WO2014052451A2 - Insulin analog dimers - Google Patents

Insulin analog dimers Download PDF

Info

Publication number
WO2014052451A2
WO2014052451A2 PCT/US2013/061676 US2013061676W WO2014052451A2 WO 2014052451 A2 WO2014052451 A2 WO 2014052451A2 US 2013061676 W US2013061676 W US 2013061676W WO 2014052451 A2 WO2014052451 A2 WO 2014052451A2
Authority
WO
WIPO (PCT)
Prior art keywords
chain
insulin
seq
amino acid
polypeptide
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2013/061676
Other languages
English (en)
French (fr)
Other versions
WO2014052451A3 (en
Inventor
Richard D. Dimarchi
Yan Zhao
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Indiana University Research and Technology Corp
Original Assignee
Indiana University Research and Technology Corp
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Indiana University Research and Technology Corp filed Critical Indiana University Research and Technology Corp
Priority to CA2886228A priority Critical patent/CA2886228A1/en
Priority to JP2015534623A priority patent/JP6387008B2/ja
Priority to US14/431,040 priority patent/US9593156B2/en
Priority to CN201380061231.7A priority patent/CN104981251B/zh
Priority to EP18174352.7A priority patent/EP3395358B1/en
Priority to EP13841334.9A priority patent/EP2900255B1/en
Priority to AU2013323669A priority patent/AU2013323669B2/en
Publication of WO2014052451A2 publication Critical patent/WO2014052451A2/en
Publication of WO2014052451A3 publication Critical patent/WO2014052451A3/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/575Hormones
    • C07K14/62Insulins
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/54Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic compound
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/54Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic compound
    • A61K47/55Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic compound the modifying agent being also a pharmacologically or therapeutically active agent, i.e. the entire conjugate being a codrug
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/56Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule
    • A61K47/59Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule obtained otherwise than by reactions only involving carbon-to-carbon unsaturated bonds, e.g. polyureas or polyurethanes
    • A61K47/60Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule obtained otherwise than by reactions only involving carbon-to-carbon unsaturated bonds, e.g. polyureas or polyurethanes the organic macromolecular compound being a polyoxyalkylene oligomer, polymer or dendrimer, e.g. PEG, PPG, PEO or polyglycerol
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/62Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
    • A61K47/65Peptidic linkers, binders or spacers, e.g. peptidic enzyme-labile linkers
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/08Drugs for disorders of the metabolism for glucose homeostasis
    • A61P3/10Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides

Definitions

  • Insulin is a peptide hormone comprised of a two chain heterodimer that is
  • Human insulin is comprised of two peptide chains (an "A chain” (SEQ ID NO: 1) and "B chain” (SEQ ID NO: 2)) bound together by disulfide bonds and having a total of 51 amino acids.
  • a chain SEQ ID NO: 1
  • B chain SEQ ID NO: 2
  • the C-terminal region of the B-chain and the two terminal regions of the A- chain associate in a three-dimensional structure to assemble a site for high affinity binding to the insulin receptor.
  • Insulin demonstrates unparalleled ability to lower glucose in virtually all forms of diabetes.
  • its pharmacology is not glucose sensitive and as such it is capable of excessive action that can lead to life-threatening hypoglycemia.
  • Inconsistent pharmacology is a hallmark of insulin therapy such that it is extremely difficult to normalize blood glucose without occurrence of hypoglycemia.
  • native insulin is of short duration of action and requires modification to render it suitable for use in control of basal glucose.
  • Established approaches to delay the onset of insulin action include reduction in solubility, and albumin binding.
  • the insulin-like growth factors 1 and 2 are single chain liner peptide hormones that are highly homologous in their A and B chain sequences, sharing approximately fifty percent homology with native insulin.
  • the IGF A and B chains are linked by a "C-peptide", wherein the C-peptides of the two IGFs differ in size and amino acid sequence, the first being twelve and the second being eight amino acids in length.
  • Human IGF-1 is a 70 aa basic peptide having the protein sequence shown in SEQ ID NO: 3, and has a 43% homology with proinsulin (Rinderknecht et al. (1978) J. Biol. Chem. 253:2769-2776).
  • Human IGF-2 is a 67 amino acid basic peptide having the protein sequence shown in SEQ ID NO: 4. The IGFs demonstrate considerably less activity at the insulin B receptor isoform than the A-receptor isoform.
  • IGF-1 based insulin peptides analogs (wherein the native Gln-Phe dipeptide of the B-chain is replaced by Tyr-Leu) that display high activity at the insulin receptor (see PCT/US2009/068713, the disclosure of which is incorporated herein).
  • IGF YL analog peptides are more readily synthesized than insulin and enable the development of co-agonist analogs for insulin and IGF- 1 receptors, and selective insulin receptor specific analogs.
  • these insulin analogs can also be formulated as single chain insulin agonists for use in accordance with the present disclosure (see PCT/US2001/040699, the disclosure of which is incorporated herein).
  • Multimers of insulin and insulin analogs can be formed and used to treat diabetes in a similar fashion as native human insulin.
  • the activity of insulin analog dimers is highly dependent on the size and position where the dimerzing linker joins the two insulin polypeptides.
  • insulin dimers that maintain full inherent potency but only partial maximal responsivity as well as dimers that are selective for the subtype B insulin receptor. Such dimers may offer a more precisely controlled onset and duration of insulin action after clearance from the site of administration and equilibration in the plasma.
  • insulin analog dimers having insulin receptor agonist activity, wherein the level of insulin activity of the dimers is a function of the insulin polypeptide sequences, the site of dimerization and the length of the dimerization linker that connects the two insulin polypeptides.
  • the insulin dimers are formed between a first and second insulin polypeptide wherein each insulin polypeptide comprises an A chain and a B chain.
  • the first and second insulin polypeptides of the dimers disclosed herein can be independently selected from two chain insulin analogs or single chain insulin analogs wherein the first and second insulin polypeptides are covalently linked to one another by a covalent bond or bifunctional linker.
  • the first and second insulin polypeptides can be covalently bound to one another by formation of a covalent bond between two functional groups using standard techniques known to those skilled in the art.
  • the two insulin polypeptides may comprise, or be modified to include, the necessary functional groups to allow the formation of a dimerizing linkage comprising a disulfide linkage, an amide linkage, a thio-ether linkage or an ester linkage.
  • a bifunctional linker is provided to link the first and second insulin polypeptide, wherein the bifunctional linker comprises a hydroxyl group and a carboxylate, or an amine group and a carboxylate or a thiol group and a carboxylate or a thiol group and a thiol group.
  • the first and second insulin polypeptides are linked via a disulfide bond and in an alternative embodiment the first and second insulin polypeptides are linked via a thio-ether bond.
  • the insulin dimer is an insulin super agonist (i.e., have greater activity at the insulin receptor than native insulin) comprising a first and second insulin polypeptide wherein the first and second insulin polypeptide are each two chain insulins. More particularly, the first insulin polypeptide is linked to the second insulin polypeptide via the N- terminal alpha amine of each B chain or via the side chains of the B 1 amino acids of the first and second insulin polypeptides. In one embodiment the first and second insulin polypeptides are linked to one another via a disulfide bond located at the N-terminal alpha amine of each B chain of the respective first and second insulin single chain polypeptides. In one embodiment the A and B chains of the first and second insulin polypeptides are native human insulin A and B chains. In one embodiment an improved method of treating diabetes is provided wherein a patient is administered an insulin super agonist.
  • use of a super agonist allows for the administration of the insulin dimer in a reduced concentration, including at a
  • conjugates can be formed using the super agonist insulin dimer wherein the size of the non-insulin component is reduced in half (relative to what would be used with an insulin monomer) since the non-insulin component would be linked to both the first and second insulin polypeptides comprising the dimer.
  • the first and second insulin are reduced in half (relative to what would be used with an insulin monomer) since the non-insulin component would be linked to both the first and second insulin polypeptides comprising the dimer.
  • polypeptides can be pegylated, wherein the individual PEG chains are 5-10 or 5-20 Kd in size.
  • Administration of reduced concentrations of the insulin super agonist with reduced molecular weight conjugate moieties linked to the first and second insulin polypeptides are anticipated to provide beneficial results from a commercial and therapeutic perspective.
  • the insulin dimer exhibits insulin partial agonist activity. Applicants do not wish to be bound to any one theory, but the partial agonist activity of the insulin dimers disclosed herein is believed to derive from the fact that the dimers exhibit mixed agonist/antagonist activity.
  • an insulin partial agonist dimer is provided comprising a first and second insulin polypeptide wherein the first and second insulin polypeptide are each two chain insulin polypeptides and the first insulin polypeptide is linked to the second insulin polypeptide via the carboxy terminus of each of the B chain, including for example, through an amino acid side chain of an amino acid position independently selected from B26, B27, B28, B29 and B30.
  • the insulin partial agonist has less than 66%, 50%, 40%, 33% or 20% maximal activity at the insulin receptor relative to native insulin.
  • the first and second insulin polypeptides are linked to one another via a disulfide bond between the amino acid side chains of a B Chain C-terminal amino acid (e.g. cysteine) optionally through a linker added to the side chain of a C-terminal amino acid (e.g. B27-B30).
  • the first and second insulin polypeptide are linked via a disulfide bond formed between the amino acid side chains of the respective B29 amino acids of the first and second insulin polypeptides.
  • the B29 amino acid is a modified lysine with a side chain of Structure I: and the first and second insulin polypeptides are linked via a disulfide bond.
  • the A and B chains of the first and second insulin polypeptides are native human insulin A and B chains.
  • an insulin dimer that exhibits insulin partial agonist activity wherein at least one of the first and second insulin polypeptides is a single chain insulin and the first and second insulin polypeptides are linked to one another via an amino acid side chain of the linking moiety of the single chain insulin polypeptide and the N-terminal alpha amine, or the side chain of an N-terminal amino acid, of the B chain of the second insulin polypeptide.
  • the first and second insulin polypeptides are joined via a linker (e.g.
  • first and second insulin polypeptides each comprise a modified lysine having a side chain of Structure I: SH an d the first and second insulin polypeptides are linked via a disulfide bond.
  • both the first and the second insulin polypeptides are single chain insulin polypeptides with the B chain linked to the A chain via a linking moiety and insulin dimer formed by linking an amino acid side chain of each of the respective linking moieties of the first and second insulin polypeptides to one another.
  • the first and second insulin polypeptides comprise a B chain and A chain of human insulin, or analogs or derivatives thereof.
  • the side chain of the amino acid at position 8 of the linking moiety of the single chain insulin polypeptide is linked to N-terminal amino acid of the B chain of the second insulin polypeptide (i.e., a B1-C8 linkage).
  • the dimer comprises a human insulin polypeptide linked to an IGF1 or IGF II, or analog thereof, via a Bl to C8 linkage.
  • one or both of the insulin polypeptides of the insulin dimers disclosed herein further comprises a self-cleaving dipeptide element (U-B) covalently linked to an N-terminal alpha amine or side chain amine of an amino acid of the first or second insulin polypeptide of the dimer via an amide or ester linkage (see International applications
  • the prodrug element comprises a dipeptide of the structure U-B, wherein U is an amino acid or a hydroxy acid, B is an N- alkylated amino acid linked to said single chain insulin agonist through an amide bond between a carboxyl moiety of B and an amine of an insulin polypeptide, wherein U, B, or the amino acid of the single chain insulin agonist to which U-B is linked is a non-coded amino acid.
  • insulin agonist dimers are encompassed by the present disclosure including modifications that improve the solubility of the underlying insulin polypeptides.
  • solubility of the insulin polypeptides is enhanced by the covalent linkage of a hydrophilic moiety to the N-terminus of the A or B chain or to a side chain of an amino acid of one or both of the first and second insulin polypeptides, including the linkage to a side chain of an amino acid of the linking peptide of single chain insulin polypeptides.
  • the hydrophilic moiety is linked to the side chain of an amino acid at a position selected from the group consisting of A9, A14 and A15 of the A chain or positions Bl, B2, B10, B22, B28 or B29 of the B chain.
  • the hydrophilic moiety is a polyethylene glycol chain, an acyl group or an alkyl group.
  • the hydrophilic moiety is albumin, including for example, albumins such as human serum albumin (HSA) and recombinant human albumin (rHA).
  • HSA human serum albumin
  • rHA recombinant human albumin
  • the hydrophilic moiety is a polyethylene glycol (PEG) chain, having a molecular weight selected from the range of about 500 to about 40,000 Daltons.
  • the polyethylene glycol chain has a molecular weight selected from the range of about 500 to about 5,000 Daltons.
  • the polyethylene glycol chain has a molecular weight of about 10,000 to about 20,000 Daltons.
  • Acylation or alkylation can increase the half-life of the insulin polypeptides in circulation. Acylation or alkylation can advantageously delay the onset of action and/or extend the duration of action at the insulin receptors.
  • the insulin analogs may be acylated or alkylated at the same amino acid position where a hydrophilic moiety is linked, including for example, at position 8 of the linking moiety or on the side chain of an amino acid comprising a self-cleaving dipeptide element.
  • compositions comprising the insulin dimers disclosed herein, and a pharmaceutically acceptable carrier.
  • a pharmaceutical composition comprising any of the insulin dimers disclosed herein, preferably at a purity level of at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99%, and a pharmaceutically acceptable diluent, carrier or excipient.
  • Such compositions may contain an insulin dimer as disclosed herein at a
  • the pharmaceutical compositions comprise aqueous solutions that are sterilized and optionally stored within various package containers.
  • the pharmaceutical compositions comprise a lyophilized powder.
  • compositions can be further packaged as part of a kit that includes a disposable device for administering the composition to a patient.
  • the containers or kits may be labeled for storage at ambient room temperature or at refrigerated temperature.
  • an improved method of regulating blood glucose levels in insulin dependent patients is provided, and more particularly, a method of treating diabetes with a reduced risk of hypoglycemia is provided.
  • the method comprises the steps of administering to a patient a partial insulin agonist dimer in an amount therapeutically effective for the control of diabetes.
  • the partial agonist insulin dimer comprises a first and second insulin polypeptide that are linked to one another through a dimerization linker, wherein the first and second insulin polypeptides each independently comprise an insulin polypeptide selected from the group consisting of
  • a two chain insulin analog comprising an A chain and a B chain linked via interchain disulfide bonds
  • a single chain insulin analog comprising an A chain, a B chain and a linking moiety, wherein a first end of said linking moiety is covalently bound to the carboxy terminus of the B chain and a second end of said linking moiety is covalently bound to the amino terminus of the A chain.
  • the A chain comprises a sequence of GIVX4X5CCX 8 X9X 1 oCX 1 2LXi4Xi5LEXi 8 Xi9CX2i-Ri3 (SEQ ID NO: 70), the B chain comprises a sequence of X25LCGX2 9 X30LVX33X34LYLVCGX41X42GFX45 (SEQ ID NO: 44); and
  • first and second insulin polypeptides are linked to one another via the side chain of the amino acids at position B29 of the respective first and second insulin polypeptides;
  • At least one of said first and second insulin polypeptides is a single chain insulin polypeptide and the first and second insulin polypeptides are linked to one another via the side chain of the amino acid at position Bl of one of said first and second insulin
  • polypeptides and the side chain of an amino acid of said linking moiety are polypeptides and the side chain of an amino acid of said linking moiety
  • both the first and second insulin polypeptides are single chain insulin polypeptides and the first and second insulin polypeptides are linked to one another via the side chain of amino acids of the linking moieties moiety of the respective first and second insulin polypeptides.
  • the partial agonist dimers exhibit a decreased maximal dose response, thus applicants anticipate they will decrease the risk of hypoglycemia upon administration to a patient.
  • insulin dimers are provided that are selective for the subtype B insulin receptor (IR-B).
  • IR-B subtype B insulin receptor
  • a dimer formed between an insulin based polypeptide and a polypeptide e.g., IGF I or IGF II
  • a polypeptide e.g., IGF I or IGF II
  • IGF I or IGF II e.g., IGF I or IGF II
  • IGF I or IGF II e.g., IGF I or IGF II
  • insulin dimers are provided that are selective for the subtype B insulin receptor.
  • the dimer comprises a first and second insulin polypeptide, each of which are single chain insulin polypeptides comprising an A chain, a B chain and a linking moiety, wherein a first end of said linking moiety is covalently bound to the carboxy terminus of the B chain and a second end of said linking moiety is covalently bound to the amino terminus of the A chain, wherein
  • the first insulin polypeptide comprises
  • a first linking moiety comprising a sequence selected from the group consisting of PEG8-K-PEG4 and GYGSSSRX 68 APQT (SEQ ID NO: 9), and
  • the second polypeptide comprises
  • AYRPSETLCGGELVDTLQFVCGDRGFYFSRPA SEQ ID NO: 87
  • GPETLCGAELVDALQFVCGDRGFYFNKPT SEQ ID NO: 10
  • a second linking moiety comprising a sequence selected from the group consisting of PEG8-K-PEG4 and GYGSSSRX 68 APQT (SEQ ID NO: 9), wherein
  • X 6 8 is arginine, ornithine, lysine or an amino acid comprising a side chain of Structure I:
  • X 7 5 is lysine or arginine; and m is an integer selected from 1-4, and R15 is H or NH 2 further wherein
  • the first and second insulin polypeptides are linked to one another via (i) the N terminal amine or side chain of the N-terminal amino acid of one of said first or second insulin polypeptide and the side chain of the linking moiety of the other insulin polypeptide or (ii) the side chain of an amino acid of each respective the linking moiety of the first and second insulin polypeptide .
  • Fig. 1. is a schematic overview of the two step synthetic strategy for preparing human insulin. Details of the procedure are provided in Example 1.
  • Fig. 2 is a graph comparing insulin receptor specific binding of synthetic human insulin relative to purified native insulin.
  • the synthetic insulin was produced by the approach detailed in Figure 1 where the A 7 -B 7 bond is the first disulfide formed. As indicated by the data presented in the graph, the two molecules have similar binding activities.
  • Fig. 3 is a graph comparing relative insulin receptor binding of native insulin and the
  • IGF1(Y B 16 L B 17 ) analog As indicated by the data presented in the graph, the two molecules have similar binding activities.
  • Fig. 4 is an alignment of the human proinsulin (A chain, SEQ ID NO: 1; B chain, SEQ ID NO: 2 and the C chain, SEQ ID NO: 92) and insulin-like growth factors I and II (IGF I; SEQ ID NO: 3 and IGF II; SEQ ID NO: 4) amino acid sequences.
  • the alignment demonstrates that these three peptides share a high level of sequence identity (* indicates a space with no corresponding amino acid and a dash (-) indicates the identical amino acid as present in insulin).
  • Fig. 5A & 5B are graphs depicting the in vitro activity of the prodrug dK,(N-isobutylG)- IGF1YL (SEQ ID NO: 86, with dipeptide linked through the A19 4-aminoPhe).
  • Fig 5A is a graph comparing relative insulin receptor binding of native insulin and the A19 IGF prodrug derivative (IGFIYL: dK,(N-isobutylG) over time (0 hours, 5 hours and 52 hours) incubated in PBS.
  • Fig 5B is a graph comparing relative insulin receptor binding of native insulin and the A19 IGF prodrug derivative (IGFIYL: dK,(N-isobutylG) over time (0 hours, 3.6 hours and 24.8 hours) incubated in 20% plasma/PBS at 37° C. As indicated by the data presented in the graph, increased activity is recovered from the A19 IGF prodrug derivative sample as the prodrug form is converted to the active IGFIYL peptide.
  • IGFIYL dK,(N-isobutylG
  • Fig. 6 is a bar graph depicting the relative in vitro binding activity and phosphorylation activity of single chain B°C 1 A° insulin analogs at the A subtype insulin.
  • the activity of the native IGF-1 C peptide (010) relative to various amino acid substitutions or deletions in the C peptide linking moiety was compared.
  • the B°C 1 A° insulin analog nomenclature the B° and A 0 designations refer to the native insulin sequences of the A and B chain, while C 1 designates the IGF-1 C peptide.
  • Fig. 7 is a bar graph depicting the relative in vitro binding activity and phosphorylation activity of single chain B°C 1 A° insulin analogs at the A subtype insulin wherein the native sequence of the linking IGF-1 C peptide has been modified by the indicated amino acid substitutions at position 1, 2, 3, 4 or 8.
  • This data in conjunction with the data provided in Fig. 8 demonstrate the consistency between the binding and phosphorylation activity of the insulin analogs.
  • Figs. 8A-8C relate to single chain insulin analogs that use a PEG polymer as the linking moiety.
  • Fig. 8A is a schematic drawing showing the preparation of an IGF-1 YL single chain insulin analog that uses a PEG polymer as the linking moiety.
  • Figs. 7 is a bar graph depicting the relative in vitro binding activity and phosphorylation activity of single chain B°C 1 A° insulin analogs at the A subtype insulin wherein the native sequence of the linking IGF-1 C peptide has been modified by the indicated amino acid substitutions at position 1, 2,
  • FIG. 8B & 8C are graphs depicting the relative in vitro binding activity (Fig. 8B) and phosphorylation activity (Fig. 8C) of single chain insulin analogs linked via a 4, 8 or 16 monomeric PEG linking moiety relative to the native insulin heteroduplex.
  • Figs. 9A-9D are graphs showing the results of comparative insulin tolerance tests conducted on mice comparing the ability of human insulin to reduce and sustain low blood glucose concentration relative to three different acylated insulin analogs.
  • the polypeptides were tested at two different concentrations (27 nmol/kg and 90nmol/kg).
  • the acylated insulins included MIU-41, MIU-36 and MIU-37.
  • MIU-41 [B 1 (H5,H10,Y16,L17)26A : ⁇ , ⁇ - K14,N18,N21)], is a two chain insulin analog having a C16 acylation via a gamma glutamic acid linker attached to a lysine residue located at position A14.
  • MIU-36 [ ⁇ - K0,H5,H10,Y16,L17)26A : ⁇ , ⁇ )] is a two chain insulin analog having a C16 acylation linked to the N-terminus of the B chain).
  • MIU-37 [B 1 (H5,H10,Y16,L17,C16rE-K22)26A :
  • a 1 (N18,N21)] is a two chain insulin analog having a C16 acylation via a gamma glutamic acid linker attached to a lysine residue located at position B22.
  • Figs. 10A-10D represents the results obtained from a comparative insulin tolerance test for Detemir and MIU-56 using C57/Blk mice.
  • MIU-56 is an insulin single chain analog B 1 (H5,Y16,L17)26A-PEG8-K-PEG4-A 1 (N18,21) comprising a 20 kDa PEG linked to the side chain of the single lysine residue in the linking moiety ( PEG8-K-PEG4) that joins the A chain and the B chain.
  • Figs. 10A and 10B are graphs showing the results of insulin tolerance tests comparing the ability of the acylated insulin analog Detemir relative to the pegylated single chain insulin analog MIU-56 to reduce and maintain low blood glucose levels.
