WO2014058830A1 - Proteolytic inactivation of select proteins in bacterial extracts for improved expression - Google Patents
Proteolytic inactivation of select proteins in bacterial extracts for improved expression Download PDFInfo
- Publication number
- WO2014058830A1 WO2014058830A1 PCT/US2013/063804 US2013063804W WO2014058830A1 WO 2014058830 A1 WO2014058830 A1 WO 2014058830A1 US 2013063804 W US2013063804 W US 2013063804W WO 2014058830 A1 WO2014058830 A1 WO 2014058830A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- protein
- seq
- rfl
- omptl
- amino acids
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/195—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
- C07K14/24—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Enterobacteriaceae (F), e.g. Citrobacter, Serratia, Proteus, Providencia, Morganella, Yersinia
- C07K14/245—Escherichia (G)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/06—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies from serum
- C07K16/065—Purification, fragmentation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/32—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against translation products of oncogenes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/48—Hydrolases (3) acting on peptide bonds (3.4)
- C12N9/50—Proteinases, e.g. Endopeptidases (3.4.21-3.4.25)
- C12N9/52—Proteinases, e.g. Endopeptidases (3.4.21-3.4.25) derived from bacteria or Archaea
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12P—FERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
- C12P21/00—Preparation of peptides or proteins
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12P—FERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
- C12P21/00—Preparation of peptides or proteins
- C12P21/02—Preparation of peptides or proteins having a known sequence of two or more amino acids, e.g. glutathione
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
- C12Q1/00—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
- C12Q1/68—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving nucleic acids
- C12Q1/6844—Nucleic acid amplification reactions
- C12Q1/686—Polymerase chain reaction [PCR]
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
- C12Q1/00—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
- C12Q1/68—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving nucleic acids
- C12Q1/6876—Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes
- C12Q1/6888—Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes for detection or identification of organisms
- C12Q1/689—Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes for detection or identification of organisms for bacteria
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N30/00—Investigating or analysing materials by separation into components using adsorption, absorption or similar phenomena or using ion-exchange, e.g. chromatography or field flow fractionation
- G01N30/02—Column chromatography
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N30/00—Investigating or analysing materials by separation into components using adsorption, absorption or similar phenomena or using ion-exchange, e.g. chromatography or field flow fractionation
- G01N30/02—Column chromatography
- G01N30/04—Preparation or injection of sample to be analysed
- G01N30/06—Preparation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/50—Fusion polypeptide containing protease site
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y304/00—Hydrolases acting on peptide bonds, i.e. peptidases (3.4)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y304/00—Hydrolases acting on peptide bonds, i.e. peptidases (3.4)
- C12Y304/21—Serine endopeptidases (3.4.21)
Definitions
- the invention relates to cell free synthesis technology, and particularly to the proteolytic inactivation of select proteins in a bacterial extract.
- a preferred use is to increase the yield of polypeptides having a non-native amino acid incorporated at a defined amino acid residue.
- nnAA non-native amino acids
- One approach for producing polypeptides having a nnAA incoroporated at a defined amino acid residue is to use an nnAA, aminoacylated orthogonal CUA containing tRNA for introduction of the nnAA into the nascent polypeptide at an amber (stop) codon during protein translation.
- nnAA aminoacylated orthogonal CUA containing tRNA
- RFl is a termination complex protein that facilitates the termination of translation by recognizing the amber codon in an mRNA sequence.
- RFl recognition of the amber stop codon can promote pre-mature truncation products at the site of non-native amino acid incorporation, and thus decreased protein yield. Therefore, attenuating the activity of RFl may increase nnAA incorporation into recombinant proteins.
- nnAA incorporation can be increased by attenuating RFl activity in 3 ways: 1) neutralizing antibody inactivation of RFl, 2) genomic knockout of RFl (in an RF2 bolstered strain), and 3) site specific removal of RFl using a strain engineered to express RFl containing a protein tag for removal by affinity
- the present disclosure describes a novel method for inactivating RFl by introducing proteolytic cleavage sites into the RFl amino acid sequence.
- the cleavage sites are not accessible to the protease during bacterial cell growth, but are cleaved by the protease when the bacterial cells are lysed to produce cell- free extract.
- the yield of full length polypeptides having a nnAA incorporated at an amber codon is increased in bacterial cell extracts expressing modified RFl variants described herein.
- the present invention provides recombinant target proteins that are modified to comprise an Outer Membrane Protein Tl (OmpTl) protease cleavage site.
- the OmpTl cleavage site includes a scissile OmpTl peptide bond.
- the target protein is modified to introduce the OmpTl cleavage site into a surface exposed motif of the target protein. Because OmpTl cleaves substrates between dibasic residues with high efficiency, the native surface exposed motif is modified to include two adjacent basic amino acids that are positively charged at pH 7.0.
- the target protein can be an essential protein that is required, for example, for normal cell growth and/or survival.
- the surface exposed motif has a B factor of at least 50 A 2 when the motif region of the protein is uncomplexed. In some embodiments, surface exposed motif has a total solvent accessible surface area of between about 25 A 2 and about 225 A 2 .
- the target protein is modified such that the scissile OmpTl peptide bond is located in a position of the protein which exhibits a Phi angle of from 0° to -180° or a Psi angle from 0° to +180° in a Ramachadran Plot.
- the invention provides a bacterial cell expressing both OmpTl and an essential target protein recombinantly modified to include a scissile OmpTl peptide bond.
- the scissile OmpTl peptide bond is located within a surface exposed motif and the native motif is modified to include two adjacent basic amino acids that are positively charged at pH 7.0.
- the bacterial cell expresses an essential target protein recombinantly modified to include a scissile OmpTl peptide bond where the bond is in a position of the protein which is located within a surface exposed motif having a B factor of at least 50 A 2 when the protein is uncomplexed.
- the bacterial cell expresses an essential target protein recombinantly modified to include a scissile OmpTl peptide bond where the bond is in a position of the protein which is located within a surface exposed motif having a total solvent accessible surface area of between about 25 A 2 and about 225 A 2 .
- the bacterial cell expresses an essential target protein recombinantly modified to include a scissile OmpTl peptide bond where the bond is in a position of the protein which exhibits a Phi angle of from 0° to -180° or a Psi angle from 0° to +180° in a Ramachadran Plot.
- the bacterial cell is an E. coli.
- the essential target protein is selected from RF1, RF2, RNAse, thioredoxin reductase, glutarodoxin reductase, glutathione reductase, amino acid degrading enzymes, polyphosphate kinase, or cold shock proteins.
- the invention provides a method for reducing the deleterious activity of a modified essential target protein in an in vitro cell free synthesis system, the method comprising the steps of: i) culturing an OmpTl positive bacteria expressing the modified essential target protein said protein modified to include a scissile OmptTl peptide bond where the protein is modified to include two adjacent basic amino acids that are positively charged at pH 7.0;
- the scissile OmptTl peptide bond is located within a surface exposed motif having a B factor of at least 50 A 2 when the protein is uncomplexed. In some embodiments, the scissile OmpTl peptide bond is located within a surface exposed motif having a total solvent accessible surface area of between about 25 A 2 and about 225 A 2 . In some embodiments, the scissile OmpTl peptide bond is located in a position of the protein which exhibits a Phi angle of from 0° to -180° or a Psi angle from 0° to +180° in a Ramachadran Plot.
- the oxidative phosphorylation system of the bacteria remains active after cell lysis and during the synthesis of the protein of interest.
- the cell free synthesis system places a non-native amino acid at an amber codon of the protein of interest.
- the invention provides a functional Releasing Factor 1 protein (RFl) that is cleavable by an Outer Membrane Protein Tl (OmpTl), where a scissile OmpTl peptide bond is located within the switch loop region corresponding to amino acids 287-304 of wild type RFl (SEQ ID NO: 1) and where the switch loop region is modified to include two adjacent basic amino acids that are positively charged at pH 7.0.
- the two adjacent basic amino acids are independently selected from arginine and lysine.
- the switch loop region is modified to have three adjacent basic amino acids.
- the native asparagine at position 296 is substituted for one of the three adjacent basic amino acids.
- the functional, modified RFl protein is cleaved by OmpTl at a faster rate than the wild-type RFl .
- the cleavage activity of modified RFl by OmpTl is greater than 50% of the wild type RFl (SEQ ID NO:l) after 30 minutes at 30° C when the modified and wild-type proteins are present at a similar concentration in a cell- free extract from bacteria expressing OmpTl .
- the functional RFl that is cleavable by OmpTl contains an OmpTl cleavage peptide in the switch loop region.
- the invention provides a nucleic acid encoding a functional Releasing Factor 1 protein (RFl) that is cleavable by an Outer Membrane Protein Tl (OmpTl) where a scissile OmpTl peptide bond is located within the switch loop region of RFl corresponding to amino acids 287-304 of wild type RFl (SEQ ID NO:l) and where the switch loop region is modified to include two adjacent basic amino acids that are positively charged at pH 7.0.
- RFl functional Releasing Factor 1 protein
- OmpTl Outer Membrane Protein Tl
- the invention provides a method for reducing RFl competition at an amber codon in an in vitro cell free synthesis system, the method comprising the steps of: i) culturing an OmpTl positive bacteria expressing a functional Releasing Factor 1 protein (RFl) that is cleavable by an Outer Membrane Protein Tl (OmpTl)
- RFl functional Releasing Factor 1 protein
- the OmpTl positive bacteria is from E. coli.
- the oxidative phosphorylation system of the bacteria remains active after cell lysis and during the synthesis of the protein of interest.
- the cell free synthesis system places a non-native amino acid at the amber codon of the protein of interest.
- the invention provides a cell free synthesis system comprising, in a single reaction mixture: i) components from a bacterial lysate sufficient to translate a nucleic acid template encoding a protein;
- nucleic acid template encoding a protein of interest and having at least one amber codon
- RFl functional Releasing Factor 1
- OmpTl Outer Membrane Protein Tl
- a scissile OmpTl peptide bond is located within the switch loop region of RFl corresponding to amino acids 287-304 of wild type RFl (SEQ ID NO: 1) and where the switch loop region is modified to include two adjacent basic amino acids that are positively charged at pH 7.0.
- the cell free synthesis system reaction mixture further comprises a non-natural amino acid and corresponding amino acid synthetase, the synthetase able to charge the tRNA complimentary to the amber codon with the non-natural amino acid.
- the cell free synthesis system generates ATP via an active oxidative phosphorylation system.
- the invention provides a method for expressing protein in a cell-free synthesis system, comprising: i. combining a nucleic acid template with a bacterial extract comprising an RFl protein that has been cleaved by OmpTl at a scissile OmpTl peptide bond located within the switch loop region corresponding to amino acids 287-303 of wild type RFl (SEQ ID NO: 1) and where the switch loop region has been modified to include two adjacent basic amino acids that are positively charged at pH 7.0 under conditions that permit protein synthesis; and
- the invention provides a bacterial cell comprising a genomically integrated sequence coding for a functional RFl that is cleavable by OmpTl .
- Figure 1 shows that modified RFl protein variants containing OmpT cleavage sites have wild-type RFl activity when added to cell-free extracts lacking OmpT activity.
- exogenous RF-1 variants to reduce suppression (increase chain termination) when adding a non-native amino acid at an amber codon introduced at position S378 of the Fc protein (Fc_S378TAG) was determined.
- Figure 1(A) Lane 1 is a control extract with no exogenously added RFl . The extract contains wild-type RFl, which results in reduced amber suppression, producing a truncated Fc (lower band in gel).
- Lane 2 is a control extract containing exogenously added wild-type (WT) RFl . The addition of wild-type RFl results in a further reduction in amber suppression, which produces relatively more truncated Fc.
- Lanes 3-7 show cell-free extracts containing different RFl variants of the invention. All five variants possess RFl activity.
- Figure 1(B) shows the relative activity of RFl variants, where added WT RFl activity is set at 100 percent, and no added RFl is set at zero percent.
- Figure 2 shows that cell-free extracts from a bacterial strain engineered to express a modified RFl variant (A 18) produce a substantial increase in the yield of full-length IgG when nnAA were introduced at various positions of heavy chain, as compared to a bacterial strain expressing a wild-type RFl .
- 2(A) right panel SBHS016 extract (strain 16), containing intact OmpT and RFl variant A18.
- the band intensity of full-length (intact) IgG is stronger in strain 16 extract, indicating the incorporation of nnAA was substantially increased, with a decrease in truncated proteins.
- Figure 3 shows that cell-free extracts from a bacterial strain engineered to express a modified RFl variant (A 18) produce a substantial increase in amber suppression
- RF1+ (RFl positive) extract refers to RFl from strain 001 that is not cleaved by OmpT.
- RF1- (RFl negative) extract refers to RFl from strain 16 that is modified to include OmpT cleavage sites, and is thus degraded by OmpT activity.
- aminoacylation or “aminoacylate” refers to the complete process in which a tRNA is "charged” with its correct amino acid that is a result of adding an aminoacyl group to a compound.
- a tRNA that undergoes aminoacylation or has been aminoacylated is one that has been charged with an amino acid
- an amino acid that undergoes aminoacylation or has been aminoacylated is one that has been charged to a tRNA molecule.
- aminoacyl-tRNA synthetase or "tRNA synthetase” or “synthetase” or “aaRS” or “RS” refers to an enzyme that catalyzes a covalent linkage between an amino acid and a tRNA molecule. This results in a "charged" tRNA molecule, which is a tRNA molecule that has its respective amino acid attached via an ester bond.
- Codon refers to a group of 3 consecutive nucleotides in a nucleic acid template that specify a particular naturally occurring amino acid, non-native amino acid, or translation stop (polypeptide chain termination) signal. Due to the degeneracy of the genetic code, an amino acid can be specified by more than one codon.
- amber codon is a polypeptide chain-termination sequence (UAG) in RNA (TAG in DNA) that acts to terminate polypeptide translation in most organisms.
- the amber codon can also encode the proteinogenic amino acid pyrro lysine if the appropriate tRNA is charged by its cognate aminoacyl-tRNA synthetase.
- Amber codon tRNA or "amber suppressor tRNA” or “amber anti-codon tRNA” refers to a tRNA that binds to an amber codon.
- adjacent amino acids refers to amino acids that immediately precede or follow each other in the amino acid sequence of a polypeptide.
- amino acid at position two of a polypeptide's primary amino acid sequence is adjacent to amino acids at positions one and three.
- Tewo adjacent basic amino acids refers to one basic amino acid that immediately precedes or follows another basic amino acid in the primary amino acid sequence of a polypeptide.
- the basic amino acid Arg (R) at position 295 of the RFl amino acid sequence can be adjacent to a basic amino acid such as K or R introduced at position 296 of the RFl amino acid sequence.
- Bacterial derived cell free extract refers to preparation of in vitro reaction mixtures able to translate mRNA into polypeptides.
- the mixtures include ribosomes, ATP, amino acids, and tRNAs. They may be derived directly from lysed bacteria, from purified components or combinations of both.
- Cell-free synthesis system refers to the in vitro synthesis of polypeptides in a reaction mix comprising biological extracts and/or defined reagents.
- the reaction mix will comprise a template for production of the macromolecule, e.g. DNA, mRNA, etc.; monomers for the macromolecule to be synthesized, e.g. amino acids, nucleotides, etc.; and co-factors, enzymes and other reagents that are necessary for the synthesis, e.g. ribosomes, uncharged tRNAs, tRNAs charged with unnatural amino acids, polymerases, transcriptional factors, etc.
- cleavage activity is greater than 50% of the wild type RF1 refers to the cleavage rate of a modified protein described herein being greater than 50% of the cleavage rate of wild-type protein under specified conditions.
