE UniProt [online] 9 January 2013 (2013-01-09), "SubName: Full=Uncharacterized protein;", XP002722327, retrieved from EBI accession no. UNIPROT:K7JYJ8 Database accession no. K7JYJ8 *
E. C. SISLER: "Ethylene acitvity of some TT-acceptor compounds", TOB SEI, vol. 21, 1977, pages 43 - 45
G. E. SCHALLER; J. J. KIEBER: "The Arabidopsis Book", 2002, AMERICAN SOCIETY OF PLANT BIOLOGISTS, article "Ethylene"
G. VAN ZHONG; J.K. BURNS: "Profiling ethylene regulated gene expression in Arabidopsis thaliana by microarray analysis", PLANT MOL. BIOL., vol. 53, 2003, pages 117 - 131
GASSER ET AL., J. BIOL. CHEM., vol. 263, 1988, pages 4280 - 4289
H.V. OLPHEN: "Introduction to Clay Colloid Chemistry; 2nd Ed.,", J. WILEY & SONS
J. B. CHAIRES: "Calorimetry and thermodynamics in drug design", ANN. REV. BIOPHYS., vol. 37, 2008, pages 125 - 151
K. MARTENS: "Spray Drying 3rd Ed.", 1979, G. GOODWIN LTD.
M. A. COOPLER: "Label-free screening of biomolecular interactions", ANAL. BIOANAL. CHEM., vol. 337, 2003, pages 834 - 842
M. JERABEK-WILLEMSEN ET AL.: "Molecular interaction studies using microscale thermosphoresis", ASSAY AND DRUG DEVELOPMENT TECHNOLOGIES, vol. 9, 2011, pages 342 - 353
M. M. A. BISSON ET AL: "New Insight in Ethylene Signaling: Autokinase Activity of ETR1 Modulates the Interaction of Receptors and EIN2", MOLECULAR PLANT, vol. 3, no. 5, 2 September 2010 (2010-09-02), pages 882 - 889, XP055058409, ISSN: 1674-2052, DOI: 10.1093/mp/ssq036 *
M. M. A. BISSON; A. BLECKMANN; S. ALLEKOTTE; G. GROTH: "EIN2, the central reguilator of ethylene signalling, is localized at the ER membrane where it interacts with the ethylene receptor ETR1", BIOCHEM J, vol. 424, 2009, pages 1 - 6
M. M. A. BISSON; A. BLECKMANN; S. ALLEKOTTE; G. GROTH: "EIN2, the central regulator of ethylene signalling, is localized at the ER membrane where it interacts with the ethylene receptor ETR1", BIOCHEM J, vol. 424, 2009, pages 1 - 6
M. M. A. BISSON; G. GROTH: "New insight in ethylene signaling: autokinase activity of ETR1 modulates the interaction of receptors and EIN2", MOLECULAR PLANT, vol. 5, 2010, pages 882 - 889, XP055058409, DOI: doi:10.1093/mp/ssq036
M. M. BISSON; G. GROTH: "New paradigm in ethylene signaling", PLANT SIGNAL & BEHAV, vol. 6, 2011, pages 164 - 166
M. S. REID; M-J. WU: "Ethylene and flower senescence", PLANT GROWTH REGULATION, vol. 11, 1992, pages 31 - 43
MCCUTCHEON'S: "Detergents and Emulsifiers Annual", MC PUBL. CORP.
MOELLENBECK ET AL., NAT. BIOTECHNOL., vol. 19, 2001, pages 668 - 72
MORRISON KL; WEISS GA: "Combinatorial alanlne-scanning", CURR OPLN CHEM BIOL, vol. 5, no. 3, June 2001 (2001-06-01), pages 302 - 7
N. A. KAHN: "Ethylene Action in Plants", 2006, SPRINGER
N. A. KAHN: "Ethylene Action in Plants", 2006, SPRINGER, pages: 168 - 169
N. A. KAHN: "Ethylene Action in Plants", 2006, SPRINGER, pages: 169
O'BRIEN,K.P.; REMM,M.; SONNHAMMER,E.L.: "Inparanoid: a comprehensive database of eukaryotic orthologs", NUCLEIC ACIDS RES, vol. 33, 2005, pages D476
P. GUZMÄN; J. R. ECKER: "Exploiting the Triple Response of Arabidopsis To Identify Ethylene-Related Mutants", PLANT CELL, vol. 2, 1990, pages 13 - 523