  • Figs IOC and 10D show the blood glucose AUC 2 4 hrs in mice administered Detemir and MIU-56, respectively.
  • Figs. 11A-11E Receptor activities of the B29-B29' insulin dimer (polypeptide #51, a dimer formed between two native insulin polypeptides linked together by a disulfide bond between the side chains of the B29 lysine of the B chains) were tested at the type A insulin receptor (see Fig. 11A); the type B insulin receptor (see Fig. 1 IB) and the IGF-1 receptor (see Fig. 11C) by phosphorylation assay and mitogenicity tested by HMEC proliferation assay (see Fig. 1 ID) in vitro.
  • the solid line on the graphs represents: Type A or Type B receptor phosphorylation (on Figs.
  • FIG. 11A -1 IB shows the structure of the B29-B29' insulin.
  • the dimer has been modified relative to native insulin in that the N-terminus of the A and B chains have been carbamylated as well as the lysine at position B29 to allow the attachment of sulfhydyl linkers for forming the disulfide bond at B29.
  • the two insulin polypeptides each comprising a native human insulin A chain and B chain linked to one another by the native insulin disulfides (A6-A11, A7-B7, A20-B19) that are not shown but are resident in the dimer form.
  • Figs. 12A & 12B provide data from a comparative insulin dose titration of the B29-B29' insulin dimer (Fig. 12B) relative to native insulin (Fig. 12A).
  • Native insulin was administered at three dosages (6 nmoles/kg, 18 nmoles/kg and 72 nmoles/kg) and the B29-B29' insulin dimer was administered at three higher dosages (18 nmoles/kg, 72 nmoles/kg and 144 nmoles/kg). Similar to native insulin, the B29-B29' insulin dimer lowers blood glucose levers, but the B29- B29' insulin dimer has a less steep initial lowering of glucose and holds the blood glucose levels at a more even plateau than is seen with native glucose.
  • Figs. 13A-13C demonstrates the in vitro insulin activity for the Bl- ⁇ insulin dimer.
  • Fig. 13A shows the synthesis of the Bl- ⁇ insulin dimer wherein two single chain insulin analogs are linked via a disulfide bond through the Bl amino acid side chain. The initial dimer is inactive since the A china is directly linked to the carboxy terminus of the B chain. However upon cleavage of the single chain entity with trypsin, thus converting the single chain insulin analogs into two chain insulin analogs and forming an insulin dimer comprising two chain insulin polypeptides, activity is restored, Fig.
  • FIG. 13B shows the relative in vitro activity of native insulin, the Bl- ⁇ insulin dimer (after cleavage with trypsin) and the B29-B29' insulin dimer at the type A insulin receptor.
  • the Bl- ⁇ insulin dimer (after cleavage with trypsin) is a full insulin agonist with greater potency than native insulin.
  • the ⁇ 1- ⁇ insulin dimer has activity at both the type A and Type B insulin receptors and replacement of the histidine with the native arginine at position B22 has no significant impact on activity.
  • Fig. 14A-14C represents the results obtained from a comparative insulin tolerance test for the Bl- ⁇ and B29-B29' insulin dimers using C57/Blk mice.
  • Human insulin was administered at a dose of 12 or 60 nmoles/kg (Fig. 14A); and the Bl- ⁇ insulin dimer and the B29-B29' insulin dimer was administered at a dose of 12, 60 or 300 nmoles/kg (Fig. 14B and 14C, respectively).
  • Results from the in vivo experiments show that the Bl- ⁇ insulin dimer appears to be about 5 times more potent than native insulin (the glucose lowering profile of 12 nmole/kg Bl-Bl 'insulin dimer compares similarly to 60 nmole/kg of native insulin).
  • the B29-B29' insulin dimer appears to be only about 20% as potent as native insulin (the glucose lowering profile of 60 nmole/kg of native insulin compares similarly to 300 nmole/kg of the B29-B29' insulin dimer).
  • Fig. 15A & 15B present data obtained from insulin tolerance tests of PEGylated monomer and PEGylated Bl- ⁇ dimer of an IFG 1 single chain insulin analog.
  • the dimer comprises two single chain insulin polypeptides each comprising an A chain and B chain linked via a C 1 peptide (the C peptide being modified to contain a lysine at position 8), wherein the two insulin polypeptides are joined via a PEG 20 dimerizing linker joining the N-terminal amino acid of the two respective insulin polypeptides.
  • Fig. 16A-16C demonstrates the in vitro insulin activity for an insulin agonist dimer formed between two single chain IGF- 1 insulin agonist analogs wherein the first and second insulin agonist analog polypeptides comprising the dimer each have an A chain, a B chain and a C-peptide, wherein the N-terminus of the A chain is linked to the C-terminus of the B chain via the C-peptide and the two single chain IGF-1 insulin agonist analogs are linked to one another via a disulfide bond between the side chain of the two C8 amino acids.
  • Fig. 16A shows the general structure of the C8-C8' IGF-1 analog dimer.
  • FIG. 16B shows results of in vitro activity of the C8-C8' IGF-1 analog dimer at the subtype A insulin receptor.
  • the C8-C8' IGF-1 analog dimer has an appreciably reduced (approximately 75%) maximal dose response relative to native insulin (see Fig. 16B, T).
  • the C8-C8' IGF-1 analog dimer has antagonist properties (see Fig. 16B, ⁇ ).
  • Fig. 16C demonstrates that the C8-C8' IGF-1 analog dimer retains selectivity for the insulin receptor relative to the IGF- 1 receptor.
  • Figs. 17A-17D demonstrate the activities of an insulin dimer comprising two single chain IGF-1 insulin agonist analogs wherein the A chain and the B chain are linked via a mini- peg linking moiety (PEGg-K-PEG 4 ) and the two insulin polypeptides are joined via the lysine side chain of the respective linking moieties (LysC8-LysC8 dimer of B1[[H5Y16L17]25- PEG8KPEG4-A1[N18,21]; polypeptide #53).
  • Activity was tested at the subtype A insulin receptor (see Fig. 17A); the subtype B insulin receptor (see Fig. 17B) and the IGF-1 receptor (see Fig.
  • FIG. 17C by phosphorylation assay, and receptor binding affinity tested by subtype A insulin receptor binding assay (see Fig. 17D) in vitro.
  • the solid line on the graphs represents: subtype A or subtype B receptor phosphorylation (on Figs. 17A -17B, respectively) stimulated by indicated concentrations of native insulin ( ⁇ ) or #53 ( ⁇ ); the dashed line represents: subtype A; or subtype B receptor phosphorylation (on Figs. 17A -17B, respectively) stimulated by co- incubating 6 nM insulin and indicated concentrations of insulin ( ⁇ ) or #53 ( ⁇ ).
  • Figs. 18A & 18B demonstrates the activities of an insulin dimer comprising two single chain IGF-1 insulin agonist analogs wherein the A chain and the B chain are linked via the C 1 peptide modified to contain a lysine at position 8 of the C peptide, wherein and the two insulin polypeptides are joined via the lysine side chain of the respective linking moieties (LysC8- LysC8 dimer of B1[[H5,10Y16L17]25-C1[K8]-A1[H8N18,21]; polypeptide #54).
  • Activity was tested at the subtype A insulin receptor (see Fig. 18A); and the subtype B insulin receptor (see Fig. 18B) by phosphorylation assay in vitro.
  • Subtype A or subtype B receptor see Fig. 18A
  • phosphorylation on Figs. 18A -18B, respectively stimulated by indicated concentrations of native insulin ( ⁇ ) or #53 ( ⁇ ) is shown.
  • Figs. 19A-19D demonstrates the activities of an insulin dimer comprising two IGF-1 insulin agonist analogs.
  • Fig. 19A provides the structure of an insulin dimer formed between a first inactive insulin polypeptide and a second insulin polymer via a disulfide bond formed between the side chain of the N-terminal amino acid of the first inactive insulin polymer and the side chain of the C8 amino acid of the second single chain IGF-1 insulin agonist analog.
  • the first insulin polypeptide is inactive since the A chain has been fused directly to the B chain.
  • this polypeptide is an insulin antagonist.
  • a dimer formed using the same B0-C8 linkage between two active insulin polypeptides has been discovered to exhibit partial agonist and antagonist activity.
  • Fig. 19C shows the structure of a dimer formed between a single chain IGF-1 insulin agonist and a two chain IGF-1 insulin agonist wherein the two insulin polypeptides are linked by a disulfide bond between the side chain of the N-terminal amino acid of the first insulin polypeptide and the side chain of the C8 amino acid of the second insulin polypeptide.
  • this polypeptide exhibits insulin partial agonist and antagonist activity.
  • Figs. 20A-20D demonstrate the activities of an insulin heterodimer comprising two different insulin polypeptides.
  • Polypeptide #59 represents a dimer formed between a first insulin polypeptide comprising an inactive IGF 1 analog (B 1 [[C1H5Y16L17K29]29- ⁇ ]; inactivity due to the direct connection of the A chain to the carboxy terminus of B chain) and a second active single chain IGF 1 analog (B 1 [H5Y16L17]25-PEG 8 KPEG 4 - ⁇ ]) wherein the A chain and B chain are linked via a mini-peg linking moiety (PEGg- K-PEG 4 ) and the two insulin polypeptides are joined via the lysine side chain of the linking moiety and the Bl amino acid side chain of the inactive insulin polypeptide.
  • Polypeptide #60 is identical to polypeptide to polypeptide #59 except the inactive insulin peptide has been cleaved with trypsin to generate a two chain IGF 1 insulin analog with insulin activity being restored to the polypeptide.
  • Activity was tested at the type A insulin receptor (see Fig. 20A); the type B insulin receptor (see Fig. 20B) and the IGF-1 receptor (see Fig. 20C) by phosphorylation assay, and receptor binding affinity tested by subtype A insulin receptor binding assay (see Fig. 20D) in vitro.
  • the solid line on the graphs represents: subtype A or subtype B receptor
  • Figs. 20A -20B phosphorylation (on Figs. 20A -20B, respectively) stimulated by indicated concentrations of native insulin ( ⁇ ) #53 ( ⁇ ) or #60 ( A ); the dashed line represents: subtype A; or subtype B receptor phosphorylation (on Figs. 20A -20B, respectively) stimulated by co-incubating 6 nM insulin and indicated concentrations of insulin ( ⁇ ) or #53 ( ⁇ ).
  • Fig. 21A-21E demonstrate the activities of an insulin heterodimer comprising an insulin polypeptide dimerized with an IGF2 polypeptide. Receptor activities of polypeptide #61 (B°25- C ⁇ A 0 linked to B 2 -C 2 [K8]-A 2 -D 2 [R4]) and polypeptide #62 ( ⁇ °25- ⁇ [ ⁇ 8]- ⁇ ° linked to B 2 -C 2 -
  • a 2 -D 2 were tested at the subtype A insulin receptor (see Fig. 21A and 21C); the subtype B insulin receptor (see Fig. 21B and 21D) and the IGF-1 receptor (see Fig. 21E) by
  • the graphs represents: subtype A or subtype B receptor phosphorylation stimulated by indicated concentrations of native insulin ( ⁇ ) #53 or #60 ( ⁇ ).
  • Fig. 22A Synthetic Scheme for the preparation of compound #48 (CysBl-CysBl #2 dimer; see Tables 15-17).
  • Fig. 22B Synthetic Scheme for the preparation of compound #49 (PheBl-PheBl #28 dimer; see Tables 15-17).
  • Fig. 22C Synthetic Scheme for the preparation of compound #51 (LysB29-LysB29 insulin dimer; see Tables 15-17).
  • Fig. 22D Synthetic Scheme for the preparation of compound #52 (LysB29-LysB29 MIU-3* dimer; see Tables 15-17).
  • Fig. 22E Synthetic Scheme for the preparation of compound #53 (LysC8-LysC8 #3 dimer; see Tables 15-17).
  • Fig. 22F Synthetic Scheme for the preparation of compound #55 (LysBl-LysBl #20* dimer; see Tables 15-17).
  • Fig. 22G Synthetic Scheme for the preparation of compound #56 (LysBl-LysBl #11 dimer; see Table 15-17).
  • Fig. 22H Synthetic Scheme for the preparation of compound #58 (LysC8-PEG20K- LysC8 #3 dimer; see Table 15-17).
  • Fig. , 23A Synthetic scheme for the preparation of compound Bl-thiol-activated insulin analog #2.
  • Fig. , 23B Synthetic scheme for the preparation of compound C8-thiol-modified insulin analog #3.
  • Fig. , 24A Synthetic scheme for the preparation of dimer #59 (see Table 18 for compound structure).
  • Fig. , 24B Synthetic scheme for the preparation of dimer #60 (see Table 18 for compound structure).
  • Fig. , 25A Synthetic scheme for the preparation of Bl-thiol-activated insulin analog #27.
  • Fig. , 25B Synthetic scheme for the preparation of C8-thiol-modified IGF-2 analog #31.
  • Fig. , 25C Synthetic scheme for the preparation of dimer #61 (see Table 18 for compound structure).
  • Fig. , 26A Synthetic scheme for the preparation of C8-thiol-activated insulin analog
  • Fig. , 26B Synthetic scheme for the preparation of Bl-thiol-modified IGF-2.
  • Fig. , 26C Synthetic scheme for the preparation of dimer #62 (see Table 18 for compound structure).
  • prodrug is defined as any compound that undergoes chemical modification before exhibiting its pharmacological effects.
  • amino acid encompasses any molecule containing both amino and carboxyl functional groups, wherein the amino and carboxylate groups are attached to the same carbon (the alpha carbon).
  • the alpha carbon optionally may have one or two further organic substituents.
  • designation of an amino acid without specifying its stereochemistry is intended to encompass either the L or D form of the amino acid, or a racemic mixture.
  • the D form of the amino acid is specified by inclusion of a lower case d before the three letter code and superscript number (e.g., dLys "1 ), wherein the designation lacking the lower case d (e.g., Lys -1 ) is intended to specify the native L form of the amino acid.
  • a lower case d before the three letter code and superscript number
  • the designation lacking the lower case d e.g., Lys -1
  • the inclusion of the superscript number designates the position of the amino acid in the insulin analog sequence, wherein amino acids that are located within the insulin analog sequence are designated by positive superscript numbers numbered consecutively from the N-terminus.
  • Additional amino acids linked to the insulin analog peptide either at the N-terminus or through a side chain are numbered starting with 0 and increasing in negative integer value as they are further removed from the insulin analog sequence.
  • the position of an amino acid within a dipeptide prodrug linked to the N-terminus of an insulin analog is designated aa _1 -aa°- insulin analog, wherein aa° represents the carboxy terminal amino acid of the dipeptide and aa "1 designates the amino terminal amino acid of the dipeptide.
  • hydroxyl acid encompasses amino acids that have been modified to replace the alpha carbon amino group with a hydroxyl group.
  • non-coded amino acid encompasses any amino acid that is not an L-isomer of any of the following 20 amino acids: Ala, Cys, Asp, Glu, Phe, Gly, His, He, Lys, Leu, Met, Asn, Pro, Gin, Arg, Ser, Thr, Val, Trp, Tyr.
  • a “dipeptide” is a compound formed by linkage of an alpha amino acid or an alpha hydroxyl acid to another amino acid, through a peptide bond.
  • bioactive polypeptide refers to polypeptides which are capable of exerting a biological effect in vitro and/or in vivo.
  • a general reference to a peptide/polypeptide is intended to encompass peptides/polypeptides that have modified amino and carboxy termini.
  • an amino acid sequence designating the standard amino acids is intended to encompass standard amino acids at the N- and C- terminus as well as a corresponding hydroxyl acid at the N-terminus and/or a corresponding C-terminal amino acid modified to comprise an amide group in place of the terminal carboxylic acid.
  • an "acylated" amino acid is an amino acid comprising an acyl group which is non-native to a naturally-occurring amino acid, regardless by the means by which it is produced.
  • exemplary methods of producing acylated amino acids and acylated peptides are known in the art and include acylating an amino acid before inclusion in the peptide or peptide synthesis followed by chemical acylation of the peptide.
  • the acyl group causes the peptide to have one or more of (i) a prolonged half-life in circulation, (ii) a delayed onset of action, (iii) an extended duration of action, (iv) an improved resistance to proteases, such as DPP-IV, and (v) increased potency at the IGF and/or insulin peptide receptors.
  • an "alkylated” amino acid is an amino acid comprising an alkyl group which is non-native to a naturally-occurring amino acid, regardless of the means by which it is produced.
  • exemplary methods of producing alkylated amino acids and alkylated peptides are known in the art and including alkylating an amino acid before inclusion in the peptide or peptide synthesis followed by chemical alkylation of the peptide.
  • alkylation of peptides will achieve similar, if not the same, effects as acylation of the peptides, e.g., a prolonged half-life in circulation, a delayed onset of action, an extended duration of action, an improved resistance to proteases, such as DPP-IV, and increased potency at the IGF and/or insulin receptors.
  • the term "pharmaceutically acceptable carrier” includes any of the standard pharmaceutical carriers, such as a phosphate buffered saline solution, water, emulsions such as an oil/water or water/oil emulsion, and various types of wetting agents.
  • the term also encompasses any of the agents approved by a regulatory agency of the US Federal government or listed in the US Pharmacopeia for use in animals, including humans.
  • pharmaceutically acceptable salt encompasses salts of compounds that retain the biological activity of the parent compound, and which are not biologically or otherwise undesirable. Many of the compounds disclosed herein are capable of forming acid and/or base salts by virtue of the presence of amino and/or carboxyl groups or groups similar thereto.
  • hydrophilic moiety encompasses any compound that is readily water-soluble or readily absorbs water, and which are tolerated in vivo by mammalian species without toxic effects (i.e. are biocompatible).
  • hydrophilic moieties include polyethylene glycol (PEG), polylactic acid, polyglycolic acid, a polylactic-polyglycolic acid copolymer, polyvinyl alcohol, polyvinylpyrrolidone, polymethoxazoline, polyethyloxazoline, polyhydroxyethyl methacrylate, polyhydroxypropyl methacrylamide, polymethacrylamide, polydimethylacrylamide, and derivatised celluloses such as hydroxymethylcellulose or hydroxyethylcellulose and co-polymers thereof, as well as natural polymers including, for example, albumin, heparin and dextran.
  • treating includes prophylaxis of the specific disorder or condition, or alleviation of the symptoms associated with a specific disorder or condition and/or preventing or eliminating said symptoms.
  • treating diabetes will refer in general to maintaining glucose blood levels near normal levels and may include increasing or decreasing blood glucose levels depending on a given situation.
  • an "effective" amount or a “therapeutically effective amount” of an insulin analog refers to a nontoxic but sufficient amount of an insulin analog to provide the desired effect.
  • one desired effect would be the prevention or treatment of hyperglycemia.
  • the amount that is "effective” will vary from subject to subject, depending on the age and general condition of the individual, mode of administration, and the like. Thus, it is not always possible to specify an exact “effective amount.” However, an appropriate
  • parenteral means not through the alimentary canal but by some other route such as intranasal, inhalation, subcutaneous, intramuscular, intraspinal, or intravenous.
  • references to a particular amino acid position by letter and number refer to the amino acid at that position of either the A chain (e.g. position A5) or the B chain (e.g. position B5) in the respective native human insulin A chain (SEQ ID NO: 1) or B chain (SEQ ID NO: 2), or the corresponding amino acid position in any analogs thereof.
  • a reference herein to "position B28" absent any further elaboration would mean the corresponding position B27 of the B chain of an insulin analog in which the first amino acid of SEQ ID NO: 2 has been deleted.
  • amino acids added to the N-terminus of the native B chain are numbered starting with BO, followed by numbers of increasing negative value (e.g., B-l, B-2...) as amino acids are added to the N-terminus.
  • any reference to an amino acid position in the linking moiety of a single chain analog is made in reference to the native C chain of IGF 1 (SEQ ID NO: 17).
  • position 9 of the native C chain (or the "position C9") has an alanine residue.
  • native human insulin peptide is intended to designate the 51 amino acid heteroduplex comprising the A chain of SEQ ID NO: 1 and the B chain of SEQ ID NO: 2, as well as single-chain insulin analogs that comprise SEQ ID NOS: 1 and 2.
  • insulin polypeptide as used herein, absent further descriptive language is intended to encompass the 51 amino acid heteroduplex comprising the A chain of SEQ ID NO: 1 and the B chain of SEQ ID NO: 2, as well as single-chain insulin analogs thereof (including for example those disclosed in published international application W096/34882 and US Patent No.
  • heteroduplexes and single-chain analogs that comprise modified analogs of the native A chain and/or B chain and derivatives thereof (e.g. IGF1 and IGF2) that have activity at the insulin receptors.
  • modified analogs include modification of the amino acid at position A 19, B16 or B25 to a 4-amino phenylalanine or one or more amino acid substitutions at positions selected from A5, A8, A9, A10, A12, A14, A15, A17, A18, A21, Bl, B2, B3, B4, B5, B9, BIO, B13, B14, B17, B20, B21, B22, B23, B26, B27, B28, B29 and B30 or deletions of any or all of positions Bl-4 and B26-30.
  • Insulin polypeptides as defined herein can also be analogs derived from a naturally occurring insulin by insertion or substitution of a non-peptide moiety, e.g. a retroinverso fragment, or incorporation of non-peptide bonds such as an azapeptide bond (CO substituted by NH) or pseudo-peptide bond (e.g. NH substituted with CH 2 ) or an ester bond (e.g., a depsipeptide, wherein one or more of the amide (-CONHR-) bonds are replaced by ester (COOR) bonds).
  • a non-peptide moiety e.g. a retroinverso fragment
  • non-peptide bonds such as an azapeptide bond (CO substituted by NH) or pseudo-peptide bond (e.g. NH substituted with CH 2 ) or an ester bond (e.g., a depsipeptide, wherein one or more of the amide (-CONHR-) bonds are replaced by ester (COOR) bonds
  • A19 insulin analog is an insulin peptide that has a substitution of 4-amino phenylalanine or 4-methoxy phenylalanine for the native tyrosine residue at position 19 of the A chain of native insulin.
  • IGF1 analog as used herein is a generic term that encompasses polypeptides that comprise an A and B chain wherein each of the A and B chain sequences share 90% or greater sequence identity with native IGF1 A and B chain sequences, respectively.
  • the term also encompasses IGF YL analogs.
  • IGF2 analog as used herein is a generic term that encompasses polypeptides that comprise an A and B chain wherein each of the A and B chain sequences share 90% or greater sequence identity with native IGF2 A and B chain sequences, respectively.
  • IGF YL analog is a peptide comprising an IGF A chain of SEQ ID NO: 19 and an IGF B chain of SEQ ID NO: 51.
  • single-chain insulin analog encompasses a group of structurally-related proteins wherein insulin or IGF A and B chains, or analogs or derivatives thereof, are covalently linked to one another to form a linear polypeptide chain.