- the cleavage rate can be greater than 50% of the cleavage rate of wild-type protein after 30 minutes at 30° C when the modified and wild-type proteins are present at a similar concentration (e.g., a concentration of 0.1-1.0 micromolar) in a cell-free extract from bacteria expressing OmpT 1.
- the term "deleterious activity” refers to an activity that decreases the yield of proteins during protein synthesis in cell free extracts.
- the deleterious activity can inhibit cellular transcription and/or translation in cell free synthesis systems.
- the deleterious activity can include enzymatic reduction of GSSG that is required for efficient protein folding of disulfide bonded proteins produced in a cell-free synthesis reaction.
- the deleterious activity can also include premature chain termination by a releasing factor, such that polypeptide elongation is prematurely terminated at an introduced stop codon.
- a "target protein” is a protein that has been modified to include a protease cleavage site, or a protein that is modified to include a nnAA.
- An "essential target protein” is a protein that is required for normal growth and/or survival of a cell, such as a bacterial cell or eukaryotic cell.
- a "functional Releasing Factor 1 (RFl) protein” refers to RFl that retains activity equal to or substantially similar to wild-type or unmodified RFl protein. Functional RFl activity can be tested, for example, by measuring the growth rate of bacteria expressing the modified RFl protein, and comparing the growth rate to bacteria expressing wild-type or unmodified RFl . The functional activity of other proteins modified to contain OmpT cleavage sites can be similarly determined, for example, by measuring the growth rate of bacteria expressing the modified protein, and comparing the growth rate to bacteria expressing wild-type or unmodified protein.
- Functional RFl activity can also be tested, for example, by the ability of the modified RFl protein to reduce orthogonal tRNA incorporation of a nnAA at a specified position in an mRNA encoding a target protein, thereby increasing the amount of premature chain termination (i.e., increasing the amount of truncated protein).
- modified to include refers to amino acid substitutions, additions, or deletions in a protein or polypeptide sequence, or the corresponding substitutions, additions, or deletions in a nucleic acid sequence that encodes the modified protein.
- the modified protein can include amino acid substitutions that replace an equal number of amino acids from the wild-type protein sequence, amino acids added to the wild-type sequence, or amino acids deleted from the wild-type sequence.
- the protein can be modified to include basic amino acids that replace the wild-type amino acid(s) at the corresponding position in the amino acid sequence.
- the protein can also be modified to include amino acid sequences that are known protease cleavage sequences, such as OmpT cleavage sequences.
- Non-natural or “non-native” amino acid refers to amino acids that are not one of the twenty naturally occurring amino acids that are the building blocks for all proteins that are nonetheless capable of being biologically engineered such that they are incorporated into proteins.
- Non-native amino acids may include D-peptide enantiomers or any post- translational modifications of one of the twenty naturally occurring amino acids.
- a wide variety of non-native amino acids can be used in the methods of the invention.
- the non- native amino acid can be chosen based on desired characteristics of the non-native amino acid, e.g., function of the non-native amino acid, such as modifying protein biological properties such as toxicity, biodistribution, or half-life, structural properties, spectroscopic properties, chemical and/or photochemical properties, catalytic properties, ability to react with other molecules (either covalently or noncovalently), or the like.
- desired characteristics of the non-native amino acid e.g., function of the non-native amino acid, such as modifying protein biological properties such as toxicity, biodistribution, or half-life, structural properties, spectroscopic properties, chemical and/or photochemical properties, catalytic properties, ability to react with other molecules (either covalently or noncovalently), or the like.
- Non-native amino acids that can be used in the methods of the invention may include, but are not limited to, an non- native analogue of a tyrosine amino acid; an non-native analog of a glutamine amino acid; an non-native analog of a phenylalanine amino acid; an non-native analog of a serine amino acid; an non-native analog of a threonine amino acid; an alkyl, aryl, acyl, azido, cyano, halo, hydrazine, hydrazide, hydroxyl, alkenyl, alkynl, ether, thiol, sulfonyl, seleno, ester, thioacid, borate, boronate, phospho, phosphono, phosphine, heterocyclic, enone, imine, aldehyde, hydroxylamine, keto, or amino substituted amino acid, or any combination thereof; an amino acid with a photoactiva
- Nucleic acid template includes a DNA or RNA polynucleotide from which a polypeptide will be translated. It will be understood by those of skill in the art that a DNA nucleic acid template must first be transcribed into RNA, and that the RNA is translated into a polypeptide. DNA can be transcribed into RNA either in vivo or in vitro. The methods of in vitro transcription of a DNA template are well known in the art. In some embodiments, the DNA template is subject to simultaneous in vitro transcription and translation.
- OmpTl Outer Membrane Protein Tl
- OmpTl is a surface membrane serine protease and belongs to the omptin family of gram-negative bacteria. OmpTl is known to cleave antimicrobial peptides, activate human plasminogen, and degrade some heterologous recombinant proteins. OmpTl and its homo logs cleave synthetic substrates between dibasic residues with high catalytic efficiency. The cleavage of sequences containing dibasic residues has been shown to be important for the inactivation of antibiotic peptides and colicins, the proteolysis of bacterial membrane proteins in trans, and the degradation of recombinant proteins expressed E. coli. In the context of this invention, OmpTl has certain advantages in that it is located on the outer membrane of the cell, and thus is not in contact with potential substrate proteins that are located inside the intact bacterial cell.
- oxidative phosphorylation system of the bacteria remains active refers to a bacterial lysate that exhibits active oxidative phosphorylation during protein synthesis.
- the bacterial lysate can generate ATP using ATP synthase enzymes and reduction of oxygen.
- other translation systems known in the art can also use an active oxidative phosphorylation during protein synthesis.
- the activation of oxidative phosphorylation can be demonstrated by inhibition of the pathway using specific inhibitors, such as electron transport chain inhibitors.
- Translation refers to the process whereby an RNA template is converted into a polypeptide containing natural and/or non-native amino acids, and is well known in the art. Translation involves the initiation step, whereby a ribosome attaches to the RNA template, generally at the FMet codon (e.g., AUG), and the elongation step, whereby the anticodon of a charged tRNA molecule is paired with a codon in the RNA template, this step being repeated as the ribosome moves down the RNA template. As each tRNA anticodon is paired with its corresponding codon, the amino group of the amino acid charged to each tRNA molecule is covalently linked to the carboxyl group of the preceding amino acid via peptide bonds.
- FMet codon e.g., AUG
- translation also involves the termination step, whereby the ribosome encounters a translation stop codon, thus ending chain elongation and release of the polypeptide from the ribosome.
- the RNA template can comprise an ORF having an amber stop codon UAG, which is recognized by the anti-codon CUA of a tRNA charged with a nnAA. Therefore, in the present methods, the amber codon does not necessarily function to terminate translation.
- “Translation system” refers to a mixture of components that is able to translate mRNA into polypeptides in vitro.
- a translation system can be a cell free extract, reconstituted cell lysate, or a purified mixture of components that is able to translate mRNA into polypeptides in vitro.
- the cell free extract or cell lysate used in the methods described herein can be derived from Escherichia coli (E. coli).
- the translation system can also comprise a purified and reconstituted in vitro translation system.
- the methods described herein can also utilize a translation system that exhibits active oxidative phosphorylation during protein synthesis.
- the translation system can generate ATP using ATP synthetase enzymes.
- the translation system can also comprise at least one nucleic acid template.
- the nucleic acid template can be simultaneously transcribed and translated into protein using the translation system.
- Reconstituted ribosomal translation system refers to a mixture of purified components which is capable of translating a nucleic acid molecule such as mRNA in vitro, as described in Tan et al, Methods 36, 279-290 (2005), and Forster et al, U.S. Patent No. 6,977,150, which are incorporated by reference herein in their entirety.
- a "scissile OmpTl peptide bond” is a peptide bond that is capable of being cleaved by OmpTl .
- a "surface exposed motif is a domain that is present on the outside of a protein molecule. Surface exposed motifs are generally more accessible to proteolytic cleavage, for example by a serine protease such as OmpTl .
- a surface exposed motif can be defined in several ways. For example, a surface exposed motif often lacks secondary structure, such as alpha helix or beta sheet. Further, surface exposed motifs often do not share a significant amount of amino acid sequence homology, even between homologous protein sequences. However, one of skill in the art can calculate relative surface accessible area for regions of a protein of interest using the GetArea algorithm embedded in pymol molecular modeling software (See the internet at
- a "surface exposed motif having a B factor of at least 50 A 2 " refers to the mobility of individual atoms in the surface exposed motif. Atoms in surface exposed motifs can have more mobility than atoms in the core of a protein. B-factors generally indicate the relative vibrational motion of different parts of a structure, such as a protein. Atoms with low B- factors belong to a part of the protein that is well-ordered and thus have relatively low mobility. Atoms with large B-factors generally belong to part of the protein that is relatively flexible, and thus have relatively high mobility.
- the higher the B-factor, the more likely that positional errors of an individual atom in a protein structure will be observed. For example, a B factor of between 40 and 60 suggests that positional errors up to 1.0 Angstrom can be observed. A B-factor of greater than 60 suggests that the atom is not likely to be within 1.0 Angstrom of its observed position. ⁇ See, e.g., the internet at wiki.cmbi.ru.nl/index.php/B- factor). The B-factor is calculated as: ⁇ 8 ⁇ 2 ⁇ 2
- the B-factor is measured in units of A 2 .
- Ramachandran Plot refers to a method for visualizing backbone dihedral angles ⁇ (Psi) versus ⁇ (Phi) for each amino acid residue in a protein structure. Methods for calculating Phi and Psi angles are described, e.g., in Lovell, S.C. et al, Proteins: Structure, Function, and Genetics, 50:437-450 (2003), and Chen, V.B. et al, MolProbity: all-atom structure validation for macromolecular crystallography, Acta Crystallographica D66: 12-21 (2010).
- total solvent accessible surface area refers to the surface area of a protein or polypeptide that is accessible to a solvent.
- Solvent accessible surface area can be described in units of square angstroms, and can be calculated using the 'rolling ball' algorithm developed by Shrake & Rupley (Shrake, A; Ru ley, JA. (1973). "Environment and exposure to solvent of protein atoms. Lysozyme and insulin”. JMol Biol 79 (2): 351-71.).
- Solvent accessible surface area can also be calculated as described in Fraczkiewicz, R. and Braun, W., "Exact and efficient analytical calculation of the accessible surface areas and their gradients for macromolecules," J. Comp.
- switch loop region refers to a surface exposed motif that links domains three and four of RFl and forms a rigid connection that places the GGQ motif of domain 3 in contact with the peptidyl-tRNA ester linkage in the peptidyl transferase center (PTC) of the 50S subunit.
- PTC peptidyl transferase center
- the switch loop region of RFl corresponds to amino acids 287 to 304 of SEQ ID NO: l, and comprises the following amino acid sequence: 287-QQAEASTRRNLLGSGDRS-304 (SEQ ID NO:4).
- a wild-type protein is an unmodified protein having the amino acid sequence and/or functional activity of a native or naturally occurring protein.
- a wild-type RFl protein can have the sequence of SEQ ID NO: 1.
- a "control protein” can be a wild-type protein or a previously modified protein.
- Native amino acid refers to one or more naturally occurring amino acids encoded by the genetic code.
- An “endogenous native amino acid” refers to a native amino acid produced by the host cells used to generate the lysate.
- nnAA Non-native amino acids
- nucleic acids or polypeptide sequences refer to two or more sequences or subsequences that are the same or have a specified percentage of nucleotides or amino acid residues that are the same (e.g., 60% identity, optionally 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97% or 99% identity over a specified region), when compared and aligned for maximum correspondence over a comparison window, or designated region, as measured using the BLAST and PSI-BLAST algorithms, which are described in Altschul et al. (J. Mol. Biol. 215 :403- 10, 1990), and Altschul, et al. (Nucleic Acids Res., 25:3389-3402, 1997), respectively.
- Software for performing BLAST analyses is publicly available through the National Center for
- HSPs high scoring sequence pairs
- Cumulative scores are calculated using, for nucleotide sequences, the parameters M (reward score for a pair of matching residues; always >0) and N (penalty score for mismatching residues; always ⁇ 0).
- M forward score for a pair of matching residues; always >0
- N penalty score for mismatching residues; always ⁇ 0.
- a scoring matrix is used to calculate the cumulative score. Extension of the word hits in each direction are halted when: the cumulative alignment score falls off by the quantity X from its maximum achieved value; the cumulative score goes to zero or below, due to the accumulation of one or more negative- scoring residue alignments; or the end of either sequence is reached.
- the BLAST algorithm parameters W, T, and X determine the sensitivity and speed of the alignment.
- W wordlength
- E expectation
- BLASTP program uses as defaults a wordlength of 3, and expectation (E) of 10, and the BLOSUM62 scoring matrix (see Henikoff and Henikoff, Proc. Natl. Acad. Sci. USA
- Percentage of sequence identity is determined by comparing two optimally aligned sequences over a comparison window, wherein the portion of the polynucleotide or polypeptide sequence in the comparison window may comprise additions or deletions (i.e., gaps) as compared to the reference sequence (which does not comprise additions or deletions) for optimal alignment of the two sequences. The percentage is calculated by determining the number of positions at which the identical nucleic acid base or amino acid residue occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the window of comparison and multiplying the result by 100 to yield the percentage of sequence identity.
- a “comparison window,” as used herein, includes reference to a segment of any one of the number of contiguous positions selected from the group consisting of from 20 to 600, usually about 50 to about 200, more usually about 100 to about 150 in which a sequence may be compared to a reference sequence of the same number of contiguous positions after the two sequences are optimally aligned. Methods of alignment of sequences for comparison are well known in the art. [0057] The BLAST algorithm also performs a statistical analysis of the similarity between two sequences (see, e.g., Karlin and Altschul, Proc. Natl. Acad. Sci. USA 90:5873-87, 1993).
- BLAST algorithm One measure of similarity provided by the BLAST algorithm is the smallest sum probability (P(N)), which provides an indication of the probability by which a match between two nucleotide or amino acid sequences would occur by chance.
- P(N) the smallest sum probability
- a nucleic acid is considered similar to a reference sequence if the smallest sum probability in a comparison of the test nucleic acid to the reference nucleic acid is less than about 0.2, typically less than about 0.01, and more typically less than about 0.001.
- a conservative substitution is given a score between zero and 1.
- the scoring of conservative substitutions can be calculated using the algorithm described in Pearson et al. (Meth. Mol. Biol. 24:307-331, 1994). Alignment also can be performed by simple visual inspection and manual alignment of sequences.
- each polynucleotide sequence disclosed herein as encoding a protein variant also describes every possible silent variation. It will also be recognized that each codon in a polynucleotide, except AUG, which is ordinarily the only codon for methionine, and UUG, which is ordinarily the only codon for tryptophan, can be modified to yield a functionally identical molecule by standard techniques. Accordingly, each silent variation of a polynucleotide that does not change the sequence of the encoded polypeptide is implicitly described herein.
- Two or more amino acid sequences or two or more nucleotide sequences are considered to be “substantially similar” if the amino acid sequences or the nucleotide sequences share at least 50%, 60%, 70%, 80%, 90%, 95% or 99% sequence identity with each other, or with a reference sequence over a given comparison window.
- Two or more proteins are also considered substantially similar if they incorporate conservative amino acid substitutions providing functionally similar amino acids into the amino acid sequence.
- Promoter refers to sequence elements in the nucleic acid template located upstream or downstream from the start of transcription. Promoter sequences are involved in recognition and binding of R A polymerase and other proteins that initiate transcription. Examples of promoters include T7, SP6 and T3 bacteriophage promoters.