PENMETSA R VARMA ET AL: "The Medicago truncatula ortholog of Arabidopsis EIN2, sickle, is a negative regulator of symbiotic and pathogenic microbial associations", PLANT JOURNAL, vol. 55, no. 4, August 2008 (2008-08-01), pages 580 - 595, XP002694830, ISSN: 0960-7412 *
S. BANDYOPADHYAY; R. SHARAN; T. IDEKER: "Systematic identfification of functional orthologs based on protein network comparison", GENOME RES., vol. 16, 2006, pages 428 - 435
S. F. ALTSCHUL; W. GISH; W. MILLER; E. W. MYERS; D. J. LIPMAN: "Basic local alignment search tool.", J. MOL. BIOL., vol. 215, 1990, pages 403 - 410, XP002949123, DOI: doi:10.1006/jmbi.1990.9999
S. F. YANG; N. E. HOFFMAN: "Ethylene biosynthesis and its regulation in higher-plants", ANNU. REV. PLANT PHYSIOL. PLANT MOL. BIOL., vol. 35, 1984, pages 155 - 189
S. P. BURG; E. A. BURG: "Molecular requirement for the biological activity of ethylene", PLANT PHYSIOL, vol. 42, pages 144 - 152, XP009147041, DOI: doi:10.1104/pp.42.1.144
SCHAREIN B; VOET VAN VORMIZEELE J; GROTH G: "Ethylene signaling: identifaction of a putative ETR1-AHP1 phosphorelay complex by fluorescence spectroscopy", ANAL. BIOCHEM., vol. 377, 2008, pages 72 - 76, XP022621092, DOI: doi:10.1016/j.ab.2008.03.015
SCHNEPF ET AL., APPLIED ENVIRONM. MICROB., vol. 71, 2006, pages 1765 - 1774
SCHÖNFELDT: "Grenzflächenaktive Äthylenoxidaddukte", 1976, WISS. VERLAGSGESELL.
SHAH ET AL., SCIENCE, vol. 233, 1986, pages 478 - 481
SHANER, NATHAN C; CAMPBELL, ROBERT E; STEINBACH, PAUL A; GIEPMANS, BEN N G; PALMER, AMY E; TSIEN, ROGER Y: "Improved monomeric red, orange and yellow fluorescent proteins derived from Discosoma sp. Red fluorescent protein", NATURE BIOTECHNOLOGY, vol. 22, no. 12, 2004, pages 1567 - 72, XP055047548, DOI: doi:10.1038/nbt1037
SISLEY; WOOD: "Encyclopedia of Surface Active Agents", 1964, CHEM. PUBL. CO. INC.
SONNHAMMER,E.L.; KOONIN,E.V.: "Orthology, paralogy and proposed classification for paralog subtypes", TRENDS GENET, vol. 18, 2002, pages 619, XP004393476, DOI: doi:10.1016/S0168-9525(02)02793-2
TATUSOV,R.L.; FEDOROVA,N.D.; JACKSON,J.D.; JACOBS,A.R.; KIRYUTIN,B.; KOONIN,E.V.; KRYLOV,D.M.; MAZUMDER,R.; MEKHEDOV,S.L.; NKOSKAY: "The COG database: an updated version includes eukaryotes", BMC BIOINFORMATICS, vol. 4, 2003, pages 41, XP021000449, DOI: doi:10.1186/1471-2105-4-41
TATUSOV,R.L.; KOONIN,E.V.; LIPMAN,D.J.: "A genomic perspective on protein families", SCIENCE, vol. 278, 1997, pages 631, XP002108438, DOI: doi:10.1126/science.278.5338.631
TRANEL; WRIGHT, WEED SCIENCE, vol. 50, 2002, pages 700 - 712
VOET VAN VORMIZEELE J; GROTH G: "Heterologous expression and singlestep purification of the ethylene receptor protein ETR1 from Arabidopsis thaliana", PROTEIN EXPR. PURIF., vol. 32, 2003, pages 89 - 94
WADE VAN VALKENBURG: "Pesticide Formulations", 1973, MARCEL DEKKER
WATKINS: "Handbook of Insecticide Dust Diluents and Carriers, 2nd Ed.,", DARLAND BOOKS
WHEELER,D.L.; BARRETT,T.; BENSON,D.A.; BRYANT,S.H.; CANESE,K.; CHETVEMIN,V.; CHURCH,D.M.; DICUCCIO,M.; EDGAR,R.; FEDERHEN,S ET AL.: "Database resources of the National Center for Biotechnology Information", NUCLEIC ACIDS RES, vol. 33, 2005, pages D3
WINNACKER KÜCHLER: "Chemische Technologie", vol. 7, 1986, C. HANSER VERLAG
WOOD,V.: "Comparative Genomics Using Fungi as Models", vol. 15, 2006, article "Schizosaccharomyces pombe/ comparative genomics; from sequence to systems", pages: 233