  • the single-chain insulin analog comprises the covalent linkage of the carboxy terminus of the B chain to the amino terminus of the A chain via a linking moiety.
  • insulin A chain absent further descriptive language is intended to encompass the 21 amino acid sequence of SEQ ID NO: 1 as well as functional analogs and derivatives thereof, including the A chain of A19 insulin analogs and other analogs known to those skilled in the art, including modification of the sequence of SEQ ID NO: 1 by one or more amino acid insertions, deletions or substitutions at positions selected from A4, A5, A8, A9, A10, A12, A14, A15, A17, A18, A21.
  • insulin B chain absent further descriptive language is intended to encompass the 30 amino acid sequence of SEQ ID NO: 2, as well as modified functional analogs of the native B chain, including modification of the amino acid at position B16 or B25 to a 4-amino phenylalanine or one or more amino acid insertions, deletions or substitutions at positions selected from Bl, B2, B3, B4, B5, B9, B10, B13, B14, B17, B20, B21, B22, B23, B25, B26, B27, B28, B29 and B30 or deletions of any or all of positions Bl-4 and B26-30.
  • derivative is intended to encompass chemical modification to a compound (e.g., an amino acid), including chemical modification in vitro, e.g. by introducing a group in a side chain in one or more positions of a polypeptide, e.g. a nitro group in a tyrosine residue, or iodine in a tyrosine residue, or by conversion of a free carboxylic group to an ester group or to an amide group, or by converting an amino group to an amide by acylation, or by acylating a hydroxy group rendering an ester, or by alkylation of a primary amine rendering a secondary amine or linkage of a hydrophilic moiety to an amino acid side chain.
  • Other derivatives are obtained by oxidation or reduction of the side-chains of the amino acid residues in the polypeptide.
  • IGF A chain absent further descriptive language is intended to encompass the 21 amino acid sequence of native IGF 1 or IGF 2 (SEQ ID NOs: 5 and 7 respectively), as well as functional analogs thereof known to those skilled in the art, including modification of the sequence of SEQ ID NO: 5 and 7 by one or more amino acid substitutions at positions selected from A5, A8, A9, A10, A12, A14, A15, A17, A18, A21.
  • IGF YL B chain is intended to encompass an amino acid sequence comprising SEQ ID NO: 21, including for example the sequence of SEQ ID NO: 6, as well as analogs of the IGF YL B chain and derivatives thereof, including modification of the amino acid at position B16 or B25 to a 4- amino phenylalanine or one or more amino acid substitutions at positions selected from Bl, B2, B3, B4, B5, B9, BIO, B13, B14, B17, B20, B21, B22, B23, B26, B27, B28, B29 and B30 or deletions of any or all of positions Bl-4 and B26-30.
  • identity as used herein relates to the similarity between two or more sequences. Identity is measured by dividing the number of identical residues by the total number of residues and multiplying the product by 100 to achieve a percentage. Thus, two copies of exactly the same sequence have 100% identity, whereas two sequences that have amino acid deletions, additions, or substitutions relative to one another have a lower degree of identity.
  • BLAST Basic Local Alignment Search Tool, Altschul et al. (1993) J. Mol. Biol. 215:403-410) are available for determining sequence identity.
  • the term "selectivity" of a molecule for a first receptor relative to a second receptor refers to the following ratio: EC 50 of the molecule at the second receptor divided by the EC 50 of the molecule at the first receptor. For example, a molecule that has an EC 50 of 1 nM at a first receptor and an EC 50 of 100 nM at a second receptor has 100-fold selectivity for the first receptor relative to the second receptor.
  • an amino acid "modification” refers to a substitution of an amino acid, or the derivation of an amino acid by the addition and/or removal of chemical groups to/from the amino acid, and includes substitution with any of the 20 amino acids commonly found in human proteins, as well as atypical or non-naturally occurring amino acids.
  • Commercial sources of atypical amino acids include Sigma-Aldrich (Milwaukee, WI), ChemPep Inc.
  • Atypical amino acids may be purchased from commercial suppliers, synthesized de novo, or chemically modified or derivatized from naturally occurring amino acids.
  • substitution refers to the replacement of one amino acid residue by a different amino acid residue.
  • conservative amino acid substitution is defined herein as exchanges within one of the following five groups: I. Small aliphatic, nonpolar or slightly polar residues:
  • polyethylene glycol chain encompasses mixtures of condensation polymers of ethylene oxide and water, in a branched or straight chain, represented by the general formula H(OCH 2 CH 2 ) n OH, wherein n is at least 2.
  • Polyethylene glycol chain” or “PEG chain” is used in combination with a numeric suffix to indicate the approximate average molecular weight thereof. For example, PEG-5,000 refers to polyethylene glycol chain having a total molecular weight average of about 5,000 Daltons.
  • pegylated and like terms includes any compound that has been modified from its native state by linking a polyethylene glycol chain to the compound.
  • a “pegylated polypeptide” is a polypeptide that has a PEG chain covalently bound to the polypeptide.
  • Linker is a bond, molecule or group of molecules that binds two separate entities to one another. Linkers may provide for optimal spacing of the two entities or may further supply a labile linkage that allows the two entities to be separated from each other. Labile linkages include photocleavable groups, acid-labile moieties, base-labile moieties and enzyme-cleavable groups.
  • insulin dimer is a complex comprising two insulin polypeptides covalently bound to one another via a linker.
  • the term insulin dimer when used absent any qualifying language, encompasses both insulin homodimers and insulin heterodimers.
  • An insulin homodimer comprises two identical insulin polypeptides, whereas an insulin heterodimer comprises two insulin polypeptides that differ.
  • C C n alkyl wherein n can be from 1 through 6, as used herein, represents a branched or linear alkyl group having from one to the specified number of carbon atoms.
  • Typical C -C alkyl groups include, but are not limited to, methyl, ethyl, n-propyl, iso-propyl, butyl, iso-Butyl, sec-butyl, tert-butyl, pentyl, hexyl and the like.
  • C2-C n alkenyl wherein n can be from 2 through 6, as used herein, represents an olefinically unsaturated branched or linear group having from 2 to the specified number of carbon atoms and at least one double bond.
  • C 2 -C n alkynyl wherein n can be from 2 to 6, refers to an unsaturated branched or linear group having from 2 to n carbon atoms and at least one triple bond.
  • Examples of such groups include, but are not limited to, 1-propynyl, 2-propynyl, 1-butynyl, 2- butynyl, 1-pentynyl, and the like.
  • aryl refers to a mono- or bicyclic carbocyclic ring system having one or two aromatic rings including, but not limited to, phenyl, naphthyl,
  • (Ci-C 3 alkyl) (C 6 -C 10 aryl) refers to a 5 to 10 membered aryl that is attached to a parent moiety via a one to three membered alkyl chain.
  • heteroaryl refers to a mono- or bi- cyclic ring system containing one or two aromatic rings and containing at least one nitrogen, oxygen, or sulfur atom in an aromatic ring.
  • the size of the heteroaryl ring and the presence of substituents or linking groups are indicated by designating the number of carbons present.
  • (C C n alkyl)(C 5 -C 6 heteroaryl) refers to a 5 or 6 membered heteroaryl that is attached to a parent moiety via a one to "n" membered alkyl chain.
  • halo refers to one or more members of the group consisting of fluorine, chlorine, bromine, and iodine.
  • patient without further designation is intended to encompass any warm blooded vertebrate domesticated animal (including for example, but not limited to livestock, horses, cats, dogs and other pets) and humans.
  • isolated means having been removed from its natural environment.
  • the analog is made through recombinant methods and the analog is isolated from the host cell.
  • purified encompasses the isolation of a molecule or compound in a form that is substantially free of contaminants normally associated with the molecule or compound in a native or natural environment and means having been increased in purity as a result of being separated from other components of the original composition.
  • purified polypeptide is used herein to describe a polypeptide which has been separated from other compounds including, but not limited to nucleic acid molecules, lipids and carbohydrates.
  • a “peptidomimetic” refers to a chemical compound having a structure that is different from the general structure of an existing peptide, but that functions in a manner similar to the existing peptide, e.g., by mimicking the biological activity of that peptide.
  • Peptidomimetic s typically comprise naturally-occurring amino acids and/or unnatural amino acids, but can also comprise modifications to the peptide backbone.
  • a peptidomimetic may include a sequence of naturally-occurring amino acids with the insertion or substitution of a non-peptide moiety, e.g. a retroinverso fragment, or incorporation of non-peptide bonds such as an azapeptide bond (CO substituted by NH) or pseudo-peptide bond (e.g.
  • the peptidomimetic may be devoid of any naturally-occurring amino acids.
  • charged amino acid or “charged residue” refers to an amino acid that comprises a side chain that is negatively charged (i.e., de-protonated) or positively charged (i.e., protonated) in aqueous solution at physiological pH.
  • negatively charged amino acids include aspartic acid, glutamic acid, cysteic acid, homocysteic acid, and homoglutamic acid
  • positively charged amino acids include arginine, lysine and histidine.
  • Charged amino acids include the charged amino acids among the 20 amino acids commonly found in human proteins, as well as atypical or non-naturally occurring amino acids.
  • acidic amino acid refers to an amino acid that comprises a second acidic moiety (other than the alpha carboxylic acid of the amino acid), including for example, a side chain carboxylic acid or sulfonic acid group.
  • a mini-PEG linker absent further descriptive language is a linear polymer of ethylene glycol, comprising 4-16 ethylene glycol units, that covalently links a polypeptide to a second polymer, typically a second polypeptide.
  • the mini-PEG may comprise amino acids.
  • Insulin analogs will be abbreviated as follows:
  • the insulin A and B chains will be designated by a capital A for the A chain and a capital B for the B chain wherein a superscript 0 (e.g., A 0 or B°) will designate the base sequence is an insulin sequence (A chain: SEQ ID NO: 1, B chain SEQ ID NO: 2) and a superscript 1 (e.g., A 1 or B 1 ) will designate the base sequence is an IGF-1 sequence (A chain: SEQ ID NO: 5, B chain SEQ ID NO: 87).
  • a superscript 0 e.g., A 0 or B°
  • a superscript 1 e.g., A 1 or B 1
  • Modifications that deviate from the native insulin and IGF sequence are indicated in parenthesis following the designation of the A or B chain (e.g., [ ⁇ , ⁇ , ⁇ , ⁇ ) : ⁇ , ⁇ , ⁇ )]) with the single letter amino acid abbreviation indicating the substitution and the number indicating the position of the substitution in the respective A or B chain, using native insulin numbering.
  • a colon between the A and B chain indicates a two chain insulin whereas a dash will indicate a covalent bond and thus a single chain analog.
  • a linking moiety will be included between the A and B chains and the designation C 1 refers to the native IGF 1 C peptide, SEQ ID NO: 17.
  • the designation "position C8" in reference to the linking moiety designates an amino acid located at the position corresponding to the eighth amino acid of SEQ ID NO: 17.
  • insulin analog dimers that have insulin receptor agonist activity.
  • the level of insulin activity of the dimers is a function of the dimeric structure, and in particular, the sequence of the insulin analog, the length of the dimerization linker and the site of dimerization that connects the two insulin polypeptides.
  • the insulin dimers disclosed herein are formed between a first and second insulin polypeptide wherein each insulin polypeptide comprises an A chain and a B chain.
  • the first and second insulin polypeptides can be independently selected from two chain insulin analogs (i.e., wherein the A and B chains are linked only via interchain disulfide bonds between internal cysteine residues) and single chain insulin analogs (i.e., wherein the A and B chains are covalently linked to one another in a linear chain, and also include interchain disulfide bonds) wherein the first and second insulin polypeptides are linked to one another to form the dimer by a covalent bond or bifunctional linker.
  • the first and second insulin polypeptides are linked to one another by a disulfide bond or a bifunctional linker joining:
  • the linking moiety of the single chain analog comprises a mini-PEG linker, a short linear polymer of about 8-16 ethylene glycol units and optionally one or more amino acids.
  • the mini-PEG linker comprises the structure (PEG)6-8-K-PEG4_ 6, including for example, PEG8-K-PEG4.
  • Dimers formed between single chain insulin polypeptides comprising a mini-PEG linking moiety are linked together by a dimerization bond or bifunctional linker, optionally attached to the side chain of an amino acid (e.g., lysine) of the mini-PEG linker.
  • the side chain of the lysine of the mini- PEG linker PEG8-K-PEG4 can be further modified to provide the structure SH ; allowing the side chain to participate in a disulfide bond.
  • linking moiety is a peptide linker, including for example the IGF 1
  • the first and second insulin polypeptides are linked together by a bond or bifunctional linker attached to the side chain of the 8th amino acid of a 12 amino acid peptide linker.
  • the C 1 or C 2 peptide linking moiety of the single chain insulin analog is modified, optionally by a substitution at position 8, to comprise an amino acid comprising a side chain of the structure allowing the side chain to participate in a disulfide bond.
  • the insulin dimers disclosed herein can comprise any of the derivatives of native human insulin that are known to have activity at the insulin receptor.
  • the first and second insulin polypeptides of the dimers comprise an A chain amino acid sequence of
  • the two A chains are identical, and the B chains are identical or different.
  • the two B chains are identical, and the two A chains are identical or different; and in another embodiment the first and second insulin polypeptides are identical in sequence.
  • the A chains comprise a sequence independently selected from GIVEQCCTSICSLYQLENYCN (SEQ ID NO: 1), GIVEECCFRSCDLALLENYCN (SEQ ID NO: 12) and
  • GIVDECCFRSCDLRRLENYCN SEQ ID NO: 11
  • the B chains comprise a sequence independently selected from FVNQHLCGSHLVEALYLVCGERGFFYTPKT (SEQ ID NO: 2), FVNQHLCGSHLVEALYLVCGEHGFFYTPR (SEQ ID NO: 13) and
  • GPEHLCGAELVDALYLVCGDRGFY (SEQ ID NO: 14).
  • one or both of the insulin polypeptides of the dimer are single chain insulin analogs wherein the carboxy terminus of the B chain is linked to the amino terminus of the A chain via a linking peptide.
  • the linking peptide of the insulin polypeptide comprises an 8 to 17 amino acid peptide, and more particularly, in one embodiment the peptide represents the IGF-1 C peptide or analog thereof.
  • the linking peptide of the insulin polypeptides comprises a sequence selected from the group consisting of GYGSSSRX 68 APQT (SEQ ID NO: 9), GAGSSSRX 68 APQT (SEQ ID NO: 15), SRVSRX 68 SR (SEQ ID NO: 98), X 51 X 52 GSSSX 57 X 68 APQT (SEQ ID NO: 17, XsiXsiGSSSXsvXssAPQT (SEQ ID NO: 16), (SSSSX 59 APPPSLPSPSRLPGPSDTPILPQX6o)n (SEQ ID NO: 18) and
  • MGSSSSX59APPPSLPSPSRLPGPSDTPILPQEEEEEX60 (SEQ ID NO: 19), wherein n is an integer selected from the group consisting of 1, 2 or 3,
  • X 51 is selected from the group consisting of glycine, alanine, valine, leucine, isoleucine and proline;
  • X 52 is alanine, tyrosine, valine, leucine, isoleucine or proline;
  • X 57 and Xs 8 are independently arginine, lysine, cysteine, homocysteine, acetyl-phenylalanine or ornithine;
  • X 59 and X 6 o are independently arginine, lysine or an amino acid comprising a side chain of Structure I:
  • X 6 8 is lysine, ornithine, arginine or an amino acid comprising a side chain of
  • the A chain is independently selected from GIVEQCCTSICSLYQLENYCN(SEQ ID NO: 1),
  • the B chain comprises the sequence
  • GPEHLCGAELVDALYLVCGDRGFY (SEQ ID NO: 14) and the linking peptide joining the A and B chains consists of the sequence GYGSSSRX 68 APQT (SEQ ID NO: 9), wherein X 68 is an amino acid comprising a side chain of the structure:
  • the insulin dimer is an insulin super agonist (i.e., have greater activity at the insulin receptor than native insulin).
  • the first insulin polypeptide is linked to the second insulin polypeptide via the N-terminal alpha amine, or the side chain of N terminal amino acid, of the B chains of the first and second insulin polypeptides (i.e., a head to head fashion), wherein the dimer exhibits 2 fold or 5 fold increased potency relative to native insulin.
  • the super agonist insulin dimer comprises a first and second insulin polypeptide wherein the first and second insulin polypeptide are each two chain insulin analogs.
  • the first insulin polypeptide is linked to the second insulin polypeptide via a disulfide linkage, or other linking moiety, between the two N terminal alpha amines of each B chain of the first and second insulin polypeptides (i.e., a head to head fashion).
  • the A chain for both the first and second insulin polypeptide comprises the native human insulin sequence (GIVEQCCTSICSLYQLENYCN; SEQ ID NO: 1) and at least one of the B chains comprises the sequence
  • first and second insulin polypeptides are each native human insulin, and the two insulin polypeptides are linked to one another via a disulfide bond linking the N- terminal amino groups of each insulin polypeptide.
  • the insulin dimer is an insulin partial agonist comprising a dimer formed between a first and second insulin polypeptide, wherein the two insulin polypeptides are linked to one another via a linking moiety that joins the amino acid side chains of a C-terminal amino acid of the B chain, independently selected from positions B26, B27, B28, B29 and B30 of the respective first and second insulin polypeptides.
  • the insulin dimer is an insulin partial agonist comprising a dimer formed between a first and second insulin polypeptide, wherein the two insulin polypeptides are linked to one another via a linking moiety that joins the amino acid side chains of a C-terminal amino acid of the B chain, independently selected from positions B28, B29 and B30 of the respective first and second insulin
  • an amino acid selected from positions B26, B27, B28, B29 and B30 of the first and second insulin polypeptides comprises a side chain of Structure I:
  • the insulin partial agonist dimer comprises a dimer formed between a first and second insulin polypeptide, wherein the two insulin polypeptides are linked to one another via a linking moiety that joins the amino acid side chains of the respective B29 amino acids of the first and second insulin polypeptides.
  • the B29 amino acids of the first and second insulin polypeptides comprises a side chain of Structure I: wherein m is an integer selected from 1 to 4, optionally wherein m is 4, and the first and second insulin polypeptides are linked via a disulfide bond between the B29 and B29' amino acid side chains.
  • the insulin partial agonist has less than 66%, 50%, 40%, 33% or 20% activity at the insulin receptor relative to native insulin.
  • the A chain for the first and second insulin polypeptide is independently selected from
  • GIVEQCCTSICSLYQLENYCN SEQ ID NO: 1
  • GIVDECCFRS CDLRRLEN YCN SEQ ID NO: 11
  • the B chains comprise a sequence independently selected from
  • GPEHLCGAELVDALYLVCGDRGFYFNKPT (SEQ ID NO: 22).
  • a chain for both the first and second insulin polypeptide comprises the native human insulin sequence, GIVEQCCTSICSLYQLENYCN (SEQ ID NO: 1) and at least one of the B chains comprises the sequence FVNQHLCGSHLVEALYLVCGEHGFFYTPKT (SEQ ID NO: 20).
  • the first and second insulin polypeptide comprises human native insulin A and B chain sequences.
  • the insulin dimer has insulin receptor agonist activity at a first concentration but insulin receptor antagonist activity at a second higher concentration (i.e., a partial agonist/antagonist insulin analog).
  • a partial agonist/antagonist insulin analog is provided comprising a dimer formed between a first insulin polypeptide and a second insulin polypeptide, wherein the first insulin and second insulin polypeptides are both two chain insulin analogs each comprising an A chain and a B chain linked to one another through interchain disulfide bonds.
  • first and second insulin polypeptides are linked to one another via a dimerization linker joining the side chain of a carboxy terminal amino acid of the respective two B chains, wherein the A chain of the first and second insulin polypeptide are independently selected from the group consisting of
  • GIVDECCFRSCDLRRLENYCN SEQ ID NO: 11
  • GIVDECCFRSCDLRRLEMYCA SEQ ID NO: 5
  • GIVEECCFRSCDLALLETYCA SEQ ID NO: 7
  • the B chain of the first and second insulin comprise a sequence independently selected from the group consisting of FVNQHLCGSHLVEALYLVCGERGFFYTPX 68 T (SEQ ID NO: 2) and
  • X 6 8 is an amino acid comprising a side chain of the structure: SH ; allowing the side chain to participate in a disulfide bond.
  • first and second insulin polypeptides comprise native insulin sequences wherein the lysine at B29 and B29' have been modified to comprise a side chain of the structure: SH and the dimer is formed by a disulfide linkage between the B29 and B29' side chains.
  • a partial agonist/antagonist insulin analog comprising two insulin polypeptides wherein at least one of the insulin polypeptides is a single chain insulin and the first and second insulin polypeptides are linked to one another via an amino acid side chain of an amino acid contained within the linking peptide of the single chain insulin polypeptide, and the N-terminal alpha amine, or the side chain of the N-terminal amino acid, of the second insulin polypeptide.
  • the first and second insulin polypeptides comprise a B chain and A chain of human insulin, or analogs or derivatives thereof.
  • one or both of the insulin polypeptides of the dimer are insulin single chain analogs wherein the carboxy terminus of the B chain is linked to the amino terminus of the A chain via a peptide comprising a sequence selected from the group consisting of GYGSSSRX 68 APQT (SEQ ID NO: 9), GYGSSSRKAPQT (SEQ ID NO: 21), SRVSRX 68 SR (SEQ ID NO: 98) or XsiXsiGSSSXsvXssAPQT (SEQ ID NO: 16), wherein X 51 is selected from the group consisting of glycine, alanine, valine, leucine, isoleucine and proline; X52 is alanine, tyrosine, valine, leucine, isoleucine or proline; X57 and X 5 g are independently arginine, lysine, cysteine, homocysteine, acetyl-phenyla
  • O and X 6 8 is lysine, ar inine or an amino acid comprising a side chain of Structure I: wherein m is an integer selected from 1 to 4.
  • a partial insulin agonist/antagonist comprising a first insulin polypeptide and a second insulin polypeptide, wherein said first insulin polypeptide is a single chain insulin analog, comprising a first A chain sequence, a first B chain sequence and a first linking peptide, wherein a first end of said first linking peptide is covalently bound to the C-terminus of the first B chain and a second end of said first linking peptide is covalently bound to the amino terminus of the first A chain.
  • the second insulin polypeptide is optionally either a single chain insulin analog or a two chain insulin analog comprising a second A chain sequence and a second B chain sequence with the proviso that when said second insulin polypeptide is a single chain insulin analog, said second insulin polypeptide further comprises a second linking peptide, wherein a first end of said second linking peptide is covalently bound to the carboxy terminus of the B chain and a second end of said second linking peptide is covalently bound to the amino terminus of the A chain.