- 5 ' untranslated region refers to the nucleic acid sequence located upstream or 5 ' of the open reading frame in a nucleic acid template. In RNA, the 5' untranslated region precedes the translation start codon present in the nucleic acid template. In DNA, the 5' untranslated region refers to nucleic acid sequences that are transcribed into RNA and are located 5 ' to the translation start codon. In DNA, the translation start codon is typically ATG, and in RNA the translation start codon is typically AUG.
- Primary amino acid sequence refers to the order of amino acid residues that are joined together by peptide bonds into a polypeptide. The order of amino acid residues is generally referenced starting at the amino terminal end of the polypeptide and proceeding to the carboxy terminal end of the polypeptide. The primary amino acid sequence is determined by the nucleotide sequence of RNA codons in the nucleic acid template.
- Open reading frame refers to the nucleotide sequence of a nucleic acid template that is translated into a polypeptide of interest.
- the open reading frame (ORF) can include at least one codon corresponding to a defined amino acid residue that binds to a tRNA charged with a nnAA.
- the at least one codon can be an amber codon.
- tRNA or "transfer RNA” refers to a small RNA molecule that transfers a specific amino acid to a growing polypeptide chain at the ribosomal site of protein synthesis during translation. tRNAs contain a three base codon that pairs to the corresponding mRNA codon. As a result of the degeneracy of the genetic code, an amino acid can associate with multiple tRNAs, while each type of tRNA molecule can only associate with one type of amino acid.
- polypeptide and “protein” are used interchangeably, and refer to a compound containing two or more amino acids joined by peptide bonds. Proteins can contain one or more polypeptide chains.
- the term "when the protein is uncomplexed” refers to the structure of a protein in solution, or a portion, region or domain of the structure of the protein in solution, and not the structure of the protein, or portion, region or domain of the structure of the protein, when it is part of a complex with other molecules such as proteins, ligands, enzyme substrate or inhibitor complexes, ribosomes, bound antibodies or antibody fragments, RNA, and DNA.
- the term also refers to the structure of a protein domain, such as the amino acids comprising a surface exposed motif, that is in solution.
- the term "about,” when modifying any amount, refers to the variation in that amount typically encountered by one of skill in the art, e.g., in protein synthesis or X-ray crystallography experiments.
- the term “about” refers to the normal variation encountered in measurements for a given analytical technique, both within and between batches or samples.
- the term about can include variation of 1-10% of the measured value, such as 5% or 10% variation.
- the amounts disclosed herein include equivalents to those amounts, including amounts modified or not modified by the term "about.”
- the present invention provides target proteins that are recombinantly modified to include OmpTl protease cleavage sites that are capable of being cleaved by OmpTl .
- the OmpTl cleavage site includes a scissile OmpTl peptide bond.
- the target protein is modified to include two adjacent basic amino acids that are positively charged at pH 7.0.
- the target protein is modified to introduce the OmpTl cleavage site into a surface exposed motif of the target protein.
- the scissile OmpTl peptide bond is located in a surface exposed motif having a B factor of at least 50 A 2 when the protein or the surface exposed motif is uncomplexed (i.e., free in solution and/or not part of a macromolecular structure comprising other molecules). In some embodiments, the scissile OmpTl peptide bond is located in a surface exposed motif having a total solvent accessible surface area (SASA) of between about 25 A 2 and about 225 A 2 .
- SASA total solvent accessible surface area
- the target protein is modified such that the scissile OmpTl peptide bond is located in a position of the protein which exhibits a Phi angle of from 0° to -180° or a Psi angle from 0° to +180° in a Ramachadran Plot.
- a homology model can be made using similar structures to predict a SASA of between about 25 A 2 and about 225 A 2 , or a Phi angle of from 0° to -180° or a Psi angle from 0° to +180° in a Ramachadran Plot, in the absence of structural information.
- the invention further provides a bacterial cell that express both OmpTl and the recombinantly modified target protein.
- the recombinantly modified target protein is an essential protein, for example, a protein that is required for normal cell growth and/or survival.
- the target proteins described herein are selected because they have deleterious activity in an in vitro cell-free synthesis system.
- the target protein can inhibit transcription and/or translation of nucleic acid templates that encode proteins of interest.
- the invention provides methods for reducing the deleterious activity of a modified essential target protein in an in vitro cell-free synthesis system by inactivating the target protein with an OmpTl protease.
- the method comprises culturing an OmpTl positive bacteria expressing the modified essential target protein, where the target protein is modified to include an OmpTl cleavage site comprising a scissile OmpTl peptide bond in a surface exposed motif; lysing the bacteria to create a cell free synthesis extract; contacting the modified essential target protein with OmpTl in an amount sufficient to reduce the amount of intact target protein by 50%; adding a nucleic acid template to the extract, where the template codes for a protein of interest; and allowing the cell free synthesis system to produce the protein of interest.
- the method takes advantage of the spatial separation of the modified target protein and the OmpTl protease during cell growth, when the target protein may be important for cell growth and/or survival, whereas the target protein is cleaved by OmpTl when the bacterial cells are disrupted and lysed to produce a cell-free extract.
- the scissile OmptTl peptide bond is located within a surface exposed motif having a B factor of at least 50 A 2 when the protein or the surface exposed motif is uncomplexed.
- the surface exposed motif can have a B factor of 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 110, 120, 130 ,140, 150, 160, 170, 180, 190, or 200 A 2 or greater, or can be in a range of between about 50 and about 200 A 2 , between about 50 and about 150 A 2 , between about 50 and about 100 A 2 , between about 60 and about 200 A 2 , between about 60 and about 150 A 2 , or between about 60 and about 100 A 2 .
- the scissile OmptTl peptide bond is located within a surface exposed motif having a total solvent accessible surface area of between about 25 A 2 and about 225 A 2 .
- the total solvent accessible surface area is about 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 110, 120 ,130, 140, 150, 160, 170, 180, 190, 200, 210, 220, or 225 A 2 (where the term "about” modifies each of the preceding values).
- the scissile OmptTl peptide bond is located in a position of the protein which exhibits a Phi angle of from 0° to -180° or a Psi angle from 0° to +180° in a Ramachadran Plot.
- a homology model can be made using similar structures to predict a SASA of between about 25 A 2 and about 225 A 2 , or a Phi angle of from 0° to - 180° or a Psi angle from 0° to + 180° in a Ramachadran Plot.
- the proteins of interest referred to above include proteins that are engineered to incorporate non-native amino acids (nnAA) at a defined location of the amino acid sequence.
- nnAA non-native amino acids
- the introduction of nnAA into proteins can result in proteins with preferred properties.
- One method for introducing nnAA into proteins or polypeptides of interest uses aminoacylated orthogonal tRNAs that recognize an amber (stop) codon for introducing the nnAA into the nascent polypeptide chain during protein translation.
- stop amber
- the yield of proteins having nnAA introduced therein can be decreased by proteins of the translation termination complex that facilitate the termination of translation by recognizing the termination or stop codons in an mRNA sequence.
- Release Factor 1 is part of the termination complex, and recognizes the UAG (amber) stop codon. RFl recognition of the amber codon can promote pre-mature chain termination at the site of nnAA incorporation, which reduces the yield of desired proteins.
- the methods described herein solve this problem by decreasing the functional activity of RFl in bacterial cell lysates.
- the essential target protein is RFl .
- the functional activity of RFl is decreased by introducing OmpTl protease cleavage sites into RFl .
- OmpTl is an enzyme located on the outer cell membrane of intact bacteria. Thus, the modified RFl is not available as a substrate for OmpTl in intact cells.
- the OmpTl enzyme When the bacterial membrane is disrupted, for example, as in a bacterial lysate, the OmpTl enzyme is able to contact and cleave the modified RFl at the introduced cleavage site, thereby decreasing the functional activity of RFl .
- the methods are applicable to other releasing factors found in the translation termination complex, such as RF2, which recognizes the UGA stop codon.
- the methods are also applicable to proteins that degrade mRNA during in vitro translation, such as RNase enzymes. Further, the methods are generally applicable to any protein in a bacterial extract that inhibits transcription and/or translation of a protein of interest.
- PCR amplification methods are well known in the art and are described, for example, in Innis et al., PCR Protocols: A Guide to Methods and Applications, Academic Press Inc. San Diego, Calif, 1990.
- An amplification reaction typically includes the DNA that is to be amplified, a thermostable DNA polymerase, two oligonucleotide primers,
- dNTPs deoxynucleotide triphosphates
- reaction buffer Typically a desirable number of thermal cycles is between 1 and 25.
- Methods for primer design and optimization of PCR conditions are well known in the art and can be found in standard molecular biology texts such as Ausubel et al, Short Protocols in Molecular Biology, 5 Edition, Wiley, 2002, and Innis et al, PCR Protocols, Academic Press, 1990. Computer programs are useful in the design of primers with the required specificity and optimal amplification properties (e.g., Oligo Version 5.0 (National Biosciences)). In some
- the PCR primers may additionally contain recognition sites for restriction endonucleases, to facilitate insertion of the amplified DNA fragment into specific restriction enzyme sites in a vector. If restriction sites are to be added to the 5' end of the PCR primers, it is preferable to include a few (e.g., two or three) extra 5' bases to allow more efficient cleavage by the enzyme.
- the PCR primers may also contain an RNA polymerase promoter site, such as T7 or SP6, to allow for subsequent in vitro transcription. Methods for in vitro transcription are well known to those of skill in the art (see, e.g., Van Gelder et al, Proc. Natl. Acad. Sci. U.S.A. 87: 1663-1667, 1990; Eberwine et al, Proc. Natl. Acad. Sci. U.S.A. 89:3010-3014, 1992).
- the present invention provides target proteins that are capable of being cleaved and inactivated by proteolytic enzymes such as OmpTl .
- the proteins are modified to introduce proteolytic cleavages sites into the protein.
- the cleavage site introduced into the modified target protein is a scissile OmpTl peptide bond, and the scissile OmpTl is introduced into a surface exposed motif of the target protein.
- the cleavage site recognized by OmpTl comprises two adjacent basic residues.
- the target proteins described herein are modified to comprise two adjacent basic residues that are positively charged at pH 7.0.
- the target protein is modified to introduce the scissile
- the location of a surface exposed motif having a B factor of at least 50 A 2 can be determined in several ways. B-factors are given for each atom in crystallographic Protein Data Bank (PDB) files.
- the B factor of a surface exposed motif can be calculated using the GetArea algorithm embedded in pymol molecular modeling software (See the internet at
- the random coil index may be used in place of a large B-factor (See Berjanskii, M.V., et al.,
- the B-factors from X-ray crystallographic structures of the protein can be mapped to the amino acid sequence, and the sequence recombinantly modified to include a scissile OmptTl peptide bond at site(s) with large B-factors.
- the recombinantly modified target protein can then be tested for degradation of the protein in a cell-extract containing OmpTl .
- the B factor is at least 50, 60, 70, 80, 90 or 100 A 2 .
- the B factor is between about 50 and about 200 A 2 , or between about 50 and about 150 A 2 , or between about 50 and 120 A 2 . It is understood that ranges described herein include all values in between the end points.
- the target protein is modified to introduce the scissile OmpTl peptide bond into a surface exposed motif having a total solvent accessible surface area of between about 25 A 2 and about 225 A 2 .
- the location of a surface exposed motif having a total solvent accessible surface area of between about 25 A 2 and about 225 A 2 can be determined using methods known in the art. For example, the software routine
- GETAREA can be used to locate solvent-exposed vertices of intersecting atoms, as described in Fraczkiewicz, R. and Braun, W., "Exact and efficient analytical calculation of the accessible surface areas and their gradients for macromolecules," J. Comp. Chem., 19, 319- 333 (1998).
- solvent accessible surface area solvation energy
- the target protein is modified to introduce the scissile OmpTl peptide bond in a position of the protein which exhibits a Phi angle of from 0° to - 180° or a Psi angle from 0° to +180° in a Ramachadran Plot.
- the location of the position in a protein which exhibits a Phi angle of from 0° to -180° or a Psi angle from 0° to +180° in a Ramachadran Plot can be determined using methods known in the art. Methods for calculating Phi and Psi angles are described, e.g., in Lovell, S.C.
- the modified proteins described herein are selected because they can inhibit production of proteins in cell-free synthesis systems.
- the modified proteins described herein decrease the production of full length proteins in bacterial cell-free extracts.
- the proteins RFl and RF2 are part of the termination complex that recognizes a stop codon in the mRNA and terminates translation of the polypeptide chain. Premature termination of translation is undesirable when incorporating non-native amino acids into a protein using cell free translation systems as described herein. Reducing recognition of the stop codon by the termination complex can increase the yield of proteins incorporating nnAA.
- the RFl and/or RF2 protein, or a function homo log thereof is modified to contain OmpTl cleavage sites in a surface exposed motif having a B Factor of at least 50 A 2 when the RFl and/or RF2 protein, or functional homo log thereof, is uncomplexed.
- the RFl and/or RF2 protein, or a function homo log thereof is modified to contain OmpTl cleavage sites in a surface exposed motif having a total solvent accessible surface area of between about 25 A 2 and about 225 A 2 .
- the RFl and/or RF2 protein, or a function homolog thereof is modified to contain OmpTl cleavage sites in a position of the protein which exhibits a Phi angle of from 0° to -180° or a Psi angle from 0° to +180° in a Ramachadran Plot.
- the functional modified protein is substantially similar to RFl (SEQ ID NO: l) or RF2 (SEQ ID NO:2).
- the RFl protein includes the RFl wildtype prototype protein (SEQ ID NO: 1) from E.coli as well as polymorphic variations and recombinantly created muteins.
- RFl proteins are defined as having substantially the same biological activity or functional capacity as the wild type (e.g., at least 80% of either), have at least 60%, 70%, 80%, 90% or 95% sequence identity to the prototype protein RFl, and/or bind to polyclonal antibodies generated against the prototype protein SEQ ID NO: 1.
- the RFl protein will bind under designated immunoassay conditions to the specified antibodies with a specificity at least two times the background, where the antibodies do not substantially bind in a significant amount to other proteins present in the sample.
- polyclonal antibodies raised to RFl SEQ ID NO: l
- iso forms or portions thereof can be selected to obtain only those polyclonal antibodies that are specifically immunoreactive with RFl and not with other proteins, except for polymorphic variants of RF 1.
- a variety of immunoassay formats may be used to select antibodies specifically immunoreactive with a particular protein.
- solid-phase ELISA immunoassays are routinely used to select antibodies specifically immunoreactive with a protein ⁇ see, e.g., Harlow & Lane, Antibodies, A Laboratory Manual (1988) for a description of immunoassay formats and conditions that can be used to determine specific immunoreactivity).
- a specific or selective reaction will be at least twice background signal or noise and more typically more than 10 to 100 times background.
- RFl was successfully modified to introduce functional OmpTl cleavage sites in a surface exposed motif.
- the introduction of putative dibasic OmpTl cleavage sites into RFl did not always result in a protein that could be efficiently cleaved by OmpTl .
- the single amino acid substitutions M74R, E76K, E84K, A85R, E87R, E108R, T293R and S304K were introduced into the loop regions of RFl beside an existing Arg or Lys, thereby creating dibasic cleavage sites.
- these variants were not efficiently cleaved when the RFl variants were expressed in OmpT positive cell extracts.
- the present invention therefore provides the unexpected result that proteins such as RFl can be modified such that the protein is capable of being cleaved by a protease such as OmpTl .
- the introduced cleavage site can be cleaved by an enzyme with OmpTl-like enzyme activity, where the enzyme activity results from a functional homo log or fragment of OmpTl, or from a protein that is modified to have OmpTl -like activity.
- the proteins described herein can also contain endogenous OmpTl protease cleavage sites.
- the unmodified or wild-type protein contains a dibasic amino acid sequence comprising a scissile OmpTl peptide bond that is cleavable by OmpTl .