Similar Documents

Publication Publication Date Title
JP6789824B2 (ja) 増大した除草剤耐性を有する植物
RU2664863C2 (ru) Микроорганизмы - стимуляторы роста растений и их использование
Huang et al. Alteration in chlorophyll fluorescence, lipid peroxidation and antioxidant enzymes activities in hybrid ramie ('boehmeria nivea'L.) Under drought stress
EP2437595B1 (de) Verwendung von fluopyram zur kontrolle von sclerotinia ssp
CA2988764A1 (en) Streptomyces endophyte compositions and methods for improved agronomic traits in plants
HUE030956T2 (hu) Herbicid és fungicid hatású 5-oxi-szubsztituáit 3-fenilizoxazolin-5-karboxamidok és 5-oxi-szubsztituált 3-fenillzoxazolin-5-tioamidok
CN110582205A (zh) 内生植物组合物和用于改进植株性状的方法
KR101904054B1 (ko) 식물 품질의 개선 방법
WO2017112827A1 (en) Endophyte compositions and methods for improvement of plant traits in plants of agronomic importance
BR122019028108B1 (pt) Composições de methylobacterium antifúngicas e métodos de utilização
EA023113B1 (ru) Применение агрохимических смесей для увеличения жизнеспособности растения
JP7040941B2 (ja) 除草剤耐性の増加した植物
Huang et al. Suppression of southern corn leaf blight by a plant growth‐promoting rhizobacterium Bacillus cereus C1L
UA120195C2 (uk) Комбінації активних сполук, які містять (тіо)карбоксамідну похідну і фунгіцидну(ні) сполуку(ки)
AU2017294685A1 (en) Plants having increased tolerance to herbicides
US20170367325A1 (en) Nanoceria Augmentation of Plant Photosynthesis under Abiotic Stress
EP2943065B1 (de) Agrochemische zusammensetzungen zur induktion der abiotischen stresstoleranz
HU220115B (hu) Antipatogén peptidek, ezeket tartalmazó készítmények, eljárás növények védelmére és a peptideket kódoló szekvenciák
CN103562158B (zh) 提高植物质量的方法
WO2014079957A1 (de) Selektive inhibition der ethylensignaltransduktion
Kmiec et al. Physiological reaction of Phalaenopsis x hybridum ‘Innocence’on Pseudococcus longispinus (Targoni Tozetti) feeding
JP2021511034A (ja) 除草剤耐性の増大した植物
US20230145729A1 (en) Indole diterpene biosynthesis
WO2022150489A1 (en) Optimization of small grain cereal forage and grain production via mutation of the tb1 and rht genes
White et al. Absence of free-cylindrospermopsin bioconcentration in water thyme (Hydrilla verticillata)

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 13794918

Country of ref document: EP

Kind code of ref document: A1

NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 13794918

Country of ref document: EP

Kind code of ref document: A1