  • the first and second insulin polypeptides are linked to one another through a bond or a bifunctional linking moiety that covalently links the side chain of an amino acid of said first linking peptide (optionally at position 8) to
  • the A chains of the partial agonist dimer comprise the sequence GrVX4X5CCX 8 X9X 1 oCX 12 LXi4Xi5LEXi 8 Xi9CX2i-Ri3 (SEQ ID NO: 70), and the B chains of the dimer comprise the sequence X 25 LCGX2 9 X3oLVX33X34LYLVCGX4iX4 2 GFX 4 5 (SEQ ID NO: 44), wherein X 4 is glutamic acid or aspartic acid; X 5 is glutamic acid or glutamine; X 8 is threonine, histidine or phenylalanine; X 9 is serine, arginine, ornithine or alanine; X 10 is serine or isoleucine; X 12 is serine or aspartic acid; X 14 is argin
  • the linking peptide of the single chain insulin analog is selected from the group consisting of GYGSSSRX 68 APQT (SEQ ID NO: 9), SRVSRX 68 SR (SEQ ID NO: 98), GYGSSSRKAPQT (SEQ ID NO: 21), and X S ⁇ GSSSX ST X SS APQT (SEQ ID NO: 16), wherein X 51 is selected from the group consisting of glycine, alanine, valine, leucine, isoleucine and proline; X 52 is alanine, tyrosine, valine, leucine, isoleucine or proline; X57 and Xs 8 are independently arginine, lysine, cysteine, homocysteine, acetyl-phenylalanine or ornithine; and X 68 is an amino acid comprising a side chain of Structure I: ; wherein m is an integer selected from 1 to 4.
  • PEG8-X6 8 -PEG4 and in one embodiment the linking peptide of the single chain insulin analog is GYGSSSRX 68 APQT (SEQ ID NO: 9) or PEG8-X 68 -PEG4. In one embodiment the linking peptide of the single chain insulin analog is GYGSSSRX 68 APQT (SEQ ID NO: 9).
  • the first and second insulin polypeptides are identical in sequence.
  • the partial agonist dimer comprises two A chains that are identical wherein the B chains are identical or different, in another embodiment the two B chains are identical and the A chains are identical or different.
  • the A chains comprise a sequence independently selected from GIVEQCCTSICSLYQLENYCN (SEQ ID NO: 1) and
  • GrVDECCFRSCDLRRLENYCN SEQ ID NO: 11
  • the B chains comprise a sequence independently selected from FVNQHLCGSHLVEALYLVCGERGFFYTPKT (SEQ ID NO: 2), FVNQHLCGSHLVEALYLVCGEHGFFYTPR (SEQ ID NO: 13) and
  • both the first and the second insulin polypeptide are single chain analogs and the first and second insulin polypeptides are linked to one another via an amino acid side chain of an amino acid of the linking peptides of each of the first and second insulin polypeptide.
  • the A chains of the first and second insulin polypeptides comprises a sequence independently selected from GIVDECCX 8 X 9 SCDLRRLEX 18 YCX2i-Ri3 (SEQ ID NO: 81) and the B chains of said first and second insulin polypeptides comprises a sequence independently selected from X 25 LCGAELVDALYLVCGDX 42 GFY (SEQ ID NO: 82), wherein X 8 is histidine or phenylalanine; X 9 is arginine, ornithine or alanine; X 18 is methionine or asparagine; X 21 is alanine or asparagine; X 25 is histidine or threonine; X 42 is selected from the group consisting of alanine, ornithine and arginine; and R 13 is COOH.
  • the A chains are each GIVDECCFRSCDLRRLENYCN (SEQ ID NO: 11), the B chain comprises the sequence FVN
  • GPEHLCGAELVDALYLVCGDRGFY (SEQ ID NO: 14) and the linking peptide joining the A and B chains consists of the sequence GYGSSSRKAPQT (SEQ ID NO: 21) or
  • GYGSSSRX 68 APQT (SEQ ID NO: 9).
  • agonist/antagonist comprises a first single chain insulin polypeptide wherein the A and B chains are linked via the sequence GYGSSSRX 68 APQT (SEQ ID NO: 9), wherein X 68 is an amino acid with a side chain of Structure I: wherein m is an integer selected from 1 to 4 and the dimer is formed by a disulfide bond between the side chain of the amino acid at position 8 of the linking peptide of the first insulin polypeptide and the N-terminal amino group of the second insulin polypeptide. In one embodiment m is 4.
  • the partial insulin agonist comprises a first and second single chain insulin polypeptide linked via a B1-C8 dimerizing linker or a C8-C8 dimerizing linker, wherein the A and B chains of both the first and second insulin polypeptide are single chain insulin analogs linked via a linking moiety having the sequence GYGSSSRX 68 APQT (SEQ ID NO: 9), wherein X 6 8 is lysine or an amino acid with a side chain of Structure I: wherein m is an integer selected from 1 to 4 and the dimer is formed by a disulfide bond between the side chain of N terminal amino acid of the B chain with the side chain of an amino acid at position 8 of the linking moiety (B1-C8 linkage) or the two side chains of the amino acid at position 8 of the linking peptide of the respective first and second insulin polypeptides (C8-C8 linkage).
  • the partial insulin agonist comprises a first and second single chain insulin polypeptide linked via a B1-C8 dimerizing linker, wherein the A and B chains of both the first and second insulin polypeptide are linked via a mini-PEG linker, including for example PEG8-K-PEG4.
  • the insulin dimer is an insulin partial agonist comprising a dimer formed between a first and second insulin polypeptide, wherein the two insulin polypeptides are linked to one another via a linking moiety that joins the amino acid side chains of an N-terminal amino acid of the B chain of one of the first and second insulin polypeptides, including for example from positions BO, Bl and B2, to an amino acid side chain of the linking moiety of the other insulin polypeptide, including for example positions corresponding to C6, C7, C8, and C9 of the IGF1 C peptide.
  • the linkage is selected form the group consisting of B0-C6, B0-C7, B0-C8, B0-C9, B1-C6, B1-C7, B1-C8, B1-C9, B2-C6, B2-C7, B2-C8, B2-C9.
  • an insulin analog dimer that exhibits partial agonist and partial antagonist activity.
  • the dimer comprises
  • said first insulin and second insulin polypeptide are both a single chain insulin analogs comprising an A chain, a B chain and a linking moiety, wherein a first end of said linking moiety is covalently bound to the carboxy terminus of the B chain and a second end of said linking moiety is covalently bound to the amino terminus of the A chain.
  • the first and second insulin polypeptides are linked to one another via a PEG, or disulfide bearing, dimerization linker that covalently links the side chain of a lysine of the linking moiety of the respective first and second insulin polypeptides.
  • the dimerization linker is selected from the group consisting of
  • a side chain aliphatic amine e.g. lysine
  • a chain of the first and second insulin comprises a sequence independently selected from GIVEQCCTSICSLYQLENYCN (SEQ ID NO: 1),
  • GIVDECCFRSCDLRRLENYCN SEQ ID NO: 11
  • GIVDECCFRSCDLRRLEMYCA SEQ ID NO: 5
  • GIVEECCFRSCDLALLETYCA SEQ ID NO: 7
  • the B chain of the first and second insulin comprises a sequence independently selected from
  • GPEHLCGAELVDALYLVCGDRGFY (SEQ ID NO: 14);
  • linking moiety of the first and second insulin polypeptide comprising a sequence independently selected from GYGSSSRX 68 APQT (SEQ ID NO: 9), X 5 ⁇ X 52 GSS SX57X58 APQT (SEQ ID NO: 16) and PEG8-X 68 -PEG4, wherein
  • X 51 is selected from the group consisting of glycine, alanine, valine, leucine, isoleucine and proline;
  • X5 2 is alanine, tyrosine, valine, leucine, isoleucine or proline;
  • one of X57 and Xs 8 is arginine and the other is an amino acid comprising a side chain of Structure I:
  • X 6 8 is an amino acid comprising a side chain of Structure I:
  • an insulin analog dimer that exhibits partial agonist and partial antagonist activity.
  • the dimer comprises
  • said first insulin polypeptide is a two chain insulin analogs comprising a first A chain, and a first B chain, wherein said first A chain and first B chain are linked to one another through interchain disulfide bonds;
  • said second insulin polypeptide is a single chain insulin analog comprising a second A chain, a second B chain and a linking moiety, wherein a first end of said linking moiety is covalently bound to the carboxy terminus of the second B chain and a second end of said linking moiety is covalently bound to the amino terminus of the second A chain,
  • first and second insulin polypeptides are linked to one another via a disulfide bearing, dimerization linker, wherein a first end of the dimerization linker is covalently linked to the side chain of the N-terminal amino acid, or the N-terminal amine of the B chain of said first insulin polypeptide and a second end of the dimerization linker is covalently linked to the side chain of a lysine of the linking moiety of the second insulin polypeptide,
  • said A chain of the first and second insulin polypeptide comprising a sequence independently selected from GIVEQCCTSICSLYQLENYCN (SEQ ID NO: 1),
  • GIVDECCFRSCDLRRLENYCN SEQ ID NO: 11
  • GIVDECCFRSCDLRRLEMYCA SEQ ID NO: 12
  • said B chain of the first insulin polypeptide comprising a sequence independently selected from CFVNQHLCGSHLVEALYLVCGERGFFYTPKT (SEQ ID NO: 94),
  • CAYRPSETLCGGELVDTLQFVCGDRGFY (SEQ ID NO: 91)
  • CAYRPSETLCGGELVDTLYLVCGDRGFY (SEQ ID NO: 93);
  • said B chain of the second insulin polypeptide comprising a sequence independently selected from FVNQHLCGSHLVEALYLVCGERGFF (SEQ ID NO: 23), GPETLCGAELVDALYLVCGDRGFY (SEQ ID NO: 77),
  • GPEHLCGAELVDALYLVCGDRGFY (SEQ ID NO: 14);
  • linking moiety of the second insulin polypeptide comprising a sequence
  • GYGSSSRX 68 APQT SEQ ID NO: 9
  • X 51 X 52 GSSSX 57 X 58 APQT SEQ ID NO: 16
  • PEG8-X 68 -PEG4 PEG8-X 68 -PEG4, wherein
  • X 51 is selected from the group consisting of glycine, alanine, valine, leucine, isoleucine and proline;
  • X 52 is alanine, tyrosine, valine, leucine, isoleucine or proline;
  • one of X 57 and X 5 g is arginine and the other is an amino acid comprising a side chain of Structure I:
  • X 6 8 is an amino acid comprising a side chain of Structure I:
  • an insulin analog dimer that exhibits partial agonist and partial antagonist activity.
  • the dimer comprises
  • said first insulin and second insulin polypeptide are both single chain insulin analogs comprising an A chain, a B chain and a linking moiety, wherein a first end of said linking moiety is covalently bound to the carboxy terminus of the B chain and a second end of said linking moiety is covalently bound to the amino terminus of the A chain, further wherein the first and second insulin polypeptides are linked to one another via a PEG, or disulfide bearing, dimerization linker, wherein a first end of the dimerization linker is covalently linked to the side chain of a lysine of the linking moiety of one of the first or second insulin polypeptides and a second end of the dimerization linker is covalently linked to the N-terminal amine of the B chain of the other first or second insulin polypeptide.
  • the dimerization linker is selected from the group consisting of to a side chain aliphatic amine (e.g. lysine) or an N-terminal amine of the insulin B chain.
  • the A chain of the first insulin polypeptide comprises the sequence
  • the B chain of the first insulin polypeptide comprises the sequence AYRPSETLCGGELVDTLQFVCGDRGFY (SEQ ID NO: 90) or AYRPSETLCGGELVDTLYLVCGDRGFY (SEQ ID NO: 92);
  • the A chain of the second insulin polypeptide comprises the sequence GIVEQCCTS ICS LYQLEN YCN (SEQ ID NO: 1); and the B chain of the second insulin polypeptide comprises a sequence independently selected from FVNQHLCGSHLVEALYLVCGERGFF (SEQ ID NO: 23), and
  • the linking moiety of the first and second insulin polypeptides comprises a sequence independently selected from
  • GYGSSSRX 68 APQT (SEQ ID NO: 9), SRVSRX 68 SR (SEQ ID NO: 98) and PEG8-X 68 -PEG4, wherein X 68 is arginine or an amino acid comprising a side chain of Structure I:
  • an insulin analog dimer that exhibits partial agonist and partial antagonist activity.
  • the dimer comprises
  • said first insulin and second insulin polypeptide are both a single chain insulin analogs comprising an A chain, a B chain and a linking moiety, wherein a first end of said linking moiety is covalently bound to the carboxy terminus of the B chain and a second end of said linking moiety is covalently bound to the amino terminus of the A chain further wherein the first and second insulin polypeptides are linked to one another via a PEG or disulfide bearing dimerization linker covalently linked to the side chain of a lysine of the linking moiety of the respective first and second insulin polypeptides,
  • said A chain of the first and second insulin comprising a sequence independently selected from GIVEQCCTSICSLYQLENYCN (SEQ ID NO: 1) and
  • said dimerization linker comprising a sequence independently selected from
  • GYGSSSRX 68 APQT SEQ ID NO: 9
  • X 6 8 is an amino acid comprising a side chain of Structure I:
  • an insulin analog dimer that exhibits partial agonist and partial antagonist activity.
  • the dimer comprises
  • said first insulin polypeptide is a two chain insulin analogs comprising a first A chain, and a first B chain, wherein said first A chain and first B chain are linked to one another through interchain disulfide bonds;
  • said second insulin polypeptide is a single chain insulin analog comprising a second A chain, a second B chain and a linking moiety, wherein a first end of said linking moiety is covalently bound to the carboxy terminus of the second B chain and a second end of said linking moiety is covalently bound to the amino terminus of the second A chain,
  • first and second insulin polypeptides are linked to one another via a disulfide bond between the N-terminal cysteine side chain of the B chain of the first insulin polypeptide and the side chain of a modified lysine of the linking moiety of the second insulin polypeptide,
  • said A chain of the first and second insulin polypeptide comprising a sequence independently selected from GIVEQCCTSICSLYQLENYCN (SEQ ID NO: 1),
  • GIVDECCFRSCDLRRLENYCN SEQ ID NO: 11
  • GIVDECCFRSCDLRRLEMYCA SEQ ID NO: 5
  • GIVEECCFRSCDLALLETYCA SEQ ID NO: 7
  • said B chain of the first insulin polypeptide comprising a sequence independently selected from CFVNQHLCGSHLVEALYLVCGERGFFYTPKT (SEQ ID NO: 94) and CGPEHLCGAELVDALYLVCGDRGFYNKPT (SEQ ID NO: 97);
  • said B chain of the second insulin polypeptide comprising a sequence independently selected from FVNQHLCGSHLVEALYLVCGERGFF (SEQ ID NO: 23) and GPEHLCGAELVDALYLVCGDRGFY (SEQ ID NO: 14);
  • linking moiety of the second insulin polypeptide comprising the sequence
  • GYGSSSRX 68 APQT (SEQ ID NO: 9), wherein X 68 is an amino acid comprising a side chain of Structure I:
  • insulin dimers are provided that are selective for the subtype B insulin receptor (IR-B).
  • IR-B subtype B insulin receptor
  • a heterodimer formed between an insulin based polypeptide and a peptide (e.g., IGF I or IGF II) that exhibits a higher IR-A/IR-B ratio (i.e., higher affinity for IR-A relative to IR-B) showed a preference for IR-B activation as indicated by the higher level of maximal receptor response at IR-B relative to IR-A.
  • insulin heterodimers are provided that showed a preference for IR-B activation relative to the subtype A insulin receptor.
  • the first insulin polypeptide comprises an A chain amino acid sequence of GIVX 4 X5CCX8X9XioCX 1 2LX 1 4Xi5LEX 18 X 1 9CX 2 i-Ri3 (SEQ ID NO: 70) and a B chain amino acid sequence of X 25 LCGX 29 X 3 oLVX 33 X3 4 LYLVCGX 41 X 42 GFX 4 5 (SEQ ID NO: 44), and the second polypeptide comprises an A chain sequence of
  • GIVEECCFRSCDLALLETYCA (SEQ ID NO: 7)
  • TPAX 75 SEGIVEECCFRSCDLALLETYCA (SEQ ID NO: 88) or
  • GIVDECCFRSCDLRRLEMYCA (SEQ ID NO: 5), a B chain sequence of
  • GPETLCGAELVDALQFVCGDRGFYFNKPT (SEQ ID NO: 10); and a linking moiety comprising a sequence selected from the group consisting of PEG8-X 68 -PEG4 and
  • GYGSSSRX 68 APQT (SEQ ID NO: 9), wherein
  • X 4 is glutamic acid or aspartic acid
  • X5 is glutamic acid or glutamine
  • X 8 is threonine, histidine or phenylalanine
  • X9 is serine, arginine, ornithine or alanine
  • X 10 is serine or isoleucine
  • X 12 is serine or aspartic acid
  • X 14 is arginine, tyrosine, ornithine or alanine
  • X 15 is glutamine, arginine, alanine, ornithine or leucine
  • X 18 is methionine, asparagine or threonine
  • X 19 is tyrosine, 4- methoxy-phenylalanine or 4-amino phenylalanine
  • X 21 is alanine, glycine or asparagine
  • X 25 is histidine or threonine
  • X 2 9 is alanine
  • the insulin polypeptide of the heterodimer is a two chain insulin polypeptide.
  • both the first and second polypeptides of the heterodimer are single chain insulin polypeptides having a linking moiety independently selected from the group consisting of
  • W 2 is a PEG6, PEG7 or PEG8;
  • Y 2 is a PEG4, PEG5 or PEG6;
  • Z 2 is lysine, cysteine or an amino acid comprising a side chain of Structure I: SH ;
  • n is an integer selected from the group consisting of 1, 2 or 3;
  • X 51 is selected from the group consisting of glycine, alanine, valine, leucine, isoleucine and proline;
  • X5 2 is alanine, tyrosine, valine, leucine, isoleucine or proline;
  • X57 and X58 are independently arginine, lysine, cysteine, homocysteine, acetyl- phenylalanine or ornithine;
  • X59 and X 6 o are independently arginine or lysine.
  • X 6 8 is arginine, lysine, cysteine or an amino acid comprising a side chain of Structure I: wherein m is an integer selected from 1 to 4.
  • the dimer comprises a first and second insulin like polypeptide, at least one of which is a single chain insulin like polypeptide, wherein
  • the first insulin polypeptide comprises
  • a B chain sequence of FVNQHLCGSHLVEALYLVCGERGFF (SEQ ID NO: 23); and optionally a first linking moiety comprising a sequence selected from the group consisting of PEG8-X 68 -PEG4 and GYGSSSRX 68 APQT (SEQ ID NO: 9), wherein
  • X 6 8 is arginine, lysine or an amino acid comprising a side chain of Structure I:
  • the second polypeptide comprises
  • a first linking moiety comprising a sequence selected from the group consisting of PEG8-X 68 -PEG4 and GYGSSSRX 68 APQT (SEQ ID NO: 9), wherein
  • X 6 8 is arginine, lysine or an amino acid comprising a side chain of Structure I:
  • X 75 is lysine or arginine; further wherein the first and second insulin polypeptides are linked to one another via the N terminal amine or side chain of the amino acid at the N-terminal amino acid of one of said first or second insulin polypeptide and the lysine side chain of the linking moiety of the other insulin polypeptide, optionally at position 8 of the linking moiety.
  • both the first and second insulin polypeptides are single chain insulin polypeptides.
  • one of the first or second polypeptides is a two chain heteroduplex comprising an A chain and a B chain linked via interchain disulfide bonds; and the other insulin polypeptide is a single chain insulin polypeptide comprising an A chain, a B chain and a linking moiety, wherein the linking moiety is PEG8-X68-PEG4 or
  • GYGSSSRX 68 APQT (SEQ ID NO: 9), wherein
  • X 6 8 is lysine or an amino acid comprising a side chain of Structure I:
  • m is 4 and said first and second insulin polypeptides are linked one another via the side chain of the amino acid at position Bl of the two chain insulin polypeptide and the side chain of the amino acid at position 8 of GYGSSSRX 68 APQT (SEQ ID NO: 9), or the side chain of the lysine of PEG8-X68-PEG4 of the single chain insulin polypeptide.
  • first and second polypeptides of the heterodimer are each single chain insulin polypeptides, wherein the first insulin polypeptide comprises
  • a B chain sequence of FVNQHLCGSHLVEALYLVCGERGFF (SEQ ID NO: 23); and a first linking moiety comprising a sequence selected from the group consisting of PEG8-X 6 -PEG4 and GYGSSSRX 68 APQT (SEQ ID NO: 9); and
  • the second IGF polypeptide comprises
  • a second linking moiety comprising a sequence selected from the group consisting of PEG8-K-PEG4 and GYGSSSRX 68 APQT (SEQ ID NO: 9), wherein
  • X 6 8 is lysine, arginine, or an amino acid comprising a side chain of Structure I:
  • X 7 5 is lysine or arginine; further wherein the first and second linking moieties join the carboxy terminus of the respective B chains to the A chains and the first and second insulin polypeptides are linked to one another via the N terminal amine or side chain of the amino acid at position Bl of one of said first or second polypeptides and the lysine side chain of the linking moiety of the other polypeptide.
  • the first and second polypeptides of the heterodimer are each single chain insulin polypeptides, wherein the first insulin polypeptide comprises
  • the second IGF polypeptide comprises
  • a second linking moiety comprising a sequence selected from the group consisting of PEG8-X 68 -PEG4 and GYGSSSRX 68 APQT (SEQ ID NO: 9), wherein
  • X 6 8 is arginine, or an amino acid comprising a side chain of Structure I:
  • X 75 is lysine or arginine; further wherein the first and second linking moieties join the carboxy terminus of the respective B chains to the A chains and the first and second insulin polypeptides are linked to one another via the N terminal amine or side chain of the amino acid at position Bl of one of said first or second polypeptides and the lysine side chain of the linking moiety of the other polypeptide.
  • an insulin analog dimer that exhibits partial agonist and partial antagonist activity and selectivity for the subtype B insulin receptor.
  • the dimer comprises
  • said first insulin and second insulin polypeptide are both single chain insulin analogs comprising an A chain, a B chain and a linking moiety, wherein for each of said first and second insulin polypeptides a first end of their respective linking moieties is covalently bound to the carboxy terminus of the B chain and a second end of their respective linking moieties is covalently bound to the amino terminus of the A chain, further wherein the first and second insulin polypeptides are linked to one another via a disulfide bearing dimerization linker, wherein a first end of the dimerization linker is covalently linked to the side chain of a lysine of the linking moiety of one of the first or second insulin polypeptides and a second end of the dimerization linker is covalently linked to the N-terminal amine of the B chain of the other first or second insulin polypeptide.