- Cleavage of the protein by OmpTl can be tested by incubating the purified protein with bacterial cell-free extracts that express OmpTl, and comparing the amount of cleavage therein with the amount of cleavage detected in cell-free extracts that do not express OmpTl .
- the unmodified proteins containing endogenous OmpTl cleavage sites are necessary or required for normal cell growth or function, but inhibit the translation of proteins in cell-free extracts.
- the invention provides methods for selectively inactivating unmodified proteins by cleavage with OmpTl, where the timing of inactivation can be controlled such that the proteins are functional during cell growth, but are inactivated in cell-extracts expressing OmpTl .
- templates for the invention are used to produce the proteins modified to comprise a scissile OmpTl cleavage site. Templates for the invention are also used to produce proteins of interest that are expressed in cell-free systems.
- the templates for cell- free protein synthesis can be either mR A or DNA.
- the template can comprise sequences for any particular gene of interest, and may encode a full-length polypeptide or a fragment of any length thereof.
- Nucleic acids that serve as protein synthesis templates are optionally derived from a natural source or they can be synthetic or recombinant.
- DNAs can be recombinant DNAs, e.g., plasmids, viruses or the like.
- the DNA template comprises an ORF encoding a target protein comprising an OmpTl cleavage site.
- the ORF can encode a modified target protein that is required for normal cell growth and survival, but whose activity decreases the yield of proteins in cell-free extracts, either directly or indirectly.
- the ORF may encode a protein component of the termination complex, such as RF1 or RF2 or modified variants thereof.
- the ORF may also encode an RNase that degrades RNA templates.
- the DNA template comprises an ORF encoding a protein of interest that is modified to incorporate a non-native amino acid.
- the ORF may encode any protein having biological importance that incorporates a nnAA at a defined position of the amino acid sequence.
- Non-limiting examples of such proteins of interest include antibodies, hormones, cytokines, and viral proteins.
- the invention uses sense codons for the incorporation of non-native amino acids, and circumvents the requirement of orthogonal components as is commonly found in the art.
- the ORF comprises at least one isoaccepting sense codon.
- the ORF further comprises one codon corresponding to a defined amino acid residue that recognizes a tRNA charged with a non-native amino acid.
- the ORF comprises an amber codon (UAG) that binds a tRNA charged with a non-native amino acid.
- UAG amber codon
- the template is capable of translating a complete and functional protein regardless of whether non-native amino acids are chosen to be incorporated into the protein of interest.
- a DNA template that comprises the ORF of interest will be operably linked to at least one promoter and to one or more other regulatory sequences including without limitation repressors, activators, transcription and translation enhancers, DNA-binding proteins, etc.
- Suitable quantities of DNA template for use herein can be produced by amplifying the DNA in well known cloning vectors and hosts, or by polymerase chain reaction (PCR).
- the DNA template can further comprise the ORF of interest joined in frame to nucleic acid sequences that encode amino acid sequences that are useful for isolating and purifying the expressed protein, such as poly-amino acid tags that bind with high affinity to chromatography media.
- the poly-amino acid tag can be located at the 5 ' end or 3 ' end of the ORF, resulting in an amino-terminal or carboxyl terminal tag in the expressed protein, respectively.
- the ORF is joined in frame to sequences that encode a poly- Histidine tag.
- a DNA template can be constructed for bacterial expression by operably linking a desired protein-encoding DNA to both a promoter sequence and a bacterial ribosome binding site (Shine-Delgarno sequence).
- Promoters suitable for use with the DNA template in the cell-free transcription-translation methods of the invention include any DNA sequence capable of promoting transcription in vivo in the bacteria from which the bacterial extract is derived. Preferred are promoters that are capable of efficient initiation of transcription within the host cell.
- DNA encoding the desired protein and DNA containing the desired promoter and Shine-Dalgarno (SD) sequences can be prepared by a variety of methods known in the art. Alternatively, the desired DNA sequences can be obtained from existing clones or, if none are available, by screening DNA libraries and constructing the desired DNA sequences from the library clones.
- RNA templates encoding the protein of interest can be conveniently produced from a recombinant host cell transformed with a vector constructed to express a mRNA with a bacterial ribosome binding site (SD sequence) operably linked to the coding sequence of the desired gene such that the ribosomes in the reaction mixture are capable of binding to and translating such mRNA.
- SD sequence bacterial ribosome binding site
- the vector carries any promoter capable of promoting the transcription of DNA in the particular host cell used for RNA template synthesis.
- RNA template can be conveniently isolated in a total cellular RNA fraction extracted from the host cell culture. Total cellular RNA can be isolated from the host cell culture by any method known in the art. The desired RNA template can be isolated along with most of the cellular mRNA if the RNA template is designed to contain at its 3' end a polyadenylation signal recognized by the eukaryotic host cell.
- the host cell will produce the RNA template with a polyadenylate (poly(A)) tail.
- Polyadenylated mRNAs can be separated from the bulk of cellular RNA by affinity chromatography on oligodeoxythymidylate (oligo (dT))- cellulose columns using any methods known in the art. If the size of the mRNA encoding the desired protein is known, the mRNA preparation can be further purified for mRNA molecules of the particular size by agarose gel electrophoresis of the RNA.
- the template is used to express the recombinant target protein comprising an OmpTl cleavage site in a cell, or to synthesize a modified recombinant target protein in a cell-free translation system.
- the template can be added to a cell lysate under conditions sufficient to translate the template into protein.
- the cell lysate can be from bacterial cells or eukaryotic cells.
- the expressed protein can then be purified using methods known in the art, as described below.
- Proteins containing OmpTl cleavage sites can be purified as is standard in the art. Proteins of the invention can be recovered and purified by methods including, but not limited to, ammonium sulfate or ethanol precipitation, acid or base extraction, column
- proteins comprising N- terminal Histidine tags can be purified using affinity media containing metal ions such as nickel and cobalt. The affinity media is then washed to remove unbound protein, and the bound proteins eluted and recovered.
- the poly-histidine tagged proteins are purified using Immobilized Metal Affinity Chromatography (IMAC).
- IMAC Immobilized Metal Affinity Chromatography
- HPLC high performance liquid chromatography
- proteins containing OmpTl cleavage sites can possess a conformation different from the desired conformations of the relevant polypeptides.
- the purified proteins can be subjected to conditions that result in the preferred protein conformation.
- a variety of purification/protein folding methods are known in the art, e.g.,
- modified proteins can be important for the modified proteins to have biological activity comparable to an unmodified, wild-type protein.
- the protein to be modified is important for normal growth of bacteria, it is desirable to retain the normal activity levels of the protein until the cells are lysed to produce the cell-free lysate for translation.
- the methods of the present invention provide for modified proteins containing OmpTl cleavage sites that have biological activity comparable to the native or wild-type protein.
- Modified proteins that retain wild- type levels of activity, or activity levels that are comparable to wild-type are referred to herein as a functional proteins.
- a modified protein is comparable to a wild-type protein if the specific activity as thus defined is at least about 50% of the wild-type protein, or at least about 60%, about 70%>, about 80%>, about 90%> or greater than that of the wild-type protein. See, e.g., Sambrook et al., Molecular Cloning: A Laboratory Manual (Cold Spring Harbor Press, Cold Spring Harbor, N.Y. 1989).
- modified proteins can be tested in a variety of ways. For example, the growth rate of bacteria expressing the modified protein can be compared to the growth rate of bacteria expressing a wild-type, control or unmodified protein.
- the functional activity of modified proteins can also be tested by determining the ability of the modified protein to terminate translation at a stop codon in the mR A template. Termination of translation results in truncated proteins, and thus the relative activities of modified proteins can be quantitated by measuring the amount of truncated and full length protein, and comparing the ratio of truncated to full length protein with that resulting from wild-type protein, as described in the Examples and shown in Figure 1.
- a modified protein has comparable activity to a wild-type protein if the ratio of truncated to full length protein is at least about 50%, 60%, 70%, 80%, 90%, 95%, or greater than the ratio of truncated to full length protein using a wild-type protein.
- the modified proteins are tested to determine that they are cleaved by OmpTl .
- One method for testing that the modified proteins of the invention are cleaved by OmpTl is to add recombinant protein containing OmpTl cleavage sites to a cell-free extract containing functional OmpTl . If the modified protein is cleaved by OmpTl, it will migrate at an apparent lower molecular weight than the intact protein during gel electrophoresis (e.g., SDS-PAGE).
- the modified protein can be detected by including a radioactive label such as 14 C in the translation reaction under conditions suitable for incorporation of the radioactive label into the modified protein.
- the migration of the radioactively labeled protein can be visualized, for example, on an autoradiograph of the gel.
- Cleavage of the modified protein by OmpTl can also be detected by Western blot analysis, for example, by transferring the proteins from the gel to a solid support, contacting the support with antibodies that bind to the intact and cleaved protein, and visualizing the bound antibodies using a detectable label.
- the cleavage activity by OmpTl can be determined by comparing the amount or rate of cleavage of a modified protein by OmpTl to that of an unmodified protein.
- the cleavage rate of the modified protein by OmpTl can be greater than 50% of the cleavage rate of the wild-type protein under specified conditions.
- the cleavage rate of a modified protein described herein is greater than 50% of the cleavage rate of wild-type protein after 30 minutes at 30° C when the modified and wild-type proteins are present at a similar concentration (e.g., a concentration of 0.1-1.0 micromolar) in a cell-free extract from bacteria expressing OmpTl .
- greater than 90% of the modified protein is cleaved by OmpTl after 60 minutes at 30° C when the modified protein is present at a concentration of 0.1 - 1.0 micromolar in a cell-free extract from bacteria expressing OmpTl .
- the OmpT cleavage sites introduced into the modified proteins described herein are cleavable by any protein or polypeptide that possesses OmpT- like enzyme activity. All that is required is that the OmpTl -like enzyme be capable of cleaving a protein modified to contain OmpT cleavage sites.
- the OmpT-like proteolytic activity can be provided by wild-type or native OmpTl, or a functional homo log or fragment thereof.
- the OmpT-like activity can also be provided by a protein that is substantially identical or substantially similar to OmpTl .
- the protein with OmpT-like activity can have at least 60%, 70%, 80%, 90%, 95% or 99% sequence identity to OmpTl .
- the protein having OmpT-like activity is at least 60%, 70%, 80%, 90%, 95% or 99% identical to SEQ ID NO:3.
- the protein having OmpTl activity is specifically bound by a polyclonal antibody that binds to OmpTl and variants thereof. Selection of polyclonal antibodies that bind to OmpTl and functional variants thereof can be performed as described herein for selecting polyclonal antibodies that bind RFl .
- nucleic acids encoding the modified proteins are transformed into bacteria.
- the bacteria can be transformed with the nucleic acid under conditions suitable for incorporation of the nucleic acid into the genome of the bacteria.
- the bacteria can be transformed with oligonucleotides having sequences that encode the OmpTl cleavage sites described herein using oligonucleotide-mediated allelic replacement, as described in the Examples.
- Incorporation of the desired mutations in the bacterial genome can be determined, for example, by screening transformed colonies using Mismatch Amplification Mutation Assay (MAMA) PCR, as described in the Examples.
- MAMA Mismatch Amplification Mutation Assay
- the modified target proteins having OmpTl cleavage sites are efficiently degraded when expressed in a bacterial cell extract that contains active OmpTl protease.
- careful selection of inhibitory proteins that are modified to be cleavable by OmpTl can enhance the productivity of cell-free synthesis systems.
- the cleavage of selected target proteins by OmpTl can improve the translation efficiency of full length proteins incorporating non-native amino acids in cell-free extracts.
- the non-native amino acid is incorporated at an amber codon introduced into the mRNA template.
- cleavage and inactivation of RFl and/or RF2 by OmpTl can increase the yield of proteins engineered to incorporate a non-native amino acid at an amber codon.
- non-native amino acids used in the present invention typically comprise one or more chemically modified derivatives or analogues of amino acids, wherein the chemical structures have the formula NH3-(CR)-COOH, where R is not any of the 20 canonical substituents defining the natural amino acids.
- Suitable non-native amino acid derivatives are commercially available from vendors such as, e.g., Bachem Inc., (Torrance, CA); Genzyme Pharmaceuticals (Cambridge, MA); Senn Chemicals (Dielsdorf, Switzerland); Sigma-Aldrich (St.
- the non-native amino acids include but are not limited to derivatives and/or analogs of glycine, tyrosine, glutamine, phenyalanine, serine, threonine, proline, tryptophan, leucine, methionine, lysine, alanine, arginine, asparagine, valine, isoleucine, aspartic acid, glutamic acid, cysteine, histidine, as well as beta-amino acids and homologs, BOC-protected amino acids, and FMOC-protected amino acids.
- non-native amino acid derivatives, analogs and mimetics not already commercially available can be accomplished in several ways. For example, one way is to synthesize a non-native amino acid of interest using organic chemistry methods known in the art, while another way is to utilize chemoenzymatic synthesis methods known in the art. See, e.g., Kamphuis et al., Ann. N. Y. Acad. Sci., 672:510-527, 1992; Ager DJ and Fotheringham IG, Curr. Opin. Drug Discov. Devel, 4:800-807, 2001; and Weiner et al., Chem. Soc.
- the non-native amino acids may include non-native L- and D- alpha amino acids.
- L-alpha amino acids can be chemically synthesized by methods known in the art such as, but not limited to, hydrogen-mediated reductive coupling via rhodium-catalyzed C-C bond formation of hydrogenated conjugations of alkynes with ethyl iminoacetates (Kong et al., J. Am. Chem. Soc, 127: 11269-11276, 2005).
- semisynthetic production by metabolic engineering can be utilized. For example, fermentation procedures can be used to synthesize non-native amino acids from E.
- Racemic mixtures of alpha-amino acids can be produced using asymmetric Strecker syntheses (as described in Zuend et al, Nature, 461;968-970 (2009)) or using transaminase enzymes for large-scale synthesis (as found in Taylor et al., Trends Biotechnol, 16:412-419, 1998 .
- Bicyclic tertiary alpha-amino acids may be produced by alkylation of glycine-derived Schiff bases or nitroacetates with cyclic ether electrophiles, followed by acid-induced ring opening and cyclization in NH 4 OH (see Strachan et al, J. Org. Chem., 71 :9909-9911 (2006)).
- the non-native amino acids may further comprise beta-amino acids, which are remarkably stable to metabolism, exhibit slow microbial degradation, and are inherently stable to proteases and peptidases.
- beta-amino acids An example of the synthesis of beta amino acids is described in Tan CYK and Weaver DF, Tetrahedron, 58:7449-7461, 2002.
- the non-native amino acids comprise chemically modified amino acids commonly used in solid phase peptide synthesis, including but not limited to, tert- butoxycarbonyl- (Boc) or (9H-fluoren-9-ylmethoxy)carbonyl (Fmoc)-protected amino acids.
- Boc derivatives of leucine, methionine, threonine, tryptophan and proline can be produced by selective 3,3-dimethyldioxirane side-chain oxidation, as described in
- Non-native amino acids that can be used in the present invention may include, but are not limited to, non-native analogues or derivatives of the 20 canonical amino acid substituents.
- non-native amino acids may involve an array of chemical and chemo-enzymatic methods known in the art.
- non-native amino acids may be synthesized according to procedures known in the art specific to a particular derivative of each non-native amino acid.
- Sycheva et al, Microbiology, 76:712-718, 2007 describes a procedure for synthesizing the non-native amino acids norvaline and norleucine.
- Diallylated proline derivatives can be produced by practical stereoselective synthesis (see Belvisi et al, Tetrahedron, 57:6463- 6473, 2001).