  • first and second insulin polypeptides are linked to one another via a disulfide bearing dimerization linker, wherein a first end of the dimerization linker is covalently linked to the side chain of a lysine of the linking moiety of the first insulin polypeptides and a second end of the dimerization linker is covalently linked to the N-terminal amine of the B chain of the second insulin polypeptide.
  • first and second insulin polypeptides are linked to one another via a disulfide bearing dimerization linker, wherein a first end of the dimerization linker is covalently linked to the side chain of a lysine of the linking moiety of one of the second insulin polypeptides and a second end of the dimerization linker is covalently linked to the N-terminal amine of the B chain of the first insulin polypeptide.
  • the A chain of the first insulin polypeptide comprises the sequence TPAKSEGIVEECCFRSCDLALLETYCA (SEQ ID NO: 103)
  • the B chain of the first insulin polypeptide comprises the sequence AYRPSETLCGGELVDTLQFVCGDRGFY (SEQ ID NO: 90)
  • the linking moiety for said first insulin polypeptide comprises the sequence SRVSRX 68 SR (SEQ ID NO: 98).
  • the A chain of the second insulin polypeptide comprises the sequence GIVEQCCTSICSLYQLENYCN (SEQ ID NO: 1)
  • the B chain of the second insulin polypeptide comprises the sequence FVNQHLCGSHLVEALYLVCGERGFF (SEQ ID NO: 23)
  • the linking moiety for said second insulin polypeptide comprises the sequence GYGSSSRX 68 APQT (SEQ ID NO: 9), wherein
  • X 6 8 is arginine or an amino acid comprising a side chain of Structure I:
  • the linking moiety of the single chain insulin analogs disclosed herein is the IGF 1 C chain sequence (GYGSSSRRAPQT; SEQ ID NO: 24) or a derivative thereof.
  • the derivative is a peptide that differs from SEQ ID NO: 24 by a single amino acid substitution of a lysine, cysteine ornithine, homocysteine, or acetyl-phenylalanine residue, and in a further embodiment the lysine, cysteine ornithine, homocysteine, or acetyl-phenylalanine amino acid is pegylated or fatty acylated.
  • the linking moiety is a peptide that differs from SEQ ID NO: 24 by a single lysine substitution. In one specific embodiment the substitution is made at position 8 of SEQ ID NO: 24.
  • the IGF 1 C chain sequence and analogs thereof as a linking moiety will generate a single chain insulin analog that has near wild type insulin activity.
  • use of a IGF 1 C chain sequence analog as the linking moiety wherein position 2 of the IGF 1 C chain sequence is modified, or the carboxy terminal four amino acids are deleted from the IGF 1 C chain sequence, produces a single chain insulin polypeptide that is selective for insulin (i.e., has a higher binding and/or activity at the insulin receptor compared to the IGF-1 receptor).
  • the single chain insulin polypeptide has 5x, lOx, 20x, 30x, 40x, or 50x higher affinity or activity at the insulin receptor relative to the IGF-1 receptor.
  • the linking moiety is a derivative of the IGF 1 C chain sequence (GYGSSSRRAPQT; SEQ ID NO: 24) and comprises a non-native sequence that differs from GYGSSSRR (SEQ ID NO: 25) or GAGSSSRRAPQT (SEQ ID NO: 26) by 1 to 3 amino acid substitutions, or 1 to 2 amino acid substitutions.
  • at least one of the amino acid substitutions is a lysine or cysteine substitution, and in one embodiment the amino acid substitutions are conservative amino acid substitutions.
  • the linking moiety is a peptide (or peptidomimetic) of 8 to 17 amino acids comprising a non-native amino acid sequence that differs from GYGSSSRR (SEQ ID NO: 25) or GAGSSSRRAPQT (SEQ ID NO: 26) by 1 amino acid substitution, including for example substitution with a lysine or cysteine.
  • the linking moiety comprises the sequence GYGSSSRR (SEQ ID NO: 25) or GAGSSSRRAPQT (SEQ ID NO: 26).
  • the linking moiety comprises the sequence GAGSSSRX 68 APQT (SEQ ID NO: 15), GYGSSSX 57 X 68 APQT (SEQ ID NO: 37), or an amino acid that differs from SEQ ID NO: 15 by a single amino acid substitution, wherein Xs 7 is arginine and X 6 8 is an amino acid with a side chain of Structure I: wherein m is an integer selected from 1 to 4.
  • a polyethylene glycol chain is linked to the side chain of the amino acid at position 8 of said linking moiety.
  • the linking moiety comprises the sequence GX 52 GSSSRX 58 APQT (SEQ ID NO: 38), wherein X 52 is any non- aromatic amino acid, including for example, alanine, valine, leucine, isoleucine or proline, and X 5 8 represents an amino acid that has a polyethylene chain covalently linked to its side chain.
  • X 5 g is a pegylated lysine.
  • the linking moiety comprises the sequence GYGSSSRX 58 (SEQ ID NO: 100) or GAGSSSRX 58 APQT (SEQ ID NO: 15), wherein Xs 8 represents an amino acid that has a polyethylene chain covalently linked to its side chain.
  • the linking moiety is an 8 to 17 amino acid sequence consisting of the sequence X 51 X 52 GSSSRR (SEQ ID NO: 27), a peptidomimetic of SEQ ID NO: 27, or an amino acid sequence that differs from SEQ ID NO: 27 by 1, 2, or 3 amino acid substitutions at one of positions 3-8 of SEQ ID NO: 27, wherein Xs 1 is selected from the group consisting of glycine, alanine, valine, leucine, isoleucine, proline and methionine, and X 52 is any amino acid.
  • the linking moiety is a peptide of eight amino acids in length and comprises the sequence GYGSSSRR (SEQ ID NO: 25), or an amino acid sequence that differs from SEQ ID NO: 18 by a single amino acid substitution, or a derivative thereof.
  • the linking moiety is an 8 to 17 amino acid sequence
  • the linking moiety comprises an 8-17 amino acid sequence selected from the group consisting of GYGSSSRR (SEQ ID NO: 25), GAGSSSRR (SEQ ID NO: 27), GAGSSSRRA (SEQ ID NO: 28), GAGSSSRRAP (SEQ ID NO: 29),
  • GAGSSSRRAPQ (SEQ ID NO: 30), GAGSSSRRAPQT (SEQ ID NO: 26), PYGSSSRR (SEQ ID NO: 31), PAGSSSRR (SEQ ID NO: 32), PAGSSSRRA (SEQ ID NO: 33), PAGSSSRRAP (SEQ ID NO: 34), PAGSSSRRAPQ (SEQ ID NO: 35), PAGSSSRRAPQT (SEQ ID NO: 36).
  • the linking moiety of a single chain insulin polypeptide disclosed herein is a relatively short bifunctional non-peptide polymer linker that approximates the length of an 8-16 amino acid sequence.
  • the non-peptide linking moiety is a polyethylene glycol linker of approximately 4 to 20, 8 to 18, 8 to 16, 8 to 14, 10 to 14, 10 to 12 or 11 to 13 monomers.
  • a single chain insulin agonist is provided wherein the last five carboxy amino acids of the native B chain are deleted, and amino acid B25 is directly linked to the linking moiety by a covalent bond. The second end of the linking moiety is covalently bound to amino acid Al of the A chain thus linking the B and A chain via the linking moiety.
  • the linking moiety is a linear polyethylene glycol linking moiety comprising at least 10 but no more than 16 monomer units and in another embodiment the polyethylene glycol linking moiety comprises at least 12 but no more than 16 monomer units, and in a further embodiment the polyethylene glycol linking moiety comprises at least 10 but no more than 14 monomer units.
  • m is an integer ranging from 6 to 18, 8 to 16, 10 to 14 or 11 to 13. In one embodiment m is an integer selected from 10, 11, 12, 13 or 14. In one embodiment m is 12.
  • a single chain insulin agonist wherein the last five carboxy amino acids of the native B chain are deleted, and amino acid B25 is linked to amino acid Al of the A chain via a linking moiety comprising polyethylene glycol of at least 8 but no more than 16 monomer units and an amino acid sequence of one to four amino acids.
  • the linking moiety comprises a 1-4 amino acid sequence and a linear polyethylene glycol of at least 8 but less than 14 monomer units in length covalently bound to said 1-4 amino acid sequence, with the proviso that the amino acid sequence is not YTPK (SEQ ID NO: 37) or FNKP (SEQ ID NO: 38).
  • a single chain insulin agonist wherein the last five carboxy amino acids of the native B chain are deleted, and amino acid B25 is linked to amino acid Al of the A chain via a linking moiety comprising a polyethylene glycol of at least 8 but less than 14 monomer units in length and a 2- 5 amino acid sequence.
  • the 2-5 amino acid sequence can be located between the B chain and the polyethylene glycol chain or between the A chain and the polyethylene glycol chain.
  • polyethylene glycol chain the amino acid sequence is not YTPKT (SEQ ID NO: 39) or FNKPT (SEQ ID NO: 40).
  • linking moiety comprises the general structure: W 2 - Z 2 -Y 2
  • W 2 and Y 2 are independently a polyethylene glycol of the general structure and Z 2 is a 1-3 amino acid sequence, wherein m is an integer ranging from 3-7.
  • W 2 is a PEG6, PEG7 or PEG8, Y 2 is a PEG4, PEG5 or PEG6, and Z 2 is a single amino acid.
  • Z 2 is Lys or Cys.
  • Z 2 comprises a pegylated Lys or Cys amino acid.
  • the linking moiety comprises a two polyethylene chains representing a total of 8-12 or 10-14 or 12 monomeric units of ethylene glycol separated by a single amino acid.
  • the single amino acid is lysine or cysteine.
  • W 2 is PEG8, Y 2 is a PEG4 and Z 2 lysine.
  • the insulin polypeptides of the present invention may comprise the native B and A chain sequences of human insulin (SEQ ID NOs: 1 and 2, respectively) or any of the known analogs or derivatives thereof that exhibit insulin agonist activity when linked to one another in a heteroduplex.
  • Such analogs include, for example, proteins that having an A-chain and a B- chain that differ from the A-chain and B-chain of human insulin by having one or more amino acid deletions, one or more amino acid substitutions, and/or one or more amino acid insertions that do not destroy the insulin activity of the insulin analog.
  • insulin analog One type of insulin analog, "monomeric insulin analog,” is well known in the art. These are fast-acting analogs of human insulin, including, for example, insulin analogs wherein:
  • amino acyl residue at position B28 is substituted with Asp, Lys, Leu, Val, or Ala, and the amino acyl residue at position B29 is Lys or Pro;
  • an insulin analog comprising an Asp substituted at position B28 or a Lys substituted at position 28 and a proline substituted at position B29. Additional monomeric insulin analogs are disclosed in Chance, et al., U.S. Pat. No. 5,514,646; Chance, et al., U.S. patent application Ser. No. 08/255,297; Brems, et al., Protein Engineering, 5:527-533 (1992); Brange, et al., EPO Publication No. 214,826 (published Mar.
  • Insulin analogs may also have replacements of the amidated amino acids with acidic forms.
  • Asn may be replaced with Asp or Glu.
  • Gin may be replaced with Asp or Glu.
  • Asn(A18), Asn(A21), or Asp(B3), or any combination of those residues may be replaced by Asp or Glu.
  • Gln(A15) or Gln(B4), or both, may be replaced by either Asp or Glu.
  • insulin single chain analogs comprising a B chain and A chain of human insulin, or analogs or derivative thereof, wherein the carboxy terminus of the B chain is linked to the amino terminus of the A chain via a linking moiety.
  • the A chain is an amino acid sequence selected from the group consisting of
  • GIVEQCCTSICSLYQLENYCN SEQ ID NO: 1
  • GIVDECCFRSCDLRRLEMYCA SEQ ID NO: 5
  • GIVEECCFRSCDLALLETYCA SEQ ID NO: 7
  • the B chain comprises a sequence selected from FVNQHLCGSHLVEALYLVCGERGFFYTPKT (SEQ ID NO: 2), GPEHLCGAELVDALYLVCGDRGFY (SEQ ID NO: 14) and
  • GPETLCGX 26 ELVDX 27 LYLVCGDX 42 GFYFNKPT-R14 SEQ ID NO: 41
  • X 26 and X 27 are each alanine and X 42 is arginine, or a carboxy shortened sequence thereof having one to five amino acids corresponding to B26, B27, B28, B29 and B30 deleted, and analogs of those sequences wherein each sequence is modified to comprise one to five amino acid substitutions at positions corresponding to native insulin positions (see peptide alignment shown in Fig.
  • amino acid substitutions are conservative amino acid substitutions. Suitable amino acid substitutions at these positions that do not adversely impact insulin's desired activities are known to those skilled in the art, as demonstrated, for example, in Mayer, et al., Insulin Structure and Function, Biopolymers. 2007;88(5):687-713, the disclosure of which is incorporated herein by reference.
  • the insulin analog peptides may comprise an insulin A chain and an insulin B chain or analogs thereof, wherein the A chain comprises an amino acid sequence that shares at least 70% sequence identity (e.g., 70%, 75%, 80%, 85%, 90%, 95%) over the length of the native peptide, with at least one of
  • GIVEQCCTSICSLYQLENYCN SEQ ID NO: 1
  • GIVDECCFRSCDLRRLEMYCA SEQ ID NO: 5
  • GIVEECCFRSCDLALLETYCA SEQ ID NO: 7
  • the B chain comprises an amino acid sequence that shares at least 60% sequence identity (e.g., 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%) over the length of the native peptide, with at least one of the sequence FVNQHLCGSHLVEALYLVCGERGFFYTPKT (SEQ ID NO: 2), GPETLCGX 26 ELVDX 27 LYLVCGDX 42 GFYFNKPT-R14 (SEQ ID NO: 41), wherein X 26 and X 27 are each alanine and X 42 is arginine, or a carboxy shortened sequence thereof having one to four amino acids corresponding to B27, B28, B29 and B30 deleted.
  • Additional amino acid sequences can be added to the amino terminus of the B chain or to the carboxy terminus of the A chain of the insulin polypeptides of the present invention.
  • a series of negatively charged amino acids can be added to the amino terminus of the B chain, including for example a peptide of 1 to 12, 1 to 10, 1 to 8 or 1 to 6 amino acids in length and comprising one or more negatively charged amino acids including for example glutamic acid and aspartic acid.
  • the B chain amino terminal extension comprises 1 to 6 charged amino acids.
  • the B chain comprises the sequence GEEEEEWFVNQHLCGSHLVEALYLVCGERGFFYTPR (SEQ ID NO: 42) or
  • the insulin polypeptides disclosed comprise a C-terminal amide or ester in place of a C-terminal carboxylate on the A chain.
  • High potency insulin polypeptides can also be prepared based on modified IGF I and IGF II sequences, as described in International application PCT/2009/068713, the disclosure of which is expressly incorporated herein by reference. More particularly, analogs of IGF I and IGF II that comprise a substitution of a tyrosine leucine dipeptide for the native IGF amino acids at positions corresponding to B16 and B17 of native insulin have a tenfold increase in potency at the insulin receptor.
  • the insulin polypeptides disclosed herein may include an A chain of IGF I (SEQ ID NO: 5) or IGF II (SEQ ID NO: 7) and a B chain of IGF I YL (SEQ ID NO: 6) or IGF II YL (SEQ ID NO: 8) or the B chain of native insulin (SEQ ID NO: 2).
  • the insulin polypeptides disclosed herein may include a native insulin A chain, or analog thereof, and a B chain of IGF I YL (SEQ ID NO: 6) or IGF II YL (SEQ ID NO: 8), as well as analogs of said B chains.
  • the insulin polypeptide comprises an IGF I (SEQ ID NO: 5) A chain, or analog or derivative thereof and a B chain of IGF I YL (SEQ ID NO: 6), IGF II YL (SEQ ID NO: 8) or native insulin (SEQ ID NO: 2), or analogs or derivatives thereof.
  • Additional modifications to the single chain IGF or insulin A and B chains include, for example, modification of the amino acids at one or more of positions A 19, B16 or B25 (relative to the native insulin A and B chains) to a 4-amino phenylalanine or one or more amino acid substitutions at positions selected from A5, A8, A9, A10, A14, A15, A17, A18, A21, Bl, B2, B3, B4, B5, B9, BIO, B13, B14, B20, B21, B22, B23, B26, B27, B28, B29 and B30 (relative to the native A and B chains of insulin) or deletions of any or all of positions Bl-4 and B26-30.
  • substitutions at positions selected from A5, A8, A9, A10, A14, A15, A17, A18, A21, Bl, B2, B3, B4, B5, B9, BIO, B13, B14, B20, B21, B22, B23, B26, B27, B28, B29 and B30 are conservative amino acid substitutions relative to the native insulin sequence.
  • R22-X25LCGX29X30LVX33X34LYLVCGX41X42GFX45 (SEQ ID NO: 44), and the A chain comprises the sequence
  • X 4 is glutamic acid or aspartic acid
  • X 5 is glutamine or glutamic acid
  • Xg is histidine, threonine or phenylalanine
  • X 9 is serine, arginine, lysine, ornithine or alanine
  • X 10 is isoleucine or serine
  • Xi 2 is serine or aspartic acid
  • Xi 4 is tyrosine, arginine, lysine, ornithine or alanine;
  • X 15 is glutamine, glutamic acid, arginine, alanine, lysine, ornithine or leucine;
  • X 17 is glutamic acid, aspartic acid, asparagine, lysine, ornithine or glutamine;
  • Xis is methionine, asparagine, glutamine, aspartic acid, glutamic acid or threonine;
  • X 19 is tyrosine, 4-methoxy-phenylalanine or 4-amino phenylalanine;
  • X 21 is selected from the group consisting of alanine, glycine, serine, valine, threonine, isoleucine, leucine, glutamine, glutamic acid, asparagine, aspartic acid, histidine, tryptophan, tyrosine, and methionine;
  • X 25 is histidine or threonine
  • X 29 is selected from the group consisting of alanine, glycine and serine;
  • X 30 is selected from the group consisting of histidine, aspartic acid, glutamic acid, homocysteic acid and cysteic acid;
  • X 33 is selected from the group consisting of aspartic acid, glutamine and glutamic acid;
  • X 34 is selected from the group consisting of alanine and threonine;
  • X 41 is selected from the group consisting of glutamic acid, aspartic acid or asparagine;
  • X 42 is selected from the group consisting of alanine, lysine, ornithine and arginine;
  • X 45 is tyrosine or phenylalanine;
  • R 22 is selected from the group consisting of AYRPSE (SEQ ID NO: 46), FVNQ (SEQ ID NO: 47), PGPE (SEQ ID NO: 48), a tripeptide glycine-proline- glutamic acid, a tripeptide valine-asparagine-glutamine, a dipeptide proline- glutamic acid, a dipeptide asparagine- glutamine, glutamine, glutamic acid and an N-terminal alpha amine; and
  • R 13 is COOH or CONH 2 .
  • X 8 , X 2 5 and X 30 are each histidine.
  • the insulin polypeptide comprises an analog of the A chain peptide sequence of SEQ ID NO: 68 and/or a B chain peptide sequence of SEQ ID NO: 69 wherein the analog of the A chain and B chain each comprise 1-3 further amino acid substitutions.
  • an insulin analog wherein the A chain of the insulin peptide comprises the sequence GIVEQCCX 8 SICSLYQLXi 7 NX 19 CX 23 (SEQ ID NO: 49) and the B chain comprising the sequence X 25 LCGX 29 X oLVEALYLVCGERGFF (SEQ ID NO: 65) wherein
  • X 8 is selected from the group consisting of threonine and histidine;
  • X 17 is glutamic acid or glutamine
  • X 19 is tyrosine, 4-methoxy-phenylalanine or 4-amino phenylalanine;
  • X 23 is asparagine or glycine
  • X 2 5 is selected from the group consisting of histidine and threonine;
  • X 29 is selected from the group consisting of alanine, glycine and serine;
  • X 3 o is selected from the group consisting of histidine, aspartic acid, glutamic acid, homocysteic acid and cysteic acid.
  • the B chain comprises the sequence X 22 VNQX 25 LCGX 29 X 3 oLVEALYLVCGERGFFYT-Zi-Bi (SEQ ID NO: 66) wherein
  • X 22 is selected from the group consisting of phenylalanine and desamino-phenylalanine;
  • X 2 5 is selected from the group consisting of histidine and threonine;
  • X 2 9 is selected from the group consisting of alanine, glycine and serine;
  • X 3 o is selected from the group consisting of histidine, aspartic acid, glutamic acid, homocysteic acid and cysteic acid;
  • Zi is a dipeptide selected from the group consisting of aspartate-lysine, lysine-proline, and proline-lysine;
  • Bi is selected from the group consisting of threonine, alanine or a threonine- arginine- arginine tripeptide.
  • the insulin polypeptide comprises a B chain having the sequence R 23 -R 2 4-X 2 5LCGX 29 X 3 oLVX 33 X 3 4LYLVCGX4iX4 2 GFX45 (SEQ ID NO: 44) or R 23 -R 22 -HLCGSX 30 LVEALYLVCGERGFF (SEQ ID NO: 67) and an A chain having the sequence GIVX4ECCX 8 X9SCDLXi4Xi5LX 17 Xi8 i9CX2i-Ri3 (SEQ ID NO: 68)
  • X 4 is glutamic acid or aspartic acid
  • Xg is histidine, threonine or phenylalanine
  • X9 is arginine, lysine, ornithine or alanine
  • X 14 is arginine, lysine, ornithine or alanine
  • X 15 is glutamine, glutamic acid, arginine, alanine, lysine, ornithine or leucine;
  • X 17 is glutamine or glutamic acid
  • X 18 is methionine, asparagine, glutamine, aspartic acid, glutamic acid or threonine;
  • Xi9 is tyrosine, 4-methoxy-phenylalanine or 4-amino phenylalanine;
  • X 21 is selected from the group consisting of alanine, glycine, serine, valine, threonine, isoleucine, leucine, glutamine, glutamic acid, asparagine, aspartic acid, histidine, tryptophan, tyrosine, and methionine;
  • X 22 is selected from the group consisting of phenylalanine and desamino-phenylalanine;
  • X25 is histidine or threonine
  • X29 is selected from the group consisting of alanine and glycine
  • X30 is selected from the group consisting of histidine, aspartic acid, glutamic acid, homocysteic acid and cysteic acid;
  • X33 is selected from the group consisting of aspartic acid, glutamine and glutamic acid;
  • X34 is selected from the group consisting of alanine and threonine
  • X 41 is selected from the group consisting of glutamic acid, aspartic acid or asparagine;
  • X42 is selected from the group consisting of alanine, lysine, ornithine and arginine;
  • X45 is tyrosine or phenylalanine;
  • R 22 is selected from the group consisting of X 22 VNQ (SEQ ID NO: 101), a tripeptide valine-asparagine-glutamine, a dipeptide asparagine-glutamine, glutamine, and a bond;
  • R 23 is an N-terminal alpha amine or (SEQ ID NO: 102)
  • X 6 o is selected from the group consisting of glycine, glutamic acid and aspartic acid;
  • X 6 i and X 62 are independently selected from the group consisting of glutamic acid and aspartic acid;
  • X 63 is selected from the group consisting of arginine, aspartic acid and glutamic acid;
  • d is an integer selected from 1-3;
  • R 24 is selected from the group consisting of AYRPSE (SEQ ID NO: 46), PGPE (SEQ ID NO: 48), a tripeptide glycine-proline- glutamic acid, a dipeptide proline- glutamic acid, glutamine, glutamic acid and a bond; and
  • X 8 is histidine or phenylalanine
  • X 9 and X 14 are independently selected from arginine, lysine, ornithine or alanine;
  • X 15 is arginine, lysine, ornithine or leucine
  • X 17 is glutamic acid or glutamine
  • X 18 is methionine, asparagine or threonine
  • X 19 is tyrosine, 4-methoxy-phenylalanine or 4-amino phenylalanine;
  • X 21 is alanine, glycine or asparagine
  • X 23 is asparagine or glycine
  • X 2 5 is selected from the group consisting of histidine and threonine;
  • X 29 is selected from the group consisting of alanine, glycine and serine;
  • X 3 o is selected from the group consisting of histidine, aspartic acid, glutamic acid, homocysteic acid and cysteic acid;
  • X 33 is selected from the group consisting of aspartic acid and glutamic acid;
  • X 4 is selected from the group consisting of alanine and threonine
  • X42 is selected from the group consisting of alanine, lysine, ornithine and arginine;
  • X45 is tyrosine
  • R 13 is COOH or CONH 2 . In one embodiment at least one of n and k is 1.
  • GIVDECCHX 9 SCDLX 14 Xi5LX 17 X 18 Xi 9 CX 2 i-Ri 3 (SEQ ID NO: 50), and the B chain comprises the sequence X 25 LCGX2 9 X 3 oLVX 33 X 3 4LYLVCGDX42GFX 4 5 (SEQ ID NO: 51) wherein X 9 and X 14 are independently selected from arginine, lysine, ornithine or alanine; X 15 is arginine, lysine, ornithine or leucine;
  • X 17 is glutamic acid, aspartic acid, asparagine, lysine, ornithine or glutamine;
  • X 18 is methionine, asparagine or threonine
  • X 19 is tyrosine, 4-methoxy-phenylalanine or 4-amino phenylalanine;
  • X 21 is alanine, glycine or asparagine
  • X23 is asparagine or glycine
  • X25 is selected from the group consisting of histidine and threonine
  • X29 is selected from the group consisting of alanine, glycine and serine;
  • X30 is selected from the group consisting of histidine, aspartic acid, glutamic acid, homocysteic acid and cysteic acid;
  • X33 is selected from the group consisting of aspartic acid and glutamic acid;
  • X34 is selected from the group consisting of alanine and threonine
  • X 42 is selected from the group consisting of alanine, lysine, ornithine and arginine; X45 is tyrosine or phenylalanine and
  • R43 is COOH or CONH 2 .
  • the A chain comprises the sequence GrVDECCHX 9 SCDLXi4Xi5LX 17 MXi 9 CX2i-Ri3 (SEQ ID NO: 52), and the B chain comprises the sequence X 25 LCGAX 30 LVDALYLVCGDX 42 GFX 45 (SEQ ID NO: 53) wherein
  • X9, X 14 and X 15 are independently ornithine, lysine or arginine;
  • X 17 is glutamic acid or glutamine
  • X 19 is tyrosine, 4-methoxy-phenylalanine or 4-amino phenylalanine;
  • X 21 is alanine, glycine or asparagine
  • X 25 is selected from the group consisting of histidine and threonine
  • X 30 is selected from the group consisting of histidine, aspartic acid and glutamic acid;
  • X 42 is selected from the group consisting of alanine, lysine, ornithine and arginine;
  • X 45 is tyrosine or phenylalanine and
  • R43 is COOH or CONH 2 .
  • the B chain is selected from the group consisting of HLCGAELVDALYLVCGDX 42 GFY (SEQ ID NO: 54),
  • GPEHLCGAELVDALYLVCGDX 42 GFYFNPKT SEQ ID NO: 56
  • GPEHLCGAELVDALYLVCGDX 42 GFYFNKPT (SEQ ID NO: 57), wherein X 42 is selected from the group consisting of ornithine, lysine and arginine.
  • the A chain comprises the sequence GIVDECCHX 9 SCDLXi 4 Xi 5 LQMYCN-R 13 (SEQ ID NO: 18), wherein X 9 , X 14 and 15 are independently ornithine, lysine or arginine.
  • an insulin single chain analog comprising the general formula IB-LM-IA wherein IB is an amino acid sequence selected from the group consisting of HLCGAELVDALYLVCGDX 42 GFY (SEQ ID NO: 54),
  • GPEHLCGAELVDALYLVCGDX 42 GFYFNPKT SEQ ID NO: 56
  • GPEHLCGAELVDALYLVCGDX 42 GFYFNKPT (SEQ ID NO: 57)
  • LM is a linking moiety selected from the group consisting of GAGSSSX 57 RAPQT SEQ ID NO: 18), GYGSSSX 57 R (SEQ ID NO: 58) and IA is the amino acid sequence GIVDECCHX 9 SCDLXi 4 Xi 5 LQMYCN- R 13 (SEQ ID NO: 18), wherein X9, X 14 , X 15 X 42 and X 57 are independently ornithine, lysine or arginine.
  • the linking moiety is GYGSSSOR (SEQ ID NO: 59).
  • HLCGAELVDALYLVCGDOGFY (SEQ ID NO: 60), GPEHLCGAELVDALYLVCGDOGFY (SEQ ID NO: 61), GPEHLCGAELVDALYLVCGDOGFYFNPKT (SEQ ID NO: 62) and GPEHLCG AELVD ALYLVCGD OGF YFNKPT (SEQ ID NO: 63) and the A chain is
  • GIVDECCHOSCDLOOLQMXi 9 CN-R 13 (SEQ ID NO: 64), wherein X 19 is tyrosine, 4- methoxy-phenylalanine or 4- amino phenylalanine.
  • the insulin polypeptides disclosed herein are further modified to comprise a hydrophilic moiety covalently linked to the side chain of an amino acid at a position selected from the group consisting of A9, A14 and A15 of the A chain or at the N-terminal alpha amine of the B chain (e.g.
  • this hydrophilic moiety is covalently linked to a Lys, Cys, Orn, homocysteine, or acetyl-phenylalanine residue at any of these positions.
  • the hydrophilic moiety is covalently linked to the side chain of an amino acid of the linking moiety.
  • hydrophilic moieties include polyethylene glycol (PEG), for example, of a molecular weight of about 1,000 Daltons to about 40,000 Daltons, or about 20,000 Daltons to about 40,000 Daltons.
  • Additional suitable hydrophilic moieties include, polypropylene glycol, polyoxyethylated polyols (e.g., POG), polyoxyethylated sorbitol, polyoxyethylated glucose, polyoxyethylated glycerol (POG), polyoxyalkylenes, polyethylene glycol propionaldehyde, copolymers of ethylene glycol/propylene glycol, monomethoxy-polyethylene glycol, mono- (C1-C10) alkoxy- or aryloxy-polyethylene glycol, carboxymethylcellulose, polyacetals, polyvinyl alcohol (PVA), polyvinyl pyrrolidone, poly-1, 3-dioxolane, poly-l,3,6-trioxane, ethylene/male
  • hydrophilic moiety e.g., polyethylene glycol chain in accordance with some embodiments has a molecular weight selected from the range of about 500 to about 40,000
  • the hydrophilic moiety e.g. PEG
  • the hydrophilic moiety, e.g., PEG has a molecular weight of about 10,000 to about 20,000 Daltons.
  • the hydrophilic moiety, e.g., PEG has a molecular weight of about 20,000 to about 40,000 Daltons.
  • the hydrophilic moiety, e.g. PEG has a molecular weight of about 20,000 Daltons.
  • an insulin polypeptide is provided wherein one or more amino acids of the analog are pegylated, and the combined molecular weight of the covalently linked PEG chains is about 20,000 Daltons.
  • dextrans are used as the hydrophilic moiety.
  • Dextrans are polysaccharide polymers of glucose subunits, predominantly linked by ccl-6 linkages. Dextran is available in many molecular weight ranges, e.g., about 1 kD to about 100 kD, or from about 5, 10, 15 or 20 kD to about 20, 30, 40, 50, 60, 70, 80 or 90 kD.
  • Linear or branched polymers are contemplated.
  • Resulting preparations of conjugates may be essentially monodisperse or polydisperse, and may have about 0.5, 0.7, 1, 1.2, 1.5 or 2 polymer moieties per peptide.
  • the hydrophilic moiety is a polyethylene glycol (PEG) chain, optionally linked to the side chain of an amino acid at a position selected from the group consisting of A9, A14 and A15 of the A chain, positions Bl, B2, BIO, B22, B28 or B29 of the B chain, at the N-terminal alpha amine of the B chain, or at any position of the linking moiety that links the A chain and B chain, including for example at position C8 in an insulin single chain analog.
  • the insulin single chain analog comprises a peptide linking moiety of 8 to 12 amino acids, wherein one of the amino acids of the linking moiety has a polyethylene chain covalently bound to its side chain.
  • the insulin single chain analog comprises a peptide linking moiety of 8 to 12 amino acids, wherein an amino acid of the linking moiety is pegylated and one or more amino acid at a position selected from the group consisting of A9, A14 and A15 of the A chain, positions Bl, B2, BIO, B22, B28 or B29 of the B chain is also pegylated.
  • the total molecular weight of the covalently linked PEG chain(s) is about 20,000 Daltons.
  • Hydrophilic moieties such as polyethylene glycol can be attached to the insulin polypeptide under any suitable conditions used to react a protein with an activated polymer molecule. Any means known in the art can be used, including via acylation, reductive alkylation, Michael addition, thiol alkylation or other chemoselective conjugation/ligation methods through a reactive group on the PEG moiety (e.g., an aldehyde, amino, ester, thiol, a- haloacetyl, maleimido or hydrazino group) to a reactive group on the target compound (e.g., an aldehyde, amino, ester, thiol, a-haloacetyl, maleimido or hydrazino group).
  • a reactive group on the PEG moiety e.g., an aldehyde, amino, ester, thiol, a-haloacetyl, maleimido or hydrazino group
  • Activating groups which can be used to link the water soluble polymer to one or more proteins include without limitation sulfone, maleimide, sulfhydryl, thiol, triflate, tresylate, azidirine, oxirane and 5- pyridyl. If attached to the peptide by reductive alkylation, the polymer selected should have a single reactive aldehyde so that the degree of polymerization is controlled. See, for example, Kinstler et al., Adv. Drug. Delivery Rev. 54: 477-485 (2002); Roberts et al., Adv. Drug Delivery Rev. 54: 459-476 (2002); and Zalipsky et al., Adv. Drug Delivery Rev. 16: 157-182 (1995).
  • an amino acid residue on the insulin polypeptide having a thiol is modified with a hydrophilic moiety such as PEG.
  • the thiol is modified with maleimide- activated PEG in a Michael addition reaction to result in a PEGylated peptide comprising the thioether linkage shown below:
  • the thiol is modified with a haloacetyl-activated PEG in a nucleophilic substitution reaction to result in a PEGylated peptide comprising the thioether linkage shown below:
  • the insulin polypeptide is modified to comprise an acyl group.
  • the acyl group can be covalently linked directly to an amino acid of the insulin polypeptide, or indirectly to an amino acid of the insulin polypeptide via a spacer, wherein the spacer is positioned between the amino acid of the insulin polypeptide and the acyl group.
  • the insulin polypeptide may be acylated at the same amino acid position where a hydrophilic moiety is linked, or at a different amino acid position. For example, acylation may occur at any position including any amino acid of the A or B chains as well as a position within the linking moiety, provided that the activity exhibited by the non-acylated insulin polypeptide is retained upon acylation.
  • Nonlimiting examples include acylation at positions A14 and A15 of the A chain, positions position Bl for insulin based B chain or position B2 for IGF-1 based B chain or positions BIO, B22, B28 or B29 of the B chain or at any position of the linking moiety of a single chain insulin analog.
  • the insulin polypeptide (or derivative or conjugate thereof) is modified to comprise an acyl group by direct acylation of an amine, hydroxyl, or thiol of a side chain of an amino acid of the insulin polypeptide.
  • the insulin polypeptide is directly acylated through the side chain amine, hydroxyl, or thiol of an amino acid.
  • acylation is at position B28 or B29 (according to the amino acid numbering of the native insulin A and B chain sequences).
  • an insulin polypeptide can be provided that has been modified by one or more amino acid substitutions in the A or B chain sequence, including for example at positions A14, A15, Bl, B2, BIO, B22, B28 or B29 (according to the amino acid numbering of the native insulin A and B chain sequences) or at any position of the linking moiety with an amino acid comprising a side chain amine, hydroxyl, or thiol.
  • the direct acylation of the insulin polypeptide occurs through the side chain amine, hydroxyl, or thiol of the amino acid at position B28 or B29 (according to the amino acid numbering of the native insulin A and B chain sequences).
  • the insulin polypeptide comprises an amino acid of Formula I:
  • the amino acid of Formula I is the amino acid wherein n is 4 (Lys) or n is 3 (Orn).
  • the insulin polypeptide comprises an amino acid of Formula II:
  • the amino acid of Formula II is the amino acid wherein n is 1 (Ser).
  • the insulin polypeptide comprises a side chain thiol is an amino acid of Formula III:
  • the amino acid of Formula III is the amino acid wherein n is 1 (Cys).
  • the insulin polypeptide comprises a disubstituted amino acid comprising the same structure of Formula I, Formula II, or Formula III, except that the hydrogen bonded to the alpha carbon of the amino acid of Formula I, Formula II, or Formula III is replaced with a second side chain.
  • the acylated insulin polypeptides comprise a spacer between the peptide and the acyl group.
  • the insulin polypeptide is covalently bound to the spacer, which is covalently bound to the acyl group.
  • the insulin polypeptide is modified to comprise an acyl group by acylation of an amine, hydroxyl, or thiol of a spacer, which spacer is attached to a side chain of an amino acid at position B28 or B29 (according to the amino acid numbering of the A or B chain of native insulin), or at any position of the spacer moiety.
  • the amino acid of the insulin polypeptide to which the spacer is attached can be any amino acid comprising a moiety which permits linkage to the spacer.
  • an amino acid comprising a side chain -NH 2 , -OH, or -COOH e.g., Lys, Orn, Ser, Asp, or Glu is suitable.
  • the spacer between the insulin polypeptide and the acyl group is an amino acid comprising a side chain amine, hydroxyl, or thiol (or a dipeptide or tripeptide comprising an amino acid comprising a side chain amine, hydroxyl, or thiol).
  • the spacer comprises a hydrophilic bifunctional spacer.
  • the spacer comprises an amino poly(alkyloxy)carboxylate.
  • the spacer can comprise, for example, NH 2 (CH 2 CH 2 0) n (CH 2 ) m COOH, wherein m is any integer from 1 to 6 and n is any integer from 2 to 12, such as, e.g., 8-amino-3,6-dioxaoctanoic acid, which is commercially available from Peptides International, Inc. (Louisville, KY).
  • the hydrophilic bifunctional spacer comprises two or more reactive groups, e.g., an amine, a hydroxyl, a thiol, and a carboxyl group or any combinations thereof.
  • the hydrophilic bifunctional spacer comprises a hydroxyl group and a
  • the hydrophilic bifunctional spacer comprises an amine group and a carboxylate. In other embodiments, the hydrophilic bifunctional spacer comprises a thiol group and a carboxylate.
  • the spacer between peptide the insulin polypeptide and the acyl group is a hydrophobic bifunctional spacer.
  • Hydrophobic bifunctional spacers are known in the art. See, e.g., Bioconjugate Techniques, G. T. Hermanson (Academic Press, San Diego, CA, 1996), which is incorporated by reference in its entirety.
  • the hydrophobic bifunctional spacer comprises two or more reactive groups, e.g., an amine, a hydroxyl, a thiol, and a carboxyl group or any combinations thereof.
  • the hydrophobic bifunctional spacer comprises a hydroxyl group and a carboxylate.
  • the hydrophobic bifunctional spacer comprises an amine group and a
  • the hydrophobic bifunctional spacer comprises a thiol group and a carboxylate.
  • Suitable hydrophobic bifunctional spacers comprising a carboxylate and a hydroxyl group or a thiol group are known in the art and include, for example, 8- hydroxyoctanoic acid and 8-mercaptooctanoic acid.
  • the bifunctional spacer can be a synthetic or naturally occurring amino acid comprising an amino acid backbone that is 3 to 10 atoms in length (e.g., 6-amino hexanoic acid, 5 -amino valeric acid, 7-aminoheptanoic acid, and 8- aminooctanoic acid).
  • the spacer can be a dipeptide or tripeptide spacer having a peptide backbone that is 3 to 10 atoms (e.g., 6 to 10 atoms) in length.
  • Each amino acid of the dipeptide or tripeptide spacer attached to the insulin polypeptide can be independently selected from the group consisting of: naturally-occurring and/or non-naturally occurring amino acids, including, for example, any of the D or L isomers of the naturally- occurring amino acids (Ala, Cys, Asp, Glu, Phe, Gly, His, He, Lys, Leu, Met, Asn, Pro, Arg, Ser, Thr, Val, Trp, Tyr), or any D or L isomers of the non-naturally occurring amino acids selected from the group consisting of: ⁇ -alanine ( ⁇ -Ala), N-a-methyl- alanine (Me-Ala), aminobutyric acid (Abu), a-aminobutyric acid ( ⁇ -Abu), aminohexanoic acid ( ⁇ -Ahx), aminoisobutyric acid (Aib), aminomethylpyrrole carboxylic acid, aminopiperidinecarboxylic acid, aminoserine (Ams),
  • DMTA dimethylthiazolidine
  • ⁇ -Glutamic acid ⁇ -Glu
  • homoserine Hse
  • hydroxyproline Hyp
  • isoleucine N-methoxy-N-methyl amide methyl-isoleucine (MeHe)
  • isonipecotic acid Isn
  • MeLeu methyl-lysine
  • dimethyl-lysine trimethyl-lysine
  • methanoproline methionine- sulfoxide (Met(O)), methionine- sulf one (Met(02)), norleucine (Nle), methyl-norleucine (Me-Nle), norvaline (Nva), ornithine (Orn), para-aminobenzoic acid (PABA), penicillamine (Pen), methylphenylalanine (MePhe), 4-Chlorophenylalanine (Phe(4- Cl)), 4-fluorophenylalanine (Phe(4-F)), 4-nitrophenylalanine (Phe(4-N02)), 4- cyanophenylalanine ((Phe(4-CN)), phenylglycine (Phg), piperidinylalanine, piperidinylglycine, 3,4-dehydroproline, pyrrolidinylalanine, sarcosine (Sar), selenocysteine (Sec), U-
  • MeVal 1 -amino- 1-cyclohexane carboxylic acid (Acx), aminovaleric acid, beta-cyclopropyl- alanine (Cpa), propargylglycine (Prg), allylglycine (Alg), 2-amino-2-cyclohexyl-propanoic acid (2-Cha), tertbutylglycine (Tbg), vinylglycine (Vg), 1 -amino- 1 -cyclopropane carboxylic acid (Acp), 1 -amino- 1-cyclopentane carboxylic acid (Acpe), alkylated 3-mercaptopropionic acid, 1- amino- 1-cyclobutane carboxylic acid (Acb).
  • the dipeptide spacer is selected from the group consisting of: Ala- Ala, ⁇ -Ala- ⁇ -Ala, Leu-Leu, Pro-Pro, ⁇ - aminobutyric acid- ⁇ -aminobutyric acid, and ⁇ -Glu- ⁇ -Glu.
  • the insulin polypeptide can be modified to comprise an acyl group by acylation of a long chain alkane.
  • the long chain alkane comprises an amine, hydroxyl, or thiol group (e.g. octadecylamine, tetradecanol, and hexadecanethiol) which reacts with a carboxyl group, or activated form thereof, of the insulin polypeptide.
  • the carboxyl group, or activated form thereof, of the insulin polypeptide can be part of a side chain of an amino acid (e.g., glutamic acid, aspartic acid) of the insulin polypeptide or can be part of the peptide backbone.
  • the insulin polypeptide is modified to comprise an acyl group by acylation of the long chain alkane by a spacer which is attached to the insulin polypeptide.
  • the long chain alkane comprises an amine, hydroxyl, or thiol group which reacts with a carboxyl group, or activated form thereof, of the spacer.
  • Suitable spacers comprising a carboxyl group, or activated form thereof, are described herein and include, for example, bifunctional spacers, e.g., amino acids, dipeptides, tripeptides, hydrophilic bifunctional spacers and hydrophobic bifunctional spacers.
  • activated forms of a carboxyl groups may include, but are not limited to, acyl chlorides, anhydrides, and esters.
  • the activated carboxyl group is an ester with a N-hydroxysuccinimide (NHS) leaving group.
  • the long chain alkane in which a long chain alkane is acylated by the peptide the insulin polypeptide or the spacer, the long chain alkane may be of any size and can comprise any length of carbon chain.
  • the long chain alkane can be linear or branched. In certain aspects, the long chain alkane is a C 4 to C30 alkane.
  • the long chain alkane can be any of a C 4 alkane, C 6 alkane, C 8 alkane, C 10 alkane, C 12 alkane, C 14 alkane, C 16 alkane, C 18 alkane, C 20 alkane, C 22 alkane, C 24 alkane, C 3 ⁇ 4 alkane, C 28 alkane, or a C30 alkane.
  • the long chain alkane comprises a C 8 to C 2 o alkane, e.g., a C 14 alkane, C 16 alkane, or a C 18 alkane.
  • an amine, hydroxyl, or thiol group of the insulin polypeptide is acylated with a cholesterol acid.
  • the peptide is linked to the cholesterol acid through an alkylated des-amino Cys spacer, i.e., an alkylated 3- mercaptopropionic acid spacer. Suitable methods of peptide acylation via amines, hydroxyls, and thiols are known in the art.
  • the acyl group of the acylated peptide the insulin polypeptide can be of any size, e.g., any length carbon chain, and can be linear or branched.
  • the acyl group is a C 4 to C30 fatty acid.
  • the acyl group can be any of a C 4 fatty acid, C 6 fatty acid, C 8 fatty acid, C 10 fatty acid, C 12 fatty acid, C 14 fatty acid, C 16 fatty acid, C 18 fatty acid, C 2 o fatty acid, C 22 fatty acid, C 24 fatty acid, C 3 ⁇ 4 fatty acid, C 28 fatty acid, or a C30 fatty acid.