- tryptophan derivatives can be synthesized by ytterbium triflate catalyzed electrophilic substitution of indo as described in Janczuk et al, Tetrahedron Lett., 43:4271-4274, 2002, and synthesis of 5-aryl tryptophan derivatives is detailed in Wang et al, Tetrahedron, 58:3101-3110, 2002.
- Non-native serine analogs can be produced by beta- fragmentation of primary alkoxyl radicals (see Boto et al., J. Org. Chem., ⁇ '2: ⁇ '260-7269, 2007).
- the tRNA charging reaction refers to the in vitro tRNA aminoacylation reaction in which desired isoaccepting sense codon or amber codon tRNAs are aminoacylated with their respective amino acid of interest.
- the tRNA charging reaction comprises the charging reaction mixture, an isoaccepting sense tRNA, and as used in this invention, may include either natural or non-native amino acids.
- tRNA molecules to be used in the tRNA charging reaction can be synthesized from a synthetic DNA template for any tRNA of choice following amplification by PCR in the presence of appropriate 5' and 3' primers.
- the resulting double-stranded DNA template, containing a T7-promoter sequence can then be transcribed in vitro using T7 RNA polymerase to produce the tRNA molecule, which is subsequently added to the tRNA charging reaction.
- the tRNA charging reaction can be any reaction that aminoacylates a sense codon or amber codon tRNA molecule with a desired amino acid separate from the protein synthesis reaction. This reaction can take place in an extract, an artificial reaction mixture, or a combination of both. Suitable tRNA aminoacylation reaction conditions are well known to those of ordinary skill in the art. Typically, tRNA aminoacylation is carried out in a physiological buffer with a pH value ranging from 6.5 to 8.5, 0.5-10 mM high energy phosphate (such as ATP), 5 - 200 mM MgCl 2 , 20 - 200 mM KC1.
- a physiological buffer with a pH value ranging from 6.5 to 8.5, 0.5-10 mM high energy phosphate (such as ATP), 5 - 200 mM MgCl 2 , 20 - 200 mM KC1.
- the reaction is conducted in the presence of a reducing agent (such as 0 - 10 mM dithiothreitol).
- a reducing agent such as 0 - 10 mM dithiothreitol
- the concentration of the synthetase is typically 1-100 nM.
- these conditions can be varied to optimize tR A aminoacylation, such as high specificity for the pre-selected amino acids, high yields, and lowest cross-reactivity.
- isoaccepting or amber tR As are charged by aminoacyl-tRNA synthetases.
- the tRNA charging reactions can utilize either the native aminoacyl-tRNA synthetase specific to the isoaccepting sense tRNAs to be charged, an engineered aminoacyl-tRNA synthetase, or a "promiscuous" aminoacyl tRNA synthetase capable of charging a tRNA molecule with more than one type of amino acid.
- Promiscuous aminoacyl-tRNA synthetases may either themselves be engineered, or may include endogenously produced aminoacyl-tRNA synthetases that are sometimes found in nature.
- a translation system which can comprise a cell free extract, cell lysate, or reconstituted translation system, along with the nucleic acid template for synthesis of the desired polypeptide or protein having non-native amino acids at preselected (defined) positions.
- the reaction mixture will further comprise monomers for the macromolecule to be synthesized, e.g. amino acids, nucleotides, etc., and such co-factors, enzymes and other reagents that are necessary for the synthesis, e.g. ribosomes, tRNA, polymerases,
- materials specifically required for protein synthesis may be added to the reaction.
- the materials include salts, folinic acid, cyclic AMP, inhibitors for protein or nucleic acid degrading enzymes, inhibitors or regulators of protein synthesis, adjusters of oxidation/reduction potentials, non-denaturing surfactants, buffer components, spermine, spermidine, putrescine, etc.
- Various cell-free synthesis reaction systems are well known in the art. See, e.g., Kim, D.M. and Swartz, J.R. Biotechnol. Bioeng. 66: 180-8 (1999); Kim, D.M.
- a DNA template is used to drive in vitro protein synthesis, and RNA polymerase is added to the reaction mixture to provide enhanced transcription of the DNA template.
- RNA polymerases suitable for use herein include any RNA polymerase that functions in the bacteria from which the bacterial extract is derived.
- an RNA template is used to drive in vitro protein synthesis
- components of the reaction mixture can be admixed together in any convenient order, but are preferably admixed in an order wherein the RNA template is added last, thereby minimizing potential degradation of the RNA template by nucleases.
- cell-free synthesis is therefore performed in a reaction where oxidative phosphorylation is activated, i.e. the CYTOMIMTM system.
- the CYTOMIMTM system is defined by using a reaction condition in the absence of polyethylene glycol with optimized magnesium concentration.
- the CYTOMIMTM system does not accumulate phosphate, which is known to inhibit protein synthesis, whereas conventional secondary energy sources result in phosphate accumulation.
- CYTOMIMTM system are described in United States Patent No. 7,338,789, the contents of which are incorporated by reference herein in its entirety.
- an active oxidative phosphorylation pathway can be demonstrated by the lack of a requirement for secondary energy sources, such as phosphoenolpyruvate, creatine phosphate, acetyl phosphate, or glycolytic intermediates such as glucose, glucose-6- phosphate, and pyruvate.
- secondary energy sources such as phosphoenolpyruvate, creatine phosphate, acetyl phosphate, or glycolytic intermediates such as glucose, glucose-6- phosphate, and pyruvate.
- the presence of an active oxidative phosphorylation pathway can also be determined by sensitivity of the pathway to inhibitors, such as electron transport chain inhibitors. Examples of electron transport chain inhibitors include 2-heptyl-4- hydroxyquinoline-N-oxide (HQNO), 2,4-dinitrophenol, cyanide, azide,
- the cell-free translation system does not comprise an active oxidative phosphorylation pathway.
- the present invention utilizes a cell lysate for in vitro translation of a target protein.
- the organism used as a source for the lysate may be referred to as the source organism or host cell.
- Host cells may be bacteria, yeast, mammalian or plant cells, or any other type of cell capable of protein synthesis.
- a lysate comprises components that are capable of translating messenger ribonucleic acid (mRNA) encoding a desired protein, and optionally comprises components that are capable of transcribing DNA encoding a desired protein.
- mRNA messenger ribonucleic acid
- Such components include, for example, DNA-directed RNA polymerase (RNA polymerase), any transcription activators that are required for initiation of transcription of DNA encoding the desired protein, transfer ribonucleic acids (tRNAs), aminoacyl-tRNA synthetases, 70S ribosomes, N 10 -formyltetrahydrofolate, formylmethionine-tRNAf* 161 synthetase, peptidyl transferase, initiation factors such as IF-1, IF-2, and IF-3, elongation factors such as EF-Tu, EF-Ts, and EF-G, release factors such as RF-1, RF-2, and RF-3, and the like.
- RNA polymerase DNA-directed RNA polymerase
- tRNAs transfer ribonucleic acids
- aminoacyl-tRNA synthetases aminoacyl-tRNA synthetases
- 70S ribosomes N 10 -formylt
- An embodiment uses a bacterial cell from which a lysate is derived.
- a bacterial lysate derived from any strain of bacteria can be used in the methods of the invention.
- the bacterial lysate can be obtained as follows.
- the bacteria of choice are grown up overnight in any of a number of growth media and under growth conditions that are well known in the art and easily optimized by a practitioner for growth of the particular bacteria.
- a natural environment for synthesis utilizes cell lysates derived from bacterial cells grown in medium containing glucose and phosphate, where the glucose is present at a concentration of at least about 0.25% (weight/volume), more usually at least about 1%; and usually not more than about 4%, more usually not more than about 2%.
- 2YTPG medium An example of such media is 2YTPG medium, however one of skill in the art will appreciate that many culture media can be adapted for this purpose, as there are many published media suitable for the growth of bacteria such as E. coli, using both defined and undefined sources of nutrients.
- Cells that have been harvested overnight can be lysed by suspending the cell pellet in a suitable cell suspension buffer, and disrupting the suspended cells by sonication, breaking the suspended cells in a French press, continuous flow high pressure homogenization, or any other method known in the art useful for efficient cell lysis The cell lysate is then centrifuged or filtered to remove large DNA fragments.
- This example describes the modification of RFl protein to introduce amino acid sequences that are cleavable by OmpTl protease.
- a PCR based strategy was used to introduce desired nucleotide sequence changes into nucleic acid templates that encode the modified RFl proteins described herein.
- the PCR reaction was carried out using Phusion Hot Start Flex 2X Master Mix (NEB) according to the protocols suggested by the manufacturer.
- NEB Phusion Hot Start Flex 2X Master Mix
- a two-step overlapping PCR was carried out to introduce OmpT cleavage mutations into the RF1 encoding gene, as described in more detail below.
- PCR generated DNA templates were purified using QIAquick PCR purification kit (QIAGEN) for application in cell-free expression. After PCR purification the variants were sequenced by Mclab (South San Francisco, CA) to confirm the presence of the expected mutations.
- the efficiency of transcription from a DNA template can be decreased due to degradation of the template by endogenous bacterial exonucleases present in cell-free extracts.
- the short form of ⁇ phage Gam protein (GamS) is known to protect DNA templates from degradation by inhibiting the activity of RecBCD (Exonuclease V) (see Sitararman, K., Esposito, D., Klarmann, G., Grice, S. F. L., Hartley, J. L. and Chatterjee, D. K. 2004, A Novel Cell-free Protein Synthesis System. J Biotechnol. 110: 257-263. Therefore, GamS protein was used in this example to stabilize PCR templates during cell-free transcription reactions.
- the GamS gene was amplified to include a C-terminal poly-histidine tag, GGSHHHHHH (SEQ ID NO:50), by primers, 5'- ATATATCATATGAACGCTTATTACATTCAGGATCGTCTTGAG-3' (SEQ ID NO:51), and 5'- ATATATGTCGACTTAATGATGATGATGATGATGAGAACCCCCTACCTCTGAATCA ATATC AACCTGGTGGTG-3 ' (SEQ ID NO:52) using pKD46 (Datsenko, K. A. and Wanner, B. 2000, One-step Inactivation of Chromosomal Genes in Escherichia coli K-12 Using PCR Products. Proc.
- SBJYOOl Bacterial Strains and Plasmids [0137] SBJYOOl is an E.coli K12 derivative optimized for open cell free protein production. SBJYOOl was transformed with the plasmid pKD46 (Coli Genetic Stock Center) which contains the phage ⁇ Red recombinase genes under an inducible arabinose promoter. Construction of SBHS002
- SBHS002 is an ompT deletion E. coli strain created using PI transduction. PI lysate was made from JW0554-1 (CGSC#8680), a Keio collection strain containing the
- ompT::Kan R mutation flanked by FRT sites The JW0554-1 PI lysate was then used to introduce the mutation into SBJY001 by PI transduction. Colonies were grown on LB with 30 ⁇ g/ml of kanamycin to select for kanamycin resistance. SBJY001ompT::Kan R was transformed with the 708-FLPe Cm R expression plasmid (Gene Bridges). FLP synthesis was induced and colonies were screened for the loss of kanamycin resistance. Kanamycin resistant colonies were sequenced to confirm the deletion of ompT. The ompT deleted strain is referred to as SBHS002.
- RFl was amplified from E.coli strain A19 genomic DNA using primers 5His-RFl : CATATGCATCACCATCACCATCACGGTGGTGGCTCTAAGCCTTCTATCGTTGCCA AACTGGAAGCC (SEQ ID NO: 138) and 3RF1 :
- GTCGACTTATTCCTGCTCGGACAACGCCGCCAG (SEQ ID NO: 139) that introduced an N-terminal His-Tag and Ndel/Sall restriction sites.
- the insert was ligated into the expression vector pYD317 and confirmed by sequencing.
- RFl was expressed in a 25 mL cell free reaction using the plasmid, purified by IMAC, and buffer exchanged into PBS.
- SBJY001 cells which have intact ompT protease on the outer membrane, and SBHS002, in which ompT was deleted, were grown up in 5 mL of LB overnight at 37°C. 50 ⁇ of each culture was spun down at 8,000rpm for 2 minutes and washed twice with 10 mM Tris, 20 mM ammonium chloride and 10 mM magnesium chloride. The cell pellets were then resuspended in 50uL of the buffer and 10 ⁇ g of purified recombinant E.coli RFl protein was added. The samples were incubated at 37 °C. The samples were spun down at 8,000 rpm for 2 minutes. The supernatant containing the RFl protein was removed and run on a SDS-PAGE gel. Cell-free expression of RFl variants
- the cell free transcription/translation reactions were carried out in a volume of 60 ⁇ 1 at 30°C in 24 deep well plates (Cat.No.95040470, Thermo Scientific) for 4.5 hours.
- the PCR template concentration for RFl variant expression was The reaction composition also included 8mM magnesium glutamate, 130mM potassium glutamate, 35mM sodium pyruvate, 1.2mM AMP, 0.86mM each of GMP, UMP and CMP, 4mM sodium oxalate, lmM putrescine, 1.5mM spermidine, 15mM potassium phosphate, lmM tyrosine, 2mM of each 19 other amino acids, lOOnM T7 RNA polymerase, 30% (V/V) S30 cell-extract.
- the RFl variants were expressed in either an OmpT-positive (OmpT+) cell- extract, which was prepared from bacterial strain SBJY001, or an OmpT-negative (OmpT-) cell-extract, which was prepared from bacterial strain SBHS002 (SBJY001ziom/?7).
- OmpT+ OmpT-positive cell- extract
- OmpT- OmpT-negative cell-extract
- SBHS002 SBJY001ziom/?7
- the mutation sequences were designed in the middle of the forward and reverse oligo primers (Table 1).
- the 5 '-fragment was amplified by PCR using 5chiT2PT7, 5 '- GCGTACTAGCGTACCACGTGGCTGGTGGCCGATTCATTAATGCAGCTGGCACGAC AGG-3 ' (SEQ ID NO:53), and the reverse primers (Table 1).
- the 5 'fragment included T7 promoter, the constant region of the N-terminal sequence and the mutation site.
- the 3'- fragment was also amplified in the first step using forward primers (Table 1) and 3chiT2TT7, 5'-
- GCGTACTAGCGTACCACGTGGCTGGTGGCGGTGAGTTTTCTCCTTCATTACAGAA ACGGC-3' (SEQ ID NO:54).
- the 3' fragment included the mutation site, the constant C- terminal region and T7 terminator sequences.
- the 5 '-fragment and 3 '-fragment DNA were assembled by overlapping PCR using a single primer 5chiT2,5'- GCGTACTAGCGTACCACGTGGCTGGTGG-3 ' (SEQ ID NO:55).
- variant N296R when expressed in cell- extracts containing OmpT, variant N296R was partially digested while the other variants migrated as expected for full-length, undigested proteins. N296 is located in the switch loop region of RFl, which is flexible and easy to access by protease digestion. [0145] In the first round screening, N296K was selected for partial digestion by OmpT in cell-extract. In the second round screening, PCR templates of double mutant and triple mutant variants were generated using the same method as described above with primers listed in Table 1. Six double mutants, N296K/L297V, N296K/L297K, N296K/L297R,
- RF1 was also modified to replace wild-type sequences in the switch loop region with known OmpT protease-susceptible peptide sequences (see Hwang, B., Varadarajan, N., Li, H., Rodriguez, S., Iverson, B. L. and Georgiou, G. 2007, Substrate Specificity of the Escherichia coli Outer Membrane Protease OmpP. J. Bacteriol. 189: 522-530; McCarter, J. D., Stephens, D., Shoemaker, K., Rosenberg, S., Kirsch, J. F. and Georgiou, G.
- Variant Nos. 1 to 14 contained ARRG (SEQ ID NO:47) for OmpT digestion.