  • the acyl group is a C 8 to C 20 fatty acid, e.g., a C 14 fatty acid or a C 16 fatty acid.
  • the acyl group is a bile acid.
  • the bile acid can be any suitable bile acid, including, but not limited to, cholic acid, chenodeoxycholic acid, deoxycholic acid, lithocholic acid, taurocholic acid, glycocholic acid, and cholesterol acid.
  • the acylated insulin polypeptide described herein can be further modified to comprise a hydrophilic moiety.
  • the hydrophilic moiety can comprise a polyethylene glycol (PEG) chain.
  • PEG polyethylene glycol
  • the acylated single chain analog comprises an amino acid selected from the group consisting of a Cys, Lys, Orn, homo-Cys, or Ac-Phe, and the side chain of the amino acid is covalently bonded to a hydrophilic moiety (e.g., PEG).
  • a hydrophilic moiety e.g., PEG
  • the acyl group is attached to position A14, A15, Bl (for insulin based B chains), B2 (for IGF-1 based B chains), BIO, B22, B28 or B29 (according to the amino acid numbering of the A and B chains of native insulin), optionally via a spacer comprising Cys, Lys, Orn, homo-Cys, or Ac-Phe.
  • the acylated insulin polypeptide comprises a spacer, wherein the spacer is both acylated and modified to comprise the hydrophilic moiety.
  • suitable spacers include a spacer comprising one or more amino acids selected from the group consisting of Cys, Lys, Orn, homo-Cys, and Ac-Phe. Alkylation of the insulin polypeptide
  • the insulin polypeptide is modified to comprise an alkyl group.
  • the alkyl group can be covalently linked directly to an amino acid of the insulin polypeptide, or indirectly to an amino acid of the insulin polypeptide via a spacer, wherein the spacer is positioned between the amino acid of the insulin polypeptide and the alkyl group.
  • the alkyl group can be attached to the insulin polypeptide via an ether, thioether, or amino linkage.
  • the insulin polypeptide may be alkylated at the same amino acid position where a hydrophilic moiety is linked, or at a different amino acid position.
  • Alkylation can be carried out at any position within the insulin polypeptide, including for example in the C-terminal region of the B chain or at a position in the linking moiety, provided that insulin activity is retained.
  • the insulin polypeptide is modified to comprise an alkyl group by direct alkylation of an amine, hydroxyl, or thiol of a side chain of an amino acid of the insulin polypeptide.
  • the insulin polypeptide is directly alkylated through the side chain amine, hydroxyl, or thiol of an amino acid.
  • the direct alkylation of the insulin polypeptide occurs through the side chain amine, hydroxyl, or thiol of the amino acid at position A14, A15, Bl (for insulin based B chains), B2 (for IGF-1 based b chains), BIO, B22, B28 or B29 (according to the amino acid numbering of the A and B chain of native insulin).
  • the amino acid of the insulin polypeptide comprises an amino acid selected from of Formula I, Formula II, and Formula III, and the alkyl group is linked through the amino, hydroxyl or thiol group contained in Formula I, Formula II, and Formula III, respectively.
  • the amino acid of Formula I is the amino acid wherein n is 4 (Lys) or n is 3 (Orn).
  • the amino acid of Formula II is the amino acid wherein n is 1 (Ser).
  • the amino acid of Formula II is the amino acid wherein n is 1 (Cys).
  • the amino acid of peptide the insulin polypeptide comprising a side chain amine, hydroxyl, or thiol is a disubstituted amino acid comprising the same structure of Formula I, Formula II, or Formula III, except that the hydrogen bonded to the alpha carbon of the amino acid of Formula I, Formula II, or Formula III is replaced with a second side chain.
  • the insulin polypeptide comprises a spacer between the peptide and the alkyl group.
  • the insulin polypeptide is covalently bound to the spacer, which is covalently bound to the alkyl group.
  • the insulin polypeptide is modified to comprise an alkyl group by alkylation of an amine, hydroxyl, or thiol of a spacer, wherein the spacer is attached to a side chain of an amino acid at position A14, A15, Bl (for insulin based b chains), B2 (for IGF-1 based B chains), BIO, B22, B28 or B29 (according to the amino acid numbering of the A and B chains of native insulin).
  • the amino acid of the insulin polypeptide to which the spacer is attached can be any amino acid (e.g., a singly a-substituted amino acid or an ⁇ , ⁇ -disubstituted amino acid) comprising a moiety which permits linkage to the spacer.
  • An amino acid of the insulin polypeptide comprising a side chain -NH 2 , -OH, or -COOH e.g., Lys, Orn, Ser, Asp, or Glu
  • Lys, Orn, Ser, Asp, or Glu is suitable.
  • the spacer between the peptide the insulin polypeptide and the alkyl group is an amino acid comprising a side chain amine, hydroxyl, or thiol or a dipeptide or tripeptide comprising an amino acid comprising a side chain amine, hydroxyl, or thiol.
  • the spacer amino acid can be any amino acid.
  • the spacer amino acid can be a hydrophobic amino acid, e.g., Gly, Ala, Val, Leu, He, Trp, Met, Phe, Tyr.
  • the spacer amino acid can be an acidic residue, e.g., Asp and Glu.
  • the spacer amino acid can be a hydrophobic amino acid, e.g., Gly, Ala, Val, Leu, He, Trp, Met, Phe, Tyr, 6-amino hexanoic acid, 5-aminovaleric acid, 7-aminoheptanoic acid, 8-aminooctanoic acid.
  • the spacer amino acid can be an acidic residue, e.g., Asp and Glu, provided that the alkylation occurs on the alpha amine of the acidic residue.
  • the spacer amino acid is an amino acid comprising a side chain amine, e.g., an amino acid of Formula I (e.g., Lys or Orn).
  • an amino acid of Formula I e.g., Lys or Orn
  • both the alpha amine and the side chain amine of the spacer amino acid it is possible for both the alpha amine and the side chain amine of the spacer amino acid to be alkylated, such that the peptide is dialkylated.
  • Embodiments of the invention include such dialkylated molecules.
  • the amino acid or one of the amino acids of the spacer can be an amino acid of Formula II.
  • the amino acid is Ser.
  • the amino acid or one of the amino acids of the spacer can be an amino acid of Formula III.
  • the amino acid is Cys.
  • the spacer comprises a hydrophilic bifunctional spacer.
  • the spacer comprises an amino poly(alkyloxy)carboxylate.
  • the spacer can comprise, for example, NH 2 (CH 2 CH 2 0) n (CH 2 ) m COOH, wherein m is any integer from 1 to 6 and n is any integer from 2 to 12, such as, e.g., 8-amino-3,6-dioxaoctanoic acid, which is commercially available from Peptides International, Inc. (Louisville, KY).
  • the spacer between peptide the insulin polypeptide and the alkyl group is a hydrophilic bifunctional spacer.
  • the hydrophilic bifunctional spacer comprises two or more reactive groups, e.g., an amine, a hydroxyl, a thiol, and a carboxyl group or any combinations thereof.
  • the hydrophilic bifunctional spacer comprises a hydroxyl group and a carboxylate.
  • the hydrophilic bifunctional spacer comprises an amine group and a carboxylate.
  • the hydrophilic bifunctional spacer comprises a thiol group and a carboxylate.
  • the spacer between peptide the insulin polypeptide and the alkyl group is a hydrophobic bifunctional spacer.
  • the hydrophobic bifunctional spacer comprises two or more reactive groups, e.g., an amine, a hydroxyl, a thiol, and a carboxyl group or any combinations thereof.
  • the hydrophobic bifunctional spacer comprises a hydroxyl group and a carboxylate.
  • the hydrophobic bifunctional spacer comprises an amine group and a carboxylate.
  • the hydrophobic bifunctional spacer comprises a thiol group and a carboxylate.
  • Suitable hydrophobic bifunctional spacers comprising a carboxylate and a hydroxyl group or a thiol group are known in the art and include, for example, 8-hydroxyoctanoic acid and 8- mercaptooctanoic acid.
  • the spacer e.g., amino acid, dipeptide, tripeptide, hydrophilic bifunctional spacer, or hydrophobic bifunctional spacer
  • the spacer is 3 to 10 atoms (e.g., 6 to 10 atoms, (e.g., 6, 7, 8, 9, or 10 atoms)) in length.
  • the spacer is about 3 to 10 atoms (e.g., 6 to 10 atoms) in length and the alkyl is a C 12 to C 18 alkyl group, e.g., C 14 alkyl group, C 16 alkyl group, such that the total length of the spacer and alkyl group is 14 to 28 atoms, e.g., about 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, or 28 atoms. In some embodiments the length of the spacer and alkyl is 17 to 28 (e.g., 19 to 26, 19 to 21) atoms.
  • the bifunctional spacer is a synthetic or non- naturally occurring amino acid comprising an amino acid backbone that is 3 to 10 atoms in length (e.g., 6-amino hexanoic acid, 5 -amino valeric acid, 7-aminoheptanoic acid, and 8- aminooctanoic acid).
  • the spacer can be a dipeptide or tripeptide spacer having a peptide backbone that is 3 to 10 atoms (e.g., 6 to 10 atoms) in length.
  • the dipeptide or tripeptide spacer attached to the insulin polypeptide can be composed of naturally-occurring and/or non-naturally occurring amino acids, including, for example, any of the amino acids taught herein.
  • the spacer comprises an overall negative charge, e.g., comprises one or two negatively charged amino acids.
  • the dipeptide spacer is selected from the group consisting of: Ala- Ala, ⁇ -Ala- ⁇ -Ala, Leu-Leu, Pro-Pro, ⁇ - aminobutyric acid- ⁇ -aminobutyric acid, and ⁇ -Glu- ⁇ -Glu.
  • the dipeptide spacer is ⁇ -Glu- ⁇ -Glu.
  • Suitable methods of peptide alkylation via amines, hydroxyls, and thiols are known in the art.
  • a Williamson ether synthesis can be used to form an ether linkage between the insulin peptide and the alkyl group.
  • a nucleophilic substitution reaction of the peptide with an alkyl halide can result in any of an ether, thioether, or amino linkage.
  • the alkyl group of the alkylated peptide the insulin polypeptide can be of any size, e.g., any length carbon chain, and can be linear or branched. In some embodiments of the invention, the alkyl group is a C 4 to C30 alkyl.
  • the alkyl group can be any of a C 4 alkyl, C 6 alkyl, C 8 alkyl, C 10 alkyl, C 12 alkyl, C 14 alkyl, C 16 alkyl, C 18 alkyl, C 2 o alkyl, C 22 alkyl, C 24 alkyl, C 26 alkyl, C 28 alkyl, or a C30 alkyl.
  • the alkyl group is a C 8 to C 20 alkyl, e.g., a C 14 alkyl or a C 16 alkyl.
  • the alkyl group comprises a steroid moiety of a bile acid, e.g., cholic acid, chenodeoxycholic acid, deoxycholic acid, lithocholic acid, taurocholic acid, glycocholic acid, and cholesterol acid.
  • a bile acid e.g., cholic acid, chenodeoxycholic acid, deoxycholic acid, lithocholic acid, taurocholic acid, glycocholic acid, and cholesterol acid.
  • the insulin polypeptide is modified to comprise an alkyl group by reacting a nucleophilic, long chain alkane with the insulin polypeptide, wherein the insulin polypeptide comprises a leaving group suitable for nucleophilic substitution.
  • the nucleophilic group of the long chain alkane comprises an amine, hydroxyl, or thiol group (e.g. octadecylamine, tetradecanol, and hexadecanethiol).
  • the leaving group of the insulin polypeptide can be part of a side chain of an amino acid or can be part of the peptide backbone. Suitable leaving groups include, for example, N-hydroxysuccinimide, halogens, and sulfonate esters.
  • the insulin polypeptide is modified to comprise an alkyl group by reacting the nucleophilic, long chain alkane with a spacer, which is attached to the insulin polypeptide, wherein the spacer comprises the leaving group.
  • the long chain alkane comprises an amine, hydroxyl, or thiol group.
  • the spacer comprising the leaving group can be any spacer discussed herein, e.g., amino acids, dipeptides, tripeptides, hydrophilic bifunctional spacers and hydrophobic bifunctional spacers further comprising a suitable leaving group.
  • the long chain alkane When a long chain alkane is alkylated by the insulin polypeptide or the spacer, the long chain alkane may be of any size and can comprise any length of carbon chain.
  • the long chain alkane can be linear or branched.
  • the long chain alkane is a C 4 to C30 alkane.
  • the long chain alkane can be any of a C 4 alkane, C 6 alkane, C 8 alkane, C 10 alkane, C 12 alkane, C 14 alkane, C 16 alkane, C 18 alkane, C 2 o alkane, C 22 alkane, C 24 alkane, C 3 ⁇ 4 alkane, C 28 alkane, or a C30 alkane.
  • the long chain alkane comprises a C 8 to C 20 alkane, e.g., a C 14 alkane, C 16 alkane, or a C 18 alkane.
  • alkylation can occur between the insulin polypeptide and a cholesterol moiety.
  • the hydroxyl group of cholesterol can displace a leaving group on the long chain alkane to form a cholesterol-insulin peptide product.
  • the alkylated insulin polypeptides described herein can be further modified to comprise a hydrophilic moiety.
  • the hydrophilic moiety can comprise a polyethylene glycol (PEG) chain. The incorporation of a hydrophilic moiety can be accomplished through any suitable means, such as any of the methods described herein.
  • the insulin polypeptide can comprise an amino acid selected from Cys, Lys, Orn, homo-Cys, or Ac-Phe, wherein the side chain of the amino acid is covalently bonded to a hydrophilic moiety (e.g., PEG).
  • a hydrophilic moiety e.g., PEG
  • the alkyl group is attached to position A14, A15, Bl (for insulin based B chains), B2 (for IGF-1 based B chains), BIO, B22, B28 or B29 (according to the amino acid numbering of the A or B chain of native insulin), optionally via a spacer comprising Cys, Lys, Orn, homo-Cys, or Ac-Phe, and optionally further comprising a hydrophilic moiety linked to the side chain of another amino acid.
  • the alkylated insulin polypeptide can comprise a spacer, wherein the spacer is both alkylated and modified to comprise the hydrophilic moiety.
  • suitable spacers include a spacer comprising one or more amino acids selected from the group consisting of Cys, Lys, Orn, homo-Cys, and Ac- Phe.
  • the insulin polypeptides described herein are glycosylated, amidated, carboxylated, phosphorylated, esterified, N-acylated, cyclized via, e.g., a disulfide bridge, or converted into a salt (e.g., an acid addition salt, a basic addition salt), and/or optionally conjugated.
  • the present disclosure also encompasses conjugates in which the insulin polypeptide is linked to a heterologous moiety.
  • the conjugation between the insulin polypeptide and the heterologous moiety can be through covalent bonding, non-covalent bonding (e.g. electrostatic interactions, hydrogen bonds, van der Waals interactions, salt bridges, hydrophobic interactions, and the like), or both types of bonding.
  • non-covalent coupling systems may be used, including biotin-avidin, ligand/receptor,
  • the covalent bonds are peptide bonds.
  • the conjugation of the insulin polypeptide to the heterologous moiety may be indirect or direct conjugation, the former of which may involve a linker or spacer. Suitable linkers and spacers are known in the art and include, but not limited to, any of the linkers or spacers described.
  • heterologous moiety is synonymous with the term “conjugate moiety” and refers to any molecule (chemical or biochemical, naturally- occurring or non- coded) which is different from the insulin polypeptide to which it is attached.
  • exemplary conjugate moieties that can be linked to the insulin polypeptide include but are not limited to a heterologous peptide or polypeptide (including for example, a plasma protein), a targeting agent, an immunoglobulin or portion thereof (e.g., variable region, CDR, or Fc region), a diagnostic label such as a radioisotope, fluorophore or enzymatic label, a polymer including water soluble polymers, or other therapeutic or diagnostic agents.
  • a conjugate comprising the insulin polypeptide and a plasma protein, wherein the plasma protein is selected from the group consisting of albumin, transferin, fibrinogen and globulins.
  • the plasma protein moiety of the conjugate is albumin or transferin.
  • the heterologous moiety is albumin, including for example, albumins such as human serum albumin (HSA) and recombinant human albumin (rHA).
  • the conjugate in some embodiments comprises the insulin polypeptide and one or more of a polypeptide, a nucleic acid molecule, an antibody or fragment thereof, a polymer, a the insulin polypeptideuantum dot, a small molecule, a toxin, a diagnostic agent, a carbohydrate, an amino acid.
  • Polymer Heterologous Moiety a polypeptide, a nucleic acid molecule, an antibody or fragment thereof, a polymer, a the insulin polypeptideuantum dot, a small molecule, a toxin, a diagnostic agent, a carbohydrate, an amino acid.
  • the heterologous moiety conjugated to the insulin polypeptide is a polymer.
  • the polymer is selected from the group consisting of:
  • the polymer is a biodegradable polymer, including a synthetic biodegradable polymer (e.g., polymers of lactic acid and glycolic acid, polyanhydrides, poly(ortho)esters, polyurethanes, poly(butic acid), poly(valeric acid), and poly(lactide- cocaprolactone)), and a natural biodegradable polymer (e.g., alginate and other polysaccharides including dextran and cellulose, collagen, chemical derivatives thereof (substitutions, additions of chemical groups, for example, alkyl, alkylene, hydroxylations, oxidations, and other modifications routinely made by those skilled in the art), albumin and other hydrophilic proteins (e.g., zein and other prolamines and hydrophobic proteins)), as well as any copolymer or mixture thereof.
  • these materials degrade either by enzymatic hydrolysis or exposure to water in vivo, by surface or bulk erosion.
  • the polymer is a bioadhesive polymer, such as a bioerodible hydrogel described by H. S. Sawhney, C. P. Pathak and J. A. Hubbell in Macromolecules, 1993, 26, 581- 587, the teachings of which are incorporated herein, polyhyaluronic acids, casein, gelatin, glutin, polyanhydrides, polyacrylic acid, alginate, chitosan, poly(methyl methacrylates), poly(ethyl methacrylates), poly(butylmethacrylate), poly(isobutyl methacrylate),
  • a bioadhesive polymer such as a bioerodible hydrogel described by H. S. Sawhney, C. P. Pathak and J. A. Hubbell in Macromolecules, 1993, 26, 581- 587, the teachings of which are incorporated herein, polyhyaluronic acids, casein, gelatin, glutin, polyanhydrides, polyacrylic acid, alginate,
  • the polymer is a water-soluble polymer or a hydrophilic polymer.
  • Hydrophilic polymers are further described herein under "Hydrophilic Heterologous Moieties.” Suitable water-soluble polymers are known in the art and include, for example,
  • polyvinylpyrrolidone hydroxypropyl cellulose (HPC; Klucel), hydroxypropyl methylcellulose (HPMC; Methocel), nitrocellulose, hydroxypropyl ethylcellulose, hydroxypropyl
  • butylcellulose hydroxypropyl pentylcellulose, methyl cellulose, ethylcellulose (Ethocel), hydroxyethyl cellulose, various alkyl celluloses and hydroxyalkyl celluloses, various cellulose ethers, cellulose acetate, carboxymethyl cellulose, sodium carboxymethyl cellulose, calcium carboxymethyl cellulose, vinyl acetate/crotonic acid copolymers, poly-hydroxyalkyl
  • carboxypolymethylene carboxypolymethylene, carboxyvinyl polymers, polyoxyethylene polyoxypropylene copolymer, polymethylvinylether co-maleic anhydride, carboxymethylamide, potassium methacrylate divinylbenzene co-polymer, polyoxyethyleneglycols, polyethylene glycol, and derivatives, salts, and combinations thereof.
  • the polymer is a polyalkylene glycol, including, for example, polyethylene glycol (PEG).
  • the heterologous moiety is a carbohydrate.
  • the carbohydrate is a monosaccharide (e.g., glucose, galactose, fructose), a disaccharide (e.g., sucrose, lactose, maltose), an oligosaccharide (e.g., raffinose, stachyose), a polysaccharide (a starch, amylase, amylopectin, cellulose, chitin, callose, laminarin, xylan, mannan, fucoidan, galactomannan.
  • a monosaccharide e.g., glucose, galactose, fructose
  • a disaccharide e.g., sucrose, lactose, maltose
  • an oligosaccharide e.g
  • the heterologous moiety is a lipid.
  • the lipid in some embodiments, in some
  • fatty acid eicosanoid, prostaglandin, leukotriene, thromboxane, N-acyl ethanolamine
  • glycerolipid e.g., mono-, di-, tri- substituted glycerols
  • glycerophospholipid e.g., phosphatidylcholine, phosphatidylinositol, phosphatidylethanolamine
  • sphingolipid e.g., sphingosine, ceramide
  • sterol lipid e.g., steroid, cholesterol
  • prenol lipid saccharolipid, or a polyketide, oil, wax, cholesterol, sterol, fat-soluble vitamin, monoglyceride, diglyceride, triglyceride, a phospholipid.
  • the insulin polypeptides described herein can be modified into a depot form, such that the manner in which the conjugate of the present disclosure is released into the body to which it is administered is controlled with respect to time and location within the body (see, for example, U.S. Patent No. 4,450,150).
  • Depot forms of the conjugates of the present disclosures can be, for example, an implantable composition comprising the conjugate of the present disclosure and a porous or non-porous material, such as a polymer, wherein the conjugate of the present disclosures is encapsulated by or diffused throughout the material and/or degradation of the non-porous material.
  • the depot is then implanted into the desired location within the body and the conjugate of the present disclosures are released from the implant at a predetermined rate.
  • a large depot polymer can be linked to a self-cleaving dipeptide element that is covalently bound to the insulin polypeptide as described herein.
  • the depot polymer effectively sequesters the insulin polypeptide at its site of administration until it is subsequently cleaved from the single chain analog via a non-enzymatic reaction at a predetermined rate.
  • Depot formulations of insulin analogs using a self-cleaving dipeptide have been described in PCT/US2009/068713, the disclosure of which is incorporated herein.
  • an insulin polypeptide comprising a dipeptide prodrug element wherein the dipeptide prodrug element is linked to a large polymer such as PEG or dextran or is acylated with a C18-C25 hydrocarbon.
  • a self-cleaving dipeptide element comprising a large depot polymer (including for example, PEG) is linked to the side chain of an amino acid of the linking moiety of an insulin single chain analog, including for example, the amino acid at position C8 of the linking moiety.
  • compositions can be prepared that comprise the single chain analogs and are formulated to have a desired in vivo release profile.
  • the pharmaceutical composition is an immediate release, controlled release, sustained release, extended release, delayed release, or bi-phasic release formulation.
  • Methods of formulating peptides or conjugates for controlled release are known in the art. See, for example, J Pharm 374: 46-52 (2009) and International Patent Application Publication Nos. WO 2008/130158,
  • compositions may further comprise, for example, micelles or liposomes, or some other encapsulated form, or may be administered in an extended release form to provide a prolonged storage and/or delivery effect.
  • the disclosed pharmaceutical formulations may be administered according to any regime including, for example, daily (1 time per day, 2 times per day, 3 times per day, 4 times per day, 5 times per day, 6 times per day), every two days, every three days, every four days, every five days, every six days, weekly, bi-weekly, every three weeks, monthly, or bi-monthly.
  • the present disclosure also encompasses prodrug analogs of the insulin polypeptide peptides disclosed herein.
  • the prodrug formulations improve the therapeutic index of the underlying peptide and delay onset of action and enhance the half-life of the insulin polypeptide peptide.
  • the disclosed prodrug chemistry can be chemically conjugated to active site amines to form amides that revert to the parent amine upon diketopiperazine formation and release of the prodrug element (see International patent application
  • Physiological conditions as disclosed herein are intended to include a temperature of about 35 to 40 °C and a pH of about 7.0 to about 7.4 and more typically include a pH of 7.2 to 7.4 and a temperature of 36 to 38 °C in an aqueous environment.
  • the rate of cleavage, and thus activation of the prodrug depends on the structure and stereochemistry of the dipeptide pro-moiety and also on the strength of the nucleophile.
  • the prodrugs disclosed herein will ultimately be chemically converted to structures that can be recognized by the insulin/IGF receptor, wherein the speed of this chemical conversion will determine the time of onset and duration of in vivo biological action.
  • the prodrug chemistry disclosed in this application relies upon an intramolecular chemical reaction that is not dependent upon additional chemical additives, or enzymes.
  • the speed of conversion is controlled by the chemical nature of the dipeptide substituent and its cleavage under physiological conditions. Since physiological pH and temperature are tightly regulated within a highly defined range, the speed of conversion from prodrug to drug will exhibit high intra and interpatient reproducibility.
  • prodrugs wherein the insulin polypeptide peptides have extended half-lives of at least 1 hour, and more typically greater than 20 hours but less than 100 hours, and are converted to the active form at physiological conditions through a non-enzymatic reaction driven by inherent chemical instability.
  • the a non-enzymatic activation tl/2 time of the prodrug is between 1-100 hrs, and more typically between 12 and 72 hours, and in one embodiment the tl/2 is between 24-48 hrs as measured by incubating the prodrug in a phosphate buffer solution (e.g., PBS) at 37 °C and pH of 7.2.
  • the half-life of the prodrugs is about 1, 8, 12, 20, 24, 48 or 72 hours.
  • the half-life of the prodrugs is about 100 hours or greater including half-lives of up to about 168, 336, 504, 672 or 720 hours, and are converted to the active form at physiological conditions through a non-enzymatic reaction driven by inherent chemical instability.
  • activation of the prodrug occurs after cleavage of an amide bond linked dipeptide, and formation of a diketopiperazine or diketomorpholine, and the active insulin polypeptide peptide.
  • the dipeptide prodrug element is covalently bound to the insulin polypeptide peptide via an amide linkage, and the dipeptide further comprises a depot polymer linked to dipeptide.
  • two or more depot polymers are linked to a single dipeptide element.
  • the depot polymer is linked to the side chain of one of the amino acids comprising the dipeptide prodrug element.
  • the depot polymer is selected to be biocompatible and of sufficient size that the insulin polypeptide, modified by covalent attachment of the dipeptide, remains sequestered at an injection site and/or incapable of interacting with its corresponding receptor upon administration to a patient. Subsequent cleavage of the dipeptide releases the insulin polypeptide to interact with its intended target.
  • the depot bearing dipeptide element can be linked to the insulin polypeptide via an amide bond through any convenient amine group of the insulin polypeptide, including an N-terminal alpha amine or an amine bearing side chain of an internal natural or synthetic amino acid of the insulin polypeptide.
  • the depot bearing dipeptide element is linked to the N- terminal alpha amine or to the amino group of a 4-amino phenylalanine present at position A19 of the single chain analog.
  • the depot polymer is selected from biocompatible polymers known to those skilled in the art.
  • the depot polymers typically have a size selected from a range of about 20,000 to 120,000 Daltons. In one embodiment the depot polymer has a size selected from a range of about 40,000 to 100,000 or about 40,000 to 80,000 Daltons. In one embodiment the depot polymer has a size of about 40,000, 50,000, 60,000, 70,000 or 80,000 Daltons.
  • Suitable depot polymers include but are not limited to dextrans, polylactides, polyglycolides, caprolactone-based polymers, poly(caprolactone), polyanhydrides, polyamines, polyesteramides, polyorthoesters, polydioxanones, polyacetals, polyketals, polycarbonates, polyphosphoesters, polyesters, polybutylene terephthalate, polyorthocarbonates,
  • the depot polymer is selected from the group consisting of polyethylene glycol, dextran, polylactic acid, polyglycolic acid and a copolymer of lactic acid and glycolic acid, and in one specific embodiment the depot polymer is polyethylene glycol. In one embodiment the depot polymer is polyethylene glycol and the combined molecular weight of depot polymer(s) linked to the dipeptide element is about 40,000 to 80,000 Daltons.
  • dipeptides composed of natural or synthetic amino acids have been identified that facilitate intramolecular decomposition under physiological conditions to release the active insulin polypeptide.
  • the dipeptide can be linked (via an amide bond) to an amino group present on the insulin polypeptide, or an amino group introduced into the insulin polypeptide by modification of the peptide sequence.
  • the dipeptide structure is selected to resist cleavage by peptidases present in mammalian sera, including for example dipeptidyl peptidase IV (DPP-IV).
  • DPP-IV dipeptidyl peptidase IV
  • the rate of cleavage of the dipeptide prodrug element from the bioactive peptide is not substantially enhanced (e.g., greater than 2X) when the reaction is conducted using physiological conditions in the presence of serum proteases relative to conducting the reaction in the absence of the proteases.
  • the cleavage half-life of the dipeptide prodrug element from the insulin polypeptide is not more than two, three, four or five fold the cleavage half-life of the dipeptide prodrug element from the insulin polypeptide in a solution comprising a DPP-IV protease.
  • the solution comprising a DPP-IV protease is serum, more particularly mammalian serum, including human serum.
  • the dipeptide prodrug element comprises the structure U-B, wherein U is an amino acid or a hydroxyl acid and B is an N-alkylated amino acid.
  • the structure of U-B is selected, in one embodiment, wherein chemical cleavage of U-B from the insulin polypeptide is at least about 90% complete within about 1 to about 720 hours in PBS under physiological conditions. In one embodiment the chemical cleavage half-life (t ⁇ ) of U-B from the insulin polypeptide peptide is at least about 1 hour to about 1 week in PBS under physiological conditions.
  • U, B, or the amino acid of the insulin polypeptide to which U-B is linked is a non-coded amino acid.
  • U and/or B is an amino acid in the D stereoisomer configuration.
  • U is an amino acid in the D stereoisomer configuration and B is an amino acid in the L stereoisomer configuration.
  • U is an amino acid in the L stereoisomer configuration and B is an amino acid in the D stereoisomer configuration.
  • U is an amino acid in the D stereoisomer configuration and B is an amino acid in the D stereoisomer configuration.
  • B is an N-alkylated amino acid but is not proline.
  • the N-alkylated group of amino acid B is a C C ⁇ alkyl, and in one embodiment the N-alkylated group is CrC 6 alkyl.
  • U is an amino acid having a disubstitution at the alpha carbon.
  • one or more dipeptide elements are linked to insulin polypeptide through an amide bond formed through one or more amino groups selected from the N-terminal amino group of the B chain, or the side chain amino group of an amino acid present in the insulin polypeptide.
  • the insulin polypeptide comprises two dipeptide elements, wherein the dipeptide elements are optionally pegylated, alkylated, acylated or linked to a depot polymer.
  • the dipeptide extension is covalently linked to an insulin polypeptide through the side chain amine of a lysine residue that resides at or near the active site.
  • the dipeptide extension is attached through a synthetic amino acid or a modified amino acid, wherein the synthetic amino acid or modified amino acid exhibits a functional group suitable for covalent attachment of the dipeptide extension (e.g., the aromatic amine of an amino-phenylalanine).
  • a functional group suitable for covalent attachment of the dipeptide extension e.g., the aromatic amine of an amino-phenylalanine.
  • one or more dipeptide elements are linked to the insulin polypeptide at an amino group selected from the N-terminal amino group of the B chain, or the side chain amino group of an aromatic amine of a 4-amino-phenylalanine residue present at a position corresponding to position A 19, B16 or B25 of native insulin.
  • the dipeptide prodrug element is linked to the aromatic ring of an A19 4-aminophenylalanine of an insulin (p-NH 2 - F) A19 or IGF B16B17 insulin polypeptide peptide via an amide bond, wherein the C-terminal amino acid of the dipeptide comprises an N-alkylated amino acid and the N-terminal amino acid of the dipeptide is any amino acid.
  • the prodrug comprises a dipeptide element linked to the N-terminal alpha amine via an amide bond wherein one of the side chains of the dipeptide element is acylated.
  • an insulin polypeptide prodrug derivative comprising a B chain with a dipeptide prodrug element linked via an amide bond to the N-terminal alpha amine of the B chain, or the side chain amino group of an aromatic amine of a 4-amino-phenylalanine residue present at a position corresponding to A 19, B 16 or B25 of native insulin or present in the linking moiety, wherein one of the side chains of the dipeptide element is acylated with a C18 to C25 hydrocarbon group.
  • the insulin polypeptide prodrug derivative may comprise a native insulin A chain or a native IGF-1 A chain or any analogs thereof disclosed herein.
  • the dipeptide comprises an N-terminal C- alkylated amino acid followed by an N-alkylated amino acid.
  • R 2> R4 and R 8 are independently selected from the group consisting of H, C -Cu alkyl, C 2 -Ci 8 alkenyl, (Ci-Ci 8 alkyl)OH, (Ci-Ci 8 alkyl)SH, (C 2 -C 3 alkyl)SCH 3 , (C 1 -C4 alkyl)CONH 2 , (C1-C4 alkyl)COOH, (C1-C4 alkyl)NH 2 , (C1-C4 alkyl)NHC(NH 2 + )NH 2 , (C 0 -C 4 alkyl)(C 3 -C 6 cycloalkyl), (C 0 -C 4 alkyl)(C 2 -C 5 heterocyclic), (C 0 -C 4 alkyl)(C 6 -C 10 aryl)R 7 , (C C 4 alkyl)(C 3 -C9 heteroaryl), and Ci-C 12 alkyl(W)C 1
  • R is selected from the group consisting of Q-Qs alkyl, (C -Cn alkyl)OH, (C -Cn alkyl)NH 2> (Ci-Ci 8 alkyl)SH, (C 0 -C 4 alkyl)(C 3 -C 6 )cycloalkyl, (C 0 -C 4 alkyl)(C 2 -C 5 heterocyclic), (C 0 -C4 alkyl)(C 6 -C 10 aryl)R 7 , and (CrC 4 alkyl)(C 3 -C 9 heteroaryl) or R 4 and R 3 together with the atoms to which they are attached form a 4, 5 or 6 member heterocyclic ring;
  • R 5 is NHR 6 or OH
  • R 6 is H, Ci-Cg alkyl or R 6 and R 2 together with the atoms to which they are attached form a 4, 5 or 6 member heterocyclic ring;
  • R 7 is selected from the group consisting of H and OH.
  • the prodrug element is linked to the N-terminal alpha amine of the insulin polypeptide and R 4 and R together with the atoms to which they are attached form a 4, 5 or 6 member heterocyclic ring, then at least one of Ri and R 2 are other than H.
  • an insulin polypeptide comprises the structure: IB- LM-IA, wherein IB comprises the sequence J-R 23 R 22 -X 25 LCGX 29 X 3 oLVEALYLVCG ERGFF (SEQ ID NO: 65), LM is a linking moiety as disclosed herein and IA comprises the sequence GrVEQCCXgSICSLYQLXi 7 NX 19 CX 23 (SEQ ID NO: 49) wherein
  • Xg is selected from the group consisting of threonine and histidine;
  • X 17 is glutamic acid or glutamine
  • X 19 is an amino acid of the general structure:
  • X is selected from the group consisting of OH or NHR 10 , wherein R 10 is H or a dipeptide element comprising the general structure U-B, wherein U is an amino acid or a hydroxyl acid and B is an N-alkylated amino acid;
  • X 23 is asparagine or glycine
  • X 25 is selected from the group consisting of histidine and threonine
  • X 29 is selected from the group consisting of alanine, glycine and serine;
  • X 30 is selected from the group consisting of histidine, aspartic acid, glutamic acid, homocysteic acid and cysteic acid;
  • R 22 is selected from the group consisting of FVNQ (SEQ ID NO: 47), a tripeptide valine-asparagine-glutamine, a dipeptide asparagine-glutamine, glutamine, glutamic acid and an N-terminal alpha amine; and
  • R 23 is a bond or an amino sequence comprising 1 to 6 charged amino acids.
  • X 22 is selected from the group consisting of phenylalanine and desamino-phenylalanine;
  • X 25 is selected from the group consisting of histidine and threonine
  • X 29 is selected from the group consisting of alanine, glycine and serine;
  • X 30 is selected from the group consisting of histidine, aspartic acid, glutamic acid, homocysteic acid and cysteic acid;
  • Zi is a dipeptide selected from the group consisting of aspartate-lysine, lysine-proline, and proline-lysine;
  • Bi is selected from the group consisting of threonine, alanine or a threonine- arginine- arginine tripeptide.
  • an insulin polypeptide comprises the structure: IB-LM-IA, wherein IB comprises the sequence X 25 LCGX 29 X 30 LVEALYLVCG ERGFF (SEQ ID NO: 65), LM is a linking moiety as disclosed herein that covalently links IB to IA, and IA comprises the sequence GIVEQCCX 8 SICSLYQLENX 19 CX 2 i (SEQ ID NO: 55), wherein the C-terminal phenylalanine residue of SEQ ID NO: 65 is directly covalently bound to the linking moiety, LM, in the absence of any intervening amino acids.
  • an insulin polypeptide comprising the structure: IB- LM-IA, wherein IB comprises the sequence J-R 23 -R 22 -
  • LM is a linking moiety as disclosed herein and IA comprises the sequence Grv T X4ECCX 8 X 9 SCDLX 1 4Xi5LXi7Xi8Xi9CX2i-Ri3 (SEQ ID NO: 68) wherein
  • J is H or a dipeptide element comprising the general structure of U-B, wherein U is an amino acid or a hydroxyl acid and B is an N-alkylated amino acid linked through an amide bond;
  • X 4 is aspartic acid or glutamic acid
  • X 8 is histidine or phenylalanine
  • X9 and X 14 are independently selected from arginine, ornithine, lysine or alanine; X 15 is arginine, lysine, ornithine or leucine;
  • X 17 is glutamic acid or glutamine
  • Xig is methionine, asparagine or threonine
  • Xi9 is tyrosine
  • X 21 is alanine, glycine or asparagine
  • R 22 is selected from the group consisting of a covalent bond, AYRPSE (SEQ ID NO: 46), a glycine-proline-glutamic acid tripeptide, a proline- glutamic acid dipeptide and glutamic acid;
  • R23 is a bond or an amino sequence comprising 1 to 6 charged amino acids
  • X25 is selected from the group consisting of histidine and threonine
  • X29 is selected from the group consisting of alanine, glycine and serine;
  • X30 is selected from the group consisting of histidine, aspartic acid, glutamic acid, homocysteic acid and cysteic acid;
  • X33 is selected from the group consisting of aspartic acid and glutamic acid;
  • X 34 is selected from the group consisting of alanine and threonine
  • X 4 2 is selected from the group consisting of alanine, lysine ornithine and arginine;
  • X 4 5 is tyrosine
  • R 13 is COOH or CONH 2 .
  • the substituents of the dipeptide prodrug element, and its site of attachment to the insulin polypeptide can be selected to provide the desired half-life of a prodrug analog of insulin polypeptides disclosed herein.
  • a dipeptide prodrug element comprising the structure:
  • Ri and R 2 are independently C C ⁇ alkyl or aryl; or R and R 2 are linked through - (CH 2 ) P -, wherein p is 2-9;
  • R 3 is C1-C18 alkyl
  • R 4 and R 8 are each hydrogen
  • R5 is an amine
  • prodrugs linked at the N-terminus and having a t of, e.g., about 1 hour comprise a dipeptide prodrug element with the structure:
  • Ri and R 2 are independently C -Cu alkyl or (Co-C 4 alkylXCe-Cio aryl)R 7 ; or Ri and R 2 are linked through -(CH 2 ) P , wherein p is 2-9;
  • R 3 is C1-C18 alkyl
  • R 4 and Rg are each hydrogen
  • R 5 is NH 2 ;
  • R 7 is selected from the group consisting of hydrogen, Q-Cig alkyl, C 2 -Ci 8 alkenyl, (C 0 - C 4 alkyl)CONH 2> (C 0 -C 4 alkyl)COOH, (C 0 -C 4 alkyl)NH 2 , (C 0 -C 4 alkyl)OH, and halo; and R 8 is H..
  • an insulin polypeptide prodrug derivative wherein the dipeptide prodrug is linked to the alpha amino group of the N-terminal amino acid of the insulin polypeptide B chain, and the prodrug has a t between about 6 to about 24 hours in PBS under physiological conditions.
  • an insulin polypeptide prodrug derivative having a t 1/2 between about 6 to about 24 hours in PBS under physiological conditions is provided wherein the prodrug element has the structure of Formula X and Ri and R 2 are independently selected from the group consisting of hydrogen, Ci-Cig alkyl and aryl, or Ri and R 2 are linked through -(CH 2 ) P -, wherein p is 2-9;
  • R 3 is Ci-Ci 8 alkyl or R 3 and R 4 together with the atoms to which they are attached form a 4-12 heterocyclic ring;
  • R 4 and R 8 are independently selected from the group consisting of hydrogen, Ci-Cg alkyl and aryl;
  • R 5 is an amine, with the proviso that both Ri and R 2 are not hydrogen and provided that one of R 4 or Rg is hydrogen.
  • an insulin polypeptide prodrug derivative wherein the dipeptide prodrug is linked to the alpha amino group of the N-terminal amino acid of the insulin polypeptide B chain, and the prodrug has a ti /2 between about 72 to about 168 hours in PBS under physiological conditions.
  • an insulin polypeptide prodrug derivative having a t 1/2 between about 72 to about 168 hours in PBS under physiological conditions is provided wherein the prodrug element has the structure of Formula X and
  • Ri is selected from the group consisting of hydrogen, Ci-Cg alkyl and aryl;
  • R 2 is H
  • R 3 is Ci-Cig alkyl
  • R 4 and R 8 are each hydrogen
  • R 5 is an amine or N-substituted amine or a hydroxyl
  • Ri is alkyl or aryl
  • R 5 together with the atoms to which they are attached form a 4-11 heterocyclic ring.
  • prodrugs having the dipeptide prodrug element linked to the N- terminal alpha amino acid of the insulin polypeptide B chain peptide and having a ti /2 comprise a dipeptide prodrug element with the structure:
  • Ri and R 2 are independently selected from the group consisting of hydrogen, Ci-Cig alkyl, (Ci-Ci 8 alkyl)OH, (Ci-C 4 alkyl)NH 2 , and (C 0 -C 4 alkyl)(C 6 -Ci 0 aryl)R 7 , or Rj and R 2 are linked through (CH 2 ) P , wherein p is 2-9;
  • R 3 is Ci-Cig alkyl or R 3 and R 4 together with the atoms to which they are attached form a 4-12 heterocyclic ring;
  • R 4 and Rg are independently selected from the group consisting of hydrogen, Q-Cg alkyl and (C 0 -C 4 alkyl)(C 6 -C 10 aryl)R 7 ;
  • R 5 is NH 2 ;
  • R 7 is selected from the group consisting of H, C -Cn alkyl, C 2 -C 1 g alkenyl, (Co-C 4 alkyl)CONH 2, (C 0 -C 4 alkyl)COOH, (C 0 -C 4 alkyl)NH 2 , (C 0 -C 4 alkyl)OH, and halo;
  • both R and R 2 are not hydrogen and provided that at least one of R 4 or R 8 is hydrogen.
  • prodrugs having the dipeptide prodrug element linked to the N- terminal amino acid of the insulin polypeptide B chain peptide and having a t comprise a dipeptide prodrug element with the structure:
  • R and R 2 are independently selected from the group consisting of hydrogen, C Cg alkyl and (Ci-C 4 alkyl)NH 2 , or Ri and R 2 are linked through (CH 2 ) P , wherein p is 2-9;
  • R 3 is C Cg alkyl or R and R 4 together with the atoms to which they are attached form a 4-6 heterocyclic ring;
  • R 4 is selected from the group consisting of hydrogen and C Cg alkyl
  • R 5 is NH 2 ;
  • prodrugs having the dipeptide prodrug element linked to the N- terminal amino acid of the insulin polypeptide B chain peptide and having a ti /2 comprise a dipeptide prodrug element with the structure:
  • Ri and R 2 are independently selected from the group consisting of hydrogen, Ci-Cg alkyl and (C1-C4 alkyl)NH 2 ;
  • R 3 is Ci-C 6 alkyl
  • R 4 is hydrogen
  • R 5 is NH 2 ;
  • prodrugs having the dipeptide prodrug element linked to the N- terminal amino acid of the insulin polypeptide B chain peptide and having a ti /2 comprise a dipeptide prodrug element with the structure:
  • Ri and R 2 are independently selected from the group consisting of hydrogen and Ci-Cg alkyl, (Ci-C 4 alkyl)NH 2 , or Ri and R 2 are linked through (CH 2 ) P , wherein p is 2-9;
  • R 3 is Ci-Cg alkyl
  • R 4 is (Co-C 4 alkyl)(C 6 -Cio aryl)R 7 ;
  • R 5 is NH 2 ;
  • R 7 is selected from the group consisting of hydrogen, Ci-Cg alkyl and (C 0 -C 4 alkyl)OH; with the proviso that both Ri and R 2 are not hydrogen.
  • a prodrug having the dipeptide prodrug element linked to the N-terminal alpha amino acid of the insulin polypeptide and having a ti /2 , e.g., of about 72 to about 168 hours is provided wherein the dipeptide prodrug element has the structure:
  • Ri is selected from the group consisting of hydrogen, Ci-Cg alkyl and (CQ-C 4 alkyl)(C 6 -Cio aryl)R 7 ;
  • R 3 is C1-C18 alkyl
  • R 4 and R 8 are each hydrogen
  • R 5 is NHR 6 or OH
  • R 6 is H, Q-Cg alkyl, or R 6 and Ri together with the atoms to which they are attached form a 4, 5 or 6 member heterocyclic ring;
  • R 7 is selected from the group consisting of