- Variant No. 15 contained ARR instead of ARRG (SEQ ID NO:47) since it is at the end of switch loop.
- Variant No. 16 contained a single mutation N296R.
- Variant Nos. 17, 18 and 19 contained an OmpT cleavage peptide WLAARRGRG (SEQ ID NO:48).
- Variant Nos. 20, 21 and 22 contained another OmpT cleavage peptide WGGRWARK GTI (SEQ ID NO:49).
- the mutation sequences were designed in the forward and reverse oligo primers listed in Table 4.
- the 5 '-fragment was amplified by PCR using the primer 5chiT2PT7 and the reverse primers (Table 4).
- the 5 'fragment included T7 promoter, the constant region of the N-terminal sequence and the mutation site.
- the 3 '-fragment was also amplified in the first step using forward primers (Table 3) and 3chiT2TT7.
- the 3' fragment included the mutation site, the constant C-terminal region and T7 terminator sequences.
- the 5 '-fragment and 3 '-fragment DNA were assembled by overlapping PCR using a single primer 5chiT2 as described above.
- this example describes the construction of recombinant bacterial strains that express both modified RF1 and intact OmpTl .
- the purpose of this example is to show that RF1 variants expressed by the recombinant strains are cleaved in cell-free extracts from the recombinant strains that express OmpTl .
- oligonucleotide-mediated allelic replacement was used to insert the RFl mutations into the bacterial genome.
- the OMAR protocol was adapted from a previously reported protocol (Wang and Church, Methods in Enzymology, 2011, 498, 409- 426). Briefly, SBJYOOl containing the pKD46 plasmid were grown in 3ml LB and 50 ⁇ g/mL ampicillin at 30°C to OD 6 oo 0.3. The cells were then induced with 1 mM L-arabinose at 37°C for 45 min.
- the cell pellet was washed 2X with cold 10% glycerol and resuspended in 30 cold 10% glycerol. 5 ⁇ of each oligo was added to the resuspended cells. Synthetic oligos (Integrated DNA Technologies) were 90 base pairs long and designed to anneal to the lagging strand during DNA replication (see Table 5). The cells were electroporated at 1800V for 5 ms in a 1 mm cuvette. They were then recovered in 3 mL LB and 50 ⁇ g/ml Amp. This process was repeated for 13 cycles. Cells were diluted and plated on LB agar plates and grown at 37 °C overnight.
- Strains SBHS015, SBHS016 and SBHS017, that were engineered to contain modified RF1 variants, were grown up in 500 mL TB at 37 °C shaking overnight in Tunair shake flasks. The cells were pelleted at 6000xg for 15 minutes. The cell pellet was washed 2X with 6 mL S30 Buffer (10 mM Tris, 14 mM magnesium acetate and 60 mM potassium acetate): 1 g cell pellet. The cells were then resuspended in 2 mL S30 Buffer: 1 g cell pellet. The resuspended cells were lysed using a homogenizer. The extract was then clarified 2X at 15,000xg for 30 minutes.
- the extract was activated for 1, 2 or 3 hrs in a 30 °C water bath.
- An anti-RFl antibody was made by inoculating rabbits with purified recombinant E.coli RF1 protein that was then purified using an affinity matrix (YenZym Antibodies LLC). The specificity of the antibody was confirmed using ELISAs and Western Blots of the
- the cell pellet, lysate and extract samples were run on a SDS-PAGE gel and transferred to a PVDF membrane using the iBlot® system (Invitrogen).
- the primary anti- RFl antibody was used followed by a secondary anti-rabbit alkaline-phosphatase conjugated antibody (Invitrogen).
- the bands were visualized using an alkaline-phosphatase chromogenic substrate solution containing 5 -bromo-4-chloro-3-indolyl-l -phosphate and nitroblue tetrazolium (Invitrogen).
- Strain SBHS015 contains the N296K/L297R double mutation variant of RF 1 , referred to as variant A 13.
- Strain SBHSO 16 contains the
- N296K/L297R/L298R triple mutation variant of RFl referred to as variant A18.
- Strain SBHSO 17 contains the N296K/L297R/L298K triple mutation variant of RFl, referred to as variant A 17. All three strains also express intact OmpTl, as they are derived from the parent strain SBJY001. When the recombinant strains were lysed and incubated for various time periods (0, 1, 2 and 3 hours), the modified RFl protein variants were efficiently cleaved at all time points tested by the cell-free extract, as determined by Western blot analysis (data not shown).
- This example demonstrates that recombinant bacterial strains were engineered to express modified RFl variants, and that the RFl variants were cleaved by cell-free extracts from OmpTl positive strains.
- Example 3 demonstrates that intact RFl proteins modified to include OmpTl cleavage sites in the switch loop region have wild-type RFl function.
- the percent truncated protein was determined using the equation: (truncated protein counts/ total protein counts) x 100%.
- Relative RF1 activity was determined using the equation: [(variant truncated protein- negative control truncated protein)/ (WT RFl truncated protein - negative control truncated protein)] x 100%.
- RFl variants described herein have RFl activity, as demonstrated by truncation of translation when incorporating a non-native amino acid (pAzF) at an amber codon introduced at position S378 of the Fc protein.
- pAzF non-native amino acid
- the RFl variant A13 having N296K/L297R substitutions
- Example 4 demonstrates increased incorporation of non-natural amino acids into the IgG heavy chain of Herceptin protein using cell free extracts comprising RFl variants having OmpTl cleavage sites in the switch loop region.
- the cell free extracts are from the bacterial strains described in Example 2.
- the DNA template encoding Herceptin was mutated to introduce amber codons at different positions of the coding sequence.
- Site directed mutagenesis was performed using a pYD plasmid containing the coding region of Herceptin6xHis at the C-terminus as the DNA template and synthetic oligonucleotides (Operon) containing amber codons in both sense and antisense directions (Table 6). Oligonucleotides of each mutation were mixed with the DNA template and Phusion® polymerase (Thermo, Cat# F531s) to a final volume of 20 ⁇ .
- each component was 0.16 ⁇ of each oligonucleotide, 0.5 ng/ ⁇ template DNA, 0.02 ⁇ / ⁇ .
- Mixture was incubated at 98°C 5m, 18 PCR cycles (98°C 30s, 55 °C lm, 72°C 4m), 10m at 72°C and stored at 4°C for up to 16h.
- Dpnl (NEB) was added to the mixture to final concentration of 0.6 ⁇ / ⁇ and incubated for 37°C lh. 5 ⁇ of each mixture was transformed into 50 ⁇ of Chemically Competent E.
- coli cells according to manufactures procedure (Invitrogen, MultiShotTM 96-Well Plate TOP 10). Transformed cells were recovered in 200 ⁇ SOC(Invitrogen) 37°C lh and plated onto Luria-Bertani (LB) agar supplemented with 50 ⁇ g/mL kanamycin (Teknova).
- E.coli strain SBHS016 with modified RF1 variant A18 was harvested at a final density of 40-55 OD, and centrifuged at 14,000 g in a Sharpies Model AS14 centrifuge for 10 minutes to remove spent medium.
- the cell paste was re-suspended to homogeneity with a ratio of 6 mL/g cells S30 buffer (14mM MgAcO, 60mM KAcO, lOmM Tris), and centrifuged again at 14,000 g for 10 minutes using the Sharpies AS 14 for further removal of spent medium.
- the resulting clarified cell paste was re-suspended in S30 with a ratio of 2mL/g cells, and the cells were lysed by single pass through an Avestin Emulsiflex C-55
- the homogenizer at 17,000 psi.
- the homogenate is clarified by centrifugation at 14,000 g twice for 30 minutes each, and the resulting pellets were discarded.
- the resultant cell extract solution was incubated at 30°C for 2 hours, and then centrifuged again at 14,000 g using the Sharpies AS 14 for particulate removal. This final solution was frozen in LN 2 and stored at - 80°C until needed for cell-free protein synthesis.
- non reducing and reducing gels were for autoradiography assay.
- 4 uL of sample, 8 uL of DI H 2 0 and 4 uL of 4X LDS buffer (Invitrogen, Carlsbad, CA) were mixed before being loaded on gel.
- 4 uL of sample, 1 uL of 1 M DTT, 7 uL of DI H 2 0 and 4 uL of 4X LDS buffer (Invitrogen, Carlsbad, CA) were mixed and heated in hot blot at 70 C for 5 minutes. Samples were analyzed by 4-12% Bis- Tris SDS-PAGE gels (Invitrogen, Carlsbad, CA) according to the manufacturer's
- tRNA molecules were separated from parental RNA and HDV ribozyme RNA product by gel filtration chromatography using a tandem Sephacryl 100 or 300 resin in XK50/100 columns.
- tRNAs for use in aminoacylation reactions are treated with T4 polynucleotide kinase in 100 mM MES pH 5.5, 10 mM MgCl 2 and 10 mM 2-mercaptoethanol for 1 hr to remove the 2',3'-cyclic phosphate leaving 2',3'-OH groups at the 3' terminus of the tRNA.
- T4 PNK treated tRNA was phenol:chloroform:isoamylalcohol extracted and buffer exchanged using a G25 column which removed inorganic phosphate and excess phenol.
- tRNA was isopropanol or ethanol precipitated, resuspended in 10 mM Tris (pH 6.5) and 0.1 mM EDTA. The tRNA was refolded by heating the tRNA to 70°C for 20 minutes. Then 10 mM MgCl 2 was added and the mixture was slowly equilibrated to room temperature.
- HDV ribozyme cleavage of tRNA transcripts while producing homogenous 3' ends, leaves a 2'-3' cyclic phosphate moiety that interferes with subsequent aminoacylation. It has been found that this can be removed using T4 polynucleotide kinase (PNK).
- PNK T4 polynucleotide kinase
- 40 ⁇ tRNA was incubated at 37 °C with 0.050 mg/ml PNK in 50 mM MES (pH 5.5), 10 mM MgCl 2 , 300 mM NaCl, and 0.1 mM EDTA. Dephosphorylation was assayed by two different methods. Dephosphoryation was confirmed using denaturing gel electrophoresis. As has been reported, dephophoylated tRNA has a reduced mobility in acid/urea gels electrophoresis .
- RNA concentration was measured using a Nano-Drop 1000 spectrophotometer (Thermo Scientific) and confirmed by gel
- the conditions for non-natural aminoacylation are 50 mM HEPES pH 8.1, 40 mM KC1, 75 mM MgCl 2 , 5 mM ATP, 8-40 ⁇ tRNA phe cu A , 10 mM DTT, 2 mM amino acid
- the aqueous phase (containing tRNA) is removed and added to a pre-equilibrated (300 mM NaOAC) G25 sephadex resin size exclusion column that separates based on the size of the molecule.
- the elutant is mixed with 2.5 volumes of 100% ethanol and incubated at -80°C for 15-30 minutes and centrifuged at 12,000-14,000 rcf for 30-45 minutes.
- the aminoacylated tRNA is now in a pellet that can be stored at -80°C or resuspended in a slightly acidic buffer for injection into the HPLC and/or use in OCFS reactions.
- HPLC C5 HIC column is equilibrated in buffer A (50 mM potassium phosphate and 1.5 M ammonium sulfate pH 5.7) until the UV trace doesn't fluctuate from zero. 1-10 ⁇ g tRNA is mixed with 100 ⁇ of 2X buffer A (100 mM potassium phosphate and 3 M ammonium sulfate). The sample is injected and run in a gradient from buffer A to buffer B (50 mM potassium phosphate and 5% isopropanol) over 50 minutes.
- buffer A 50 mM potassium phosphate and 1.5 M ammonium sulfate pH 5.7
- OCFS reaction mix was immediately added to microplate with inhibitor for a 25 ⁇ ⁇ final reaction volume containing 30% S30 extract, 24 ug/mL T7 RNA polymerase, ImM L-tyrosine (Sigma, T8566), pre-mix*, 10-60 ⁇ pN 3 F-tRNA phe CU A or uncharged tRNA phe cu A , arid 3nM turboGFP plasmid in DEPC-treated water (G Biosciences, 786-109).
- a positive control reaction using turboGFP without the stop codon was used to ensure that the reactions proceeded with rates similar previously observed, while reactions containing turboGFP Y50TAG were also run without tRNA to ensure no fluorescence was detected (negative control). Suppression efficiencies were calculated by comparison of positive control fluorescence to the amber codon containing template fluorescence.
- expression of the IgG heavy chain TAG variants in the SBJY001 cell free extract resulted in relatively poor amber suppression (i.e., the heavy chain protein was truncated).
- expression of the IgG heavy chain TAG variants in the SBHS016 cell free extract resulted in relatively high amber suppression (i.e., much less of the heavy chain protein was truncated), which corresponds to the substantially higher yields of full length IgG observed in Figure 2.
- TKERVYLAEEGGR VS QLDWKFNNAAIIKGAINWDLMPQISIGAAGWTTLGSRGGNMVDQDWMDSSNPGTW TDESRHPDTQLNYANEFDLNIKGWLLNEPNYRLGLMAGYQESRYSFTARGGSYIYSS EEGFRDDIGSFPNGERAIGYKQRFKMPYIGLTGSYRYEDFELGGTFKYSGWVESSDN DEHYDPGKRITYRSKVKDQNYYSVAVNAGYYVTPNAKVYVEGAWNRVTNK GNT SLYDHNNNTSDYSKNGAGIENYNFITTAGLKYTF
- SEQ ID NO: 13 N296K,L297R A13 mutation in the switch loop region of Release Factor 1 (RFl), amino acids 287 to 304
- N296K,L297R,L298K A17 mutation in the switch loop region of Release Factor 1 (RFl), amino acids
- N296K,L297R,L298R A18 mutation in the switch loop region of Release Factor 1 (RFl), amino acids
- N296K/L297V RF1 variant OmpT cleavage site screening reverse primer GCTGCGATCGCCACTCCCCAGAACTTTACGACGGGTAGACGCTTCG
- N296K/L297K RF1 variant OmpT cleavage site screening reverse primer GCTGCGATCGCCACTCCCCAGCTTTTTACGACGGGTAGACGCTTCG
- N296R/L297K RFl variant OmpT cleavage site screening reverse primer GCTGCGATCGCCACTCCCCAGCTTGCGACGACGGGTAGACGCTTCG
- N296R/L297R RFl variant OmpT cleavage site screening reverse primer GCTGCGATCGCCACTCCCCAGACGGCGACGACGGGTAGACGCTTCG
- Oligonucleotide-Mediated Allelic Replacement (OMAR) PCR oligo lopRFl KR
- Oligonucleotide-Mediated Allelic Replacement (OMAR) PCR oligo lopRFl KRR
- Oligonucleotide-Mediated Allelic Replacement (OMAR) PCR oligo lopRFl KRK
- MAMA Mismatch Amplification Mutation Assay
- MAMA Mismatch Amplification Mutation Assay
- MAMA Mismatch Amplification Mutation Assay
- MAMA Mismatch Amplification Mutation Assay
Landscapes
- Chemical & Material Sciences (AREA)
- Health & Medical Sciences (AREA)
- Organic Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- Genetics & Genomics (AREA)
- Biochemistry (AREA)
- General Health & Medical Sciences (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Engineering & Computer Science (AREA)
- Zoology (AREA)
- Wood Science & Technology (AREA)
- Biophysics (AREA)
- Immunology (AREA)
- Medicinal Chemistry (AREA)
- Bioinformatics & Cheminformatics (AREA)
- General Engineering & Computer Science (AREA)
- Biotechnology (AREA)
- Microbiology (AREA)
- Analytical Chemistry (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Physics & Mathematics (AREA)
- General Chemical & Material Sciences (AREA)
- Biomedical Technology (AREA)
- Pathology (AREA)
- Gastroenterology & Hepatology (AREA)
- General Physics & Mathematics (AREA)
- Oncology (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Peptides Or Proteins (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Plant Pathology (AREA)
- Toxicology (AREA)
- Apparatus Associated With Microorganisms And Enzymes (AREA)
Priority Applications (14)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP13779699.1A EP2906592B1 (en) | 2012-10-12 | 2013-10-08 | Proteolytic inactivation of select proteins in bacterial extracts for improved expression |
| CN201380063443.9A CN104837863B (zh) | 2012-10-12 | 2013-10-08 | 用于提高表达的细菌提取物中选定蛋白的蛋白水解失活 |
| KR1020157012291A KR102018863B1 (ko) | 2012-10-12 | 2013-10-08 | 개선된 발현을 위해 박테리아 추출물 중 선택 단백질의 단백질분해 불활성화 |
| CA2887355A CA2887355C (en) | 2012-10-12 | 2013-10-08 | Proteolytic inactivation of select proteins in bacterial extracts for improved expression |
| AU2013329464A AU2013329464C1 (en) | 2012-10-12 | 2013-10-08 | Proteolytic inactivation of select proteins in bacterial extracts for improved expression |
| PL13779699T PL2906592T3 (pl) | 2012-10-12 | 2013-10-08 | Proteolityczna inaktywacja wybranych białek w ekstraktach bakteryjnych dla ulepszonej ekspresji |
| SG11201502875VA SG11201502875VA (en) | 2012-10-12 | 2013-10-08 | Proteolytic inactivation of select proteins in bacterial extracts for improved expression |
| JP2015536826A JP6421122B2 (ja) | 2012-10-12 | 2013-10-08 | 改善された発現のための、細菌抽出物中の選択タンパク質のタンパク質分解不活性化 |
| ES13779699.1T ES2694683T3 (es) | 2012-10-12 | 2013-10-08 | Inactivación proteolítica de proteínas seleccionadas en extractos bacterianos para mejorar la expresión |
| DK13779699.1T DK2906592T3 (en) | 2012-10-12 | 2013-10-08 | Proteolytic inactivation of selected proteins in bacterial extracts for enhanced expression |
| US14/434,391 US9650621B2 (en) | 2012-10-12 | 2013-10-08 | Proteolytic inactivation of select proteins in bacterial extracts for improved expression |
| IL23809515A IL238095B (en) | 2012-10-12 | 2015-04-01 | Proteolytic inactivation of selected proteins in bacterial extraction to improve expression |
| US15/483,766 US10450353B2 (en) | 2012-10-12 | 2017-04-10 | Proteolytic inactivation of select proteins in bacterial extracts for improved expression |
| US16/562,837 US11261219B2 (en) | 2012-10-12 | 2019-09-06 | Proteolytic inactivation of select proteins in bacterial extracts for improved expression |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201261713245P | 2012-10-12 | 2012-10-12 | |
| US61/713,245 | 2012-10-12 |
Related Child Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US14/434,391 A-371-Of-International US9650621B2 (en) | 2012-10-12 | 2013-10-08 | Proteolytic inactivation of select proteins in bacterial extracts for improved expression |
| US15/483,766 Continuation US10450353B2 (en) | 2012-10-12 | 2017-04-10 | Proteolytic inactivation of select proteins in bacterial extracts for improved expression |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2014058830A1 true WO2014058830A1 (en) | 2014-04-17 |
Family
ID=49447839
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2013/063804 Ceased WO2014058830A1 (en) | 2012-10-12 | 2013-10-08 | Proteolytic inactivation of select proteins in bacterial extracts for improved expression |
Country Status (14)
| Country | Link |
|---|---|
| US (3) | US9650621B2 (https=) |
| EP (1) | EP2906592B1 (https=) |
| JP (3) | JP6421122B2 (https=) |
| KR (1) | KR102018863B1 (https=) |
| CN (1) | CN104837863B (https=) |
| AU (1) | AU2013329464C1 (https=) |
| CA (1) | CA2887355C (https=) |
| DK (1) | DK2906592T3 (https=) |
| ES (1) | ES2694683T3 (https=) |
| HU (1) | HUE041721T2 (https=) |
| IL (1) | IL238095B (https=) |
| PL (1) | PL2906592T3 (https=) |
| SG (1) | SG11201502875VA (https=) |
| WO (1) | WO2014058830A1 (https=) |
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN108949796A (zh) * | 2018-07-27 | 2018-12-07 | 张家港市华天药业有限公司 | 一种用于合成谷胱甘肽的重组菌及谷胱甘肽的合成方法 |
| CN109055291A (zh) * | 2018-07-31 | 2018-12-21 | 张家港市华天药业有限公司 | 用于合成谷胱甘肽的重组菌及谷胱甘肽的合成方法 |
Families Citing this family (33)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| PL2906592T3 (pl) * | 2012-10-12 | 2019-07-31 | Sutro Biopharma, Inc. | Proteolityczna inaktywacja wybranych białek w ekstraktach bakteryjnych dla ulepszonej ekspresji |
| SG11201508642WA (en) * | 2013-04-19 | 2015-11-27 | Sutro Biopharma Inc | Expression of biologically active proteins in a bacterial cell-free synthesis system using cell extracts with elevated levels of exogenous chaperones |
| US10316322B2 (en) * | 2014-07-02 | 2019-06-11 | Sutro Biopharma, Inc. | High growth capacity auxotrophic Escherichia coli and methods of use |
| CN116144626A (zh) * | 2016-01-13 | 2023-05-23 | 新英格兰生物实验室公司 | T7 rna聚合酶的热稳定变体 |
| CN110366428B (zh) | 2016-12-30 | 2024-05-17 | Vaxcyte公司 | 具有非天然氨基酸的多肽-抗原缀合物 |
| US11951165B2 (en) | 2016-12-30 | 2024-04-09 | Vaxcyte, Inc. | Conjugated vaccine carrier proteins |
| CN106801047A (zh) * | 2016-12-30 | 2017-06-06 | 武汉金开瑞生物工程有限公司 | 一种通过无细胞蛋白合成系统制备半胱氨酸蛋白酶的方法 |
| JP7325341B2 (ja) | 2017-07-11 | 2023-08-14 | シンソークス,インク. | 非天然ヌクレオチドの組み込み及びその方法 |
| KR20240141853A (ko) | 2017-08-03 | 2024-09-27 | 신톡스, 인크. | 자가면역 질환의 치료를 위한 사이토카인 접합체 |
| SG11202003147XA (en) | 2017-10-12 | 2020-05-28 | Vaxcyte Inc | Periodontitis vaccine and related compositions and method of use |
| CN112004547A (zh) | 2018-02-26 | 2020-11-27 | 新索思股份有限公司 | Il-15缀合物及其用途 |
| JP7340591B2 (ja) | 2018-07-11 | 2023-09-07 | アクティム・セラピューティクス・インコーポレイテッド | 遺伝子操作された免疫刺激性細菌菌株およびその使用 |
| SG11202102930YA (en) | 2018-11-08 | 2021-04-29 | Synthorx Inc | Interleukin 10 conjugates and uses thereof |
| EP3923974A4 (en) | 2019-02-06 | 2023-02-08 | Synthorx, Inc. | IL-2 CONJUGATES AND METHODS OF USE THEREOF |
| KR20210146392A (ko) | 2019-04-02 | 2021-12-03 | 박사이트, 인코포레이티드 | 침습 플라스미드 항원 b의 최적화된 무세포 합성 및 관련 조성물 및 사용 방법 |
| CN114555128A (zh) | 2019-08-15 | 2022-05-27 | 新索思股份有限公司 | 采用il-2缀合物的免疫肿瘤学组合疗法 |
| US12234271B2 (en) | 2019-09-10 | 2025-02-25 | Synthorx, Inc. | Il-2 conjugates and methods of use to treat autoimmune diseases |
| WO2021091986A1 (en) | 2019-11-04 | 2021-05-14 | Synthorx, Inc. | Interleukin 10 conjugates and uses thereof |
| US12351850B2 (en) * | 2020-04-30 | 2025-07-08 | Sutro Biopharma, Inc. | Methods of producing full-length antibodies using E. coli |
| IL299074A (en) | 2020-06-25 | 2023-02-01 | Synthorx Inc | Immuno-oncology therapeutic combination with IL-2 and anti-AGFR antibody conjugates |
| US20220089690A1 (en) * | 2020-09-14 | 2022-03-24 | Sutro Biopharma, Inc. | Method for large scale production of antibodies using a cell-free protein synthesis system |
| JP2023546010A (ja) | 2020-10-09 | 2023-11-01 | シンソークス, インコーポレイテッド | Il-2コンジュゲートを用いた免疫腫瘍療法 |
| IL301611A (en) | 2020-10-09 | 2023-05-01 | Synthorx Inc | Immuno oncology combination therapy with il-2 conjugates and pembrolizumab |
| TW202245843A (zh) | 2021-02-12 | 2022-12-01 | 美商欣爍克斯公司 | Il-2接合物及西米普利單抗(cemiplimab)之皮膚癌組合療法 |
| WO2022174102A1 (en) | 2021-02-12 | 2022-08-18 | Synthorx, Inc. | Lung cancer combination therapy with il-2 conjugates and an anti-pd-1 antibody or antigen-binding fragment thereof |
| CN113322267B (zh) * | 2021-03-15 | 2024-01-05 | 天津大学 | 系统在提高非天然氨基酸的插入效率中的应用 |
| EP4346904A1 (en) | 2021-06-03 | 2024-04-10 | Synthorx, Inc. | Head and neck cancer combination therapy comprising an il-2 conjugate and cetuximab |
| EP4452327A1 (en) | 2021-12-20 | 2024-10-30 | Synthorx, Inc. | Head and neck cancer combination therapy comprising an il-2 conjugate and pembrolizumab |
| WO2023122750A1 (en) | 2021-12-23 | 2023-06-29 | Synthorx, Inc. | Cancer combination therapy with il-2 conjugates and cetuximab |
| WO2024136899A1 (en) | 2022-12-21 | 2024-06-27 | Synthorx, Inc. | Cancer therapy with il-2 conjugates and chimeric antigen receptor therapies |
| CN121263208A (zh) | 2023-03-20 | 2026-01-02 | 新索思股份有限公司 | 使用il-2 peg缀合物的癌症疗法 |
| WO2025015041A1 (en) * | 2023-07-12 | 2025-01-16 | University Of Washington | Rna-only, positive control target for clinical diagnostic testing |
| WO2025158385A1 (en) | 2024-01-25 | 2025-07-31 | Genzyme Corporation | Pegylated il-2 for suppressing adaptive immune response to gene therapy |
Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US6977150B2 (en) | 2001-01-25 | 2005-12-20 | Anthony C. Forster | Process and compositions for peptide, protein and peptidomimetic synthesis |
| WO2006082059A1 (en) * | 2005-02-02 | 2006-08-10 | Universität Bayreuth | Esterases for monitoring protein biosynthesis in vitro |
| US7338789B2 (en) | 2002-08-19 | 2008-03-04 | The Board Of Trustees Of The Leland Stanford Junior University | Methods of in vitro protein synthesis |
| WO2010081110A1 (en) | 2009-01-12 | 2010-07-15 | Sutro Biopharma, Inc. | Dual charging system for selectively introducing non-native amino acids into proteins using an in vitro synthesis method |
Family Cites Families (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2000052193A1 (fr) * | 1999-03-04 | 2000-09-08 | Suntory Limited | Procede de controle de clivage par la protease de l'ompt |
| DE10336705A1 (de) * | 2003-08-06 | 2005-03-10 | Rina Netzwerk Rna Technologien | Verfahren zur Herstellung eines Lysats zur zellfreien Proteinbiosynthese |
| US9657323B2 (en) | 2003-09-30 | 2017-05-23 | Daiichi Sankyo Company, Limited | Polypeptide cleavage method using OmpT protease variant |
| BRPI0617191A2 (pt) * | 2005-10-12 | 2011-07-19 | Scripps Research Inst | modificação pós-traducional de polipeptìdeos expressos em fagos |
| WO2007109035A2 (en) * | 2006-03-16 | 2007-09-27 | The Scripps Research Institute | Genetically programmed expression of proteins containing the unnatural amino acid phenylselenocysteine |
| PL2906592T3 (pl) | 2012-10-12 | 2019-07-31 | Sutro Biopharma, Inc. | Proteolityczna inaktywacja wybranych białek w ekstraktach bakteryjnych dla ulepszonej ekspresji |
-
2013
- 2013-10-08 PL PL13779699T patent/PL2906592T3/pl unknown
- 2013-10-08 HU HUE13779699A patent/HUE041721T2/hu unknown
- 2013-10-08 US US14/434,391 patent/US9650621B2/en active Active
- 2013-10-08 KR KR1020157012291A patent/KR102018863B1/ko active Active
- 2013-10-08 EP EP13779699.1A patent/EP2906592B1/en active Active
- 2013-10-08 CN CN201380063443.9A patent/CN104837863B/zh active Active
- 2013-10-08 JP JP2015536826A patent/JP6421122B2/ja active Active
- 2013-10-08 SG SG11201502875VA patent/SG11201502875VA/en unknown
- 2013-10-08 DK DK13779699.1T patent/DK2906592T3/en active
- 2013-10-08 CA CA2887355A patent/CA2887355C/en active Active
- 2013-10-08 AU AU2013329464A patent/AU2013329464C1/en active Active
- 2013-10-08 ES ES13779699.1T patent/ES2694683T3/es active Active
- 2013-10-08 WO PCT/US2013/063804 patent/WO2014058830A1/en not_active Ceased
-
2015
- 2015-04-01 IL IL23809515A patent/IL238095B/en active IP Right Grant
-
2017
- 2017-04-10 US US15/483,766 patent/US10450353B2/en active Active
- 2017-11-29 JP JP2017229231A patent/JP2018029621A/ja not_active Withdrawn
-
2019
- 2019-09-06 US US16/562,837 patent/US11261219B2/en active Active
-
2020
- 2020-10-14 JP JP2020173282A patent/JP2021003134A/ja not_active Withdrawn
Patent Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US6977150B2 (en) | 2001-01-25 | 2005-12-20 | Anthony C. Forster | Process and compositions for peptide, protein and peptidomimetic synthesis |
| US7338789B2 (en) | 2002-08-19 | 2008-03-04 | The Board Of Trustees Of The Leland Stanford Junior University | Methods of in vitro protein synthesis |
| WO2006082059A1 (en) * | 2005-02-02 | 2006-08-10 | Universität Bayreuth | Esterases for monitoring protein biosynthesis in vitro |
| WO2010081110A1 (en) | 2009-01-12 | 2010-07-15 | Sutro Biopharma, Inc. | Dual charging system for selectively introducing non-native amino acids into proteins using an in vitro synthesis method |
Non-Patent Citations (79)
| Title |
|---|
| "Molecular Cloning: A Laboratory Manual", 2012, COLD SPRING HARBOR LABORATORY PRESS |
| "PCR Protocols: A Guide to Methods and Applications", 1990, ACADEMIC PRESS |
| "Peptidomimetics Protocols", vol. 23, 1998 |
| AGER DJ; FOTHERINGHAM IG, CURR. OPIN. DRUG DISCOV. DEVEL., vol. 4, 2001, pages 800 - 807 |
| ALTSCHUL ET AL., J. MOL. BIOL., vol. 215, 1990, pages 403 - 10 |
| ALTSCHUL ET AL., NUCLEIC ACIDS RES., vol. 25, 1997, pages 3389 - 3402 |
| ASYMMETRIC SYNTHESES OF UNNATURAL AMINO ACIDS AND HYDROXYETHYLENE PEPTIDE ISOSTERES, PEPTIDOMIMETICS PROTOCOLS, vol. 23, 1998 |
| AUSUBEL ET AL.: "Short Protocols in Molecular Biology", 2002, WILCY |
| AUSUBEL, F. M. ET AL.: "Current Protocols in Molecular Biology", 2012, JOHN WILEY & SONS |
| BELVISI ET AL., TETRAHEDRON, vol. 57, 2001, pages 6463 - 6473 |
| BERGER; KIMMEL: "Guide to Molecular Cloning Techniques, Methods in Enzymology", vol. 152, 1987, ACADEMIC PRESS, INC. |
| BERJANSKII, M.V. ET AL.: "Application of thc random coil index to studying protein flexibility", JBIOMOL NMR, vol. 40, no. 1, 6 November 2007 (2007-11-06), pages 31 - 48, XP019575767 |
| BINDEREIF; SCH6N; WESTHOF: "Handbook ofRNA Biochemistry", 2005, WILEY- VCH |
| BOAZ ET AL., ORG. PROCESS RES. DEV., vol. 9, 2005, pages 472 - 478 |
| BOLLAG ET AL.: "Protein Methods", 1996, WILEY-LISS |
| BOTO ET AL., J. ORG. CHEM., vol. 72, 2007, pages 7260 - 7269 |
| BUCHNER ET AL., ANAL. BIOCHEM., vol. 205, 1992, pages 263 - 70 |
| CHA, PCR METHODS AND APPLICATIONS, vol. 2, 1992, pages 14 - 20 |
| CHEN, V.B. ET AL.: "MolProbity: all- atom structure validation for macromolecular crystallography", ACTA CRYSTALLOGRAPHICA, vol. D66, 2010, pages 12 - 21 |
| CHEN, V.B. ET AL.: "MolProbity: all-atom structure validation for macromolecular crystallography", ACTA CRYSTALLOGRAPHICA, vol. D66, pages 12 - 21 |
| CHO ET AL., BIOTECHNOL. BIOPROCESS. ENG., vol. 11, 2006, pages 299 - 305 |
| COLIGAN: "Current Protocols in Protein Science", vol. 1, 2000, JOHN WILEY AND SONS, INC. |
| DATSENKO, K. A.; WANNER, B.: "One-step Inactivation of Chromosomal Genes in Escherichia coli K-12 Using PCR Products", PROC. NATL. ACAD. SCI. USA, vol. 97, 2000, pages 6640 - 6645, XP002210218, DOI: doi:10.1073/pnas.120163297 |
| DEBINSKI ET AL., J. BIOL. CHEM., vol. 268, 1993, pages 14065 - 70 |
| DEUTSCHER: "Methods in Enzymology Vol. 182: Guide to Protein Purification", vol. 182, 1990, ACADEMIC PRESS |
| EBERWINE ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 89, 1992, pages 3010 - 3014 |
| EISENBERG, D.; MCLACHLAN, A.D, NATURE, vol. 319, 1986, pages 199 |
| FOLIA MICROBIOL (PRAHA, vol. 54, 2009, pages 509 - 15 |
| FRACZKICWICZ, R.; BRAUN, W.: "Exact and efficient analytical calculation of the accessible surface areas and their gradients for macromolecules", J. COMP. CHE, vol. 19, 1998, pages 319 - 333, XP002596868 |
| FRACZKIEWICZ, R.; BRAUN, W.: "Exact and efficient analytical calculation of the accessible surface areas and their gradients for macromolecules", J. COMP. CHEM., vol. 19, 1998, pages 319 - 333, XP002596868 |
| FU ET AL., J. ORG CHEM., vol. 66, 2001, pages 7118 - 7124 |
| GRAILLE, M.; HEURGUE-HAMARD, V.; CHAMP, S.; MORA, L.; SCRIMA, N.; ULRYCK, N.; TILBCURGH, H.; BUCKINGHAM, R. H.: "Molecular Basis for Bacterial Class I Release Factor Methylation by PrmC", MOLECULAR CELL, vol. 20, 2005, pages 917 - 927 |
| HARLOW; LANE: "Antibodies, A Laboratory Manual", 1988 |
| HENIKOFF; HENIKOFF, PROC. NATL. ACAD. SCI. USA, vol. 89, 1989, pages 10915 |
| HINO N, NAT. PROTOC., vol. 1, 2007, pages 2957 - 2962 |
| HWANG, B.; VARADARAJAN, N.; LI, H.; RODRIGUCZ, S.; IVERSON, B. L.; GEORGIOU, G.: "Substrate Specificity of the Escherichia coli Outer Membrane Protease OmpP", J. BACTERIOL., vol. 189, 2007, pages 522 - 530 |
| INNIS ET AL.: "PCR Protocols: A Guide to Methods and Applications", 1990, ACADEMIC PRESS INC. |
| INNIS: "PCR Protocols", 1990, ACADEMIC PRCSS |
| JANCZUK ET AL., TETRAHEDRON LETT, vol. 43, 2002, pages 4271 - 4274 |
| JEWETT, M.C.; SWARTZ, J.R., BIOTCCHNOL. BIOCNG, vol. 86, 2004, pages 19 - 26 |
| JEWETT, M.C.; SWARTZ, J.R., BIOTECHNOL. BIOENG., vol. 87, 2004, pages 465 - 72 |
| KAMPHUIS ET AL., ANN. N. Y ACAD. SCI., vol. 672, 1992, pages 510 - 527 |
| KARLIN; ALTSCHUL, PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 5873 - 87 |
| KIM, D.M.; SWARTZ, J.R., BIOTCCHNOL. BIOCNG., vol. 66, 1999, pages 180 - 8 |
| KIM, D.M.; SWARTZ, J.R., BIOTECHNOL. BIOENG., vol. 74, 2001, pages 309 - 16 |
| KIM, D.M.; SWARTZ, J.R., BIOTECHNOL. BIOENG., vol. 85, 2004, pages 122 - 29 |
| KIM, D.M.; SWARTZ, J.R., BIOTECHNOL. PROG., vol. 16, 2000, pages 385 - 90 |
| KONG ET AL., J. AM. CHEM. SOC., vol. 127, 2005, pages 11269 - 11276 |
| KOROSTELEV, A. ET AL.: "Recognition of the amber UAG stop codon by release factor RFI", EMBO JOURNAL, vol. 29, 2010, pages 2577 - 2585 |
| KOSKINCN ET AL., TETRAHEDRON LETT., vol. 36, 1995, pages 5619 - 5622 |
| LOVELL, S.C. ET AL., PROTEINS: STRUCTURE, FUNCTION, AND GENETICS, vol. 50, 2003, pages 437 - 450 |
| MAIER TH, NATURE, vol. 21, 2003, pages 422 - 427 |
| MARKLEY, J.L. ET AL., PURE & APPL. CHEM., vol. 70, 1998, pages 117 |
| MCCARTER JOHN D ET AL: "Substrate specificity of the Escherichia coli outer membrane protease OmpT", JOURNAL OF BACTERIOLOGY, AMERICAN SOCIETY FOR MICROBIOLOGY, WASHINGTON, DC; US, vol. 186, no. 17, 1 September 2004 (2004-09-01), pages 5919 - 5925, XP002452676, ISSN: 0021-9193, DOI: 10.1128/JB.186.17.5919-5925.2004 * |
| MCCARTER, J. D.; STEPHENS, D.; SHOEMAKER, K.; ROSENBERG, S.; KIRSCH, J. F.; GEORGIOU, G.: "Substrate Specificity of the Escherichia coli Outer Membrane Protease OmpT", J. BACTERIOL., vol. 186, 2004, pages 5919 - 5925, XP002452676, DOI: doi:10.1128/JB.186.17.5919-5925.2004 |
| PEARSON ET AL., METH. MOL. BIOL., vol. 24, 1994, pages 307 - 331 |
| PROCESS CHEMISTRY IN THE PHARMACEUTICAL INDUSTRY, vol. 2, 2008 |
| SALADINO ET AL., J. ORG. CHEM., vol. 64, 1999, pages 8468 - 8474 |
| SAMBROOK ET AL.: "Molecular Cloning: A Laboratory Manual", 1989, COLD SPRING HARBOR PRESS |
| SHIMIZU ET AL., FEBS JOURNAL, vol. 273, 2006, pages 4133 - 4140 |
| SHRAKE, A; RUPLEY, JA.: "Environment and exposure to solvent of protein atoms. Lysozyme and insulin", JMOLBIOL, vol. 79, no. 2, 1973, pages 351 - 71, XP024014441, DOI: doi:10.1016/0022-2836(73)90011-9 |
| SITARARMAN, K.; ESPOSITO, D.; KLARMANN, G.; GRICE, S. F. L.; HARTLEY, J. L.; CHATTERJEE, D. K: "A Novel Cell-free Protein Synthesis System", J BIOTECHNOL., vol. 110, 2004, pages 257 - 263, XP055101805, DOI: doi:10.1016/j.jbiotec.2004.02.014 |
| SPIRIN; SWARTZ: "Cell-free Protein Synthesis", 2008, WILEY- VCH |
| STRACHAN ET AL., J. ORG. CHERN., vol. 71, 2006, pages 9909 - 9911 |
| SWARTZ ET AL., METHODS MOL BIOL., vol. 267, 2004, pages 169 - 82 |
| SYCHEVA ET AL., MICROBIOLOGY, vol. 76, 2007, pages 712 - 718 |
| TAN CYK; WEAVER DF, TETRAHEDRON, vol. 58, 2002, pages 7449 - 7461 |
| TAN ET AL., METHODS, vol. 36, 2005, pages 279 - 290 |
| TAYLOR ET AL., TRENDS BIOTECHNOL., vol. 16, 1998, pages 412 - 419 |
| VAN GELDER ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 87, 1990, pages 1663 - 1667 |
| VOLOSHIN, A.M.; SWARTZ, J.R., BIOTECHNOL. BIOENG., vol. 91, 2005, pages 516 - 21 |
| WANG ET AL., TETRAHEDRON, vol. 58, 2002, pages 3101 - 3110 |
| WANG F; ROBBINS S; GUO J; SHEN W; SCHULTZ PG., PLOS ONE, vol. 5, 2010, pages E9354 |
| WANG L ET AL., CHEMISTRY AND BIOLOGY, vol. 16, 2009, pages 323 - 336 |
| WANG; CHURCH, METHODS IN ENZYMOLOGY, vol. 498, 2011, pages 409 - 426 |
| WEINER ET AL., CHEM. SOC. REV., vol. 39, 2010, pages 1656 - 1691 |
| WESSON, L.; EISENBERG, D., PROTEIN SCI., vol. 1, 1992, pages 227 |
| YIN, G.; SWARTZ, J.R., BIOTECHNOL. BIOCNG., vol. 86, 2004, pages 188 - 95 |
| ZUEND ET AL., NATURE, vol. 461, 2009, pages 968 - 970 |
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN108949796A (zh) * | 2018-07-27 | 2018-12-07 | 张家港市华天药业有限公司 | 一种用于合成谷胱甘肽的重组菌及谷胱甘肽的合成方法 |
| CN109055291A (zh) * | 2018-07-31 | 2018-12-21 | 张家港市华天药业有限公司 | 用于合成谷胱甘肽的重组菌及谷胱甘肽的合成方法 |
Also Published As
| Publication number | Publication date |
|---|---|
| JP2021003134A (ja) | 2021-01-14 |
| KR102018863B1 (ko) | 2019-09-05 |
| US20170283469A1 (en) | 2017-10-05 |
| US20150259664A1 (en) | 2015-09-17 |
| IL238095A0 (en) | 2015-05-31 |
| JP2015531407A (ja) | 2015-11-02 |
| ES2694683T3 (es) | 2018-12-26 |
| US20200062807A1 (en) | 2020-02-27 |
| AU2013329464A1 (en) | 2015-05-14 |
| CN104837863A (zh) | 2015-08-12 |
| AU2013329464B2 (en) | 2017-07-27 |
| SG11201502875VA (en) | 2015-06-29 |
| KR20150064209A (ko) | 2015-06-10 |
| CA2887355C (en) | 2023-03-07 |
| PL2906592T3 (pl) | 2019-07-31 |
| EP2906592B1 (en) | 2018-10-03 |
| DK2906592T3 (en) | 2018-12-10 |
| US11261219B2 (en) | 2022-03-01 |
| JP6421122B2 (ja) | 2018-11-07 |
| CN104837863B (zh) | 2018-06-19 |
| US10450353B2 (en) | 2019-10-22 |
| EP2906592A1 (en) | 2015-08-19 |
| CA2887355A1 (en) | 2014-04-17 |
| AU2013329464C1 (en) | 2018-02-15 |
| HUE041721T2 (hu) | 2019-05-28 |
| JP2018029621A (ja) | 2018-03-01 |
| US9650621B2 (en) | 2017-05-16 |
| IL238095B (en) | 2019-11-28 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US11261219B2 (en) | Proteolytic inactivation of select proteins in bacterial extracts for improved expression | |
| JP7292442B2 (ja) | 改変アミノアシルtRNA合成酵素およびその用途 | |
| Rother et al. | Identification and characterisation of the selenocysteine-specific translation factor SelB from the archaeon Methanococcus jannaschii | |
| EP2376647B1 (en) | Mono charging system for selectively introducing non-native amino acids into proteins using an in vitro protein synthesis system | |
| JP2011500077A (ja) | 方法及び組成物 | |
| US20160115487A1 (en) | Cell-free synthetic incorporation of non-natural amino acids into proteins | |
| EP3974523A1 (en) | Transaminase mutant and use thereof | |
| KR20170074120A (ko) | 과당으로부터 알로오스를 생산하는 균주 및 이를 이용한 알로오스 생산방법 | |
| Mohanty et al. | Bioprocess optimization for the overproduction of catalytic domain of ubiquitin-like protease 1 (Ulp1) from S. cerevisiae in E. coli fed-batch culture | |
| US20240384267A1 (en) | Compositions and methods for multiplex decoding of quadruplet codons | |
| WO2007061136A1 (ja) | 非天然型アミノ酸を組み込んだタンパク質の製造方法 | |
| JPWO2020067550A1 (ja) | 化合物ライブラリー及び化合物ライブラリーの製造方法 | |
| CN107109446A (zh) | 顺式‑5‑羟基‑l‑哌可酸的制造方法 | |
| KR101646728B1 (ko) | 디제너러시 리프로그래밍을 통한 비천연 단백질 합성 방법 | |
| WO2025063255A1 (ja) | アンモニアリアーゼおよびその用途 | |
| WO2026008852A2 (en) | Optimized media for highly efficient cell-free protein expression systems | |
| Bordewick et al. | Mutagenesis of the L-Amino Acid Ligase RizA Increased the Production of Bioactive Dipeptides. Catalysts 2021, 11, 1385 | |
| Novikov et al. | The highly efficient expression of the aspartase gene (L-aspartate ammonia-lyase) in Escherichia coli cells | |
| JP2023501189A (ja) | ポリアミンコンジュゲート産生酵母 | |
| HK1167003A (en) | Mono charging system for selectively introducing non-native amino acids into proteins using an in vitro protein synthesis system |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 13779699 Country of ref document: EP Kind code of ref document: A1 |
|
| DPE1 | Request for preliminary examination filed after expiration of 19th month from priority date (pct application filed from 20040101) | ||
| WWE | Wipo information: entry into national phase |
Ref document number: 238095 Country of ref document: IL |
|
| ENP | Entry into the national phase |
Ref document number: 2887355 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 14434391 Country of ref document: US |
|
| ENP | Entry into the national phase |
Ref document number: 2015536826 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2013779699 Country of ref document: EP |
|
| ENP | Entry into the national phase |
Ref document number: 20157012291 Country of ref document: KR Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2013329464 Country of ref document: AU Date of ref document: 20131008 Kind code of ref document: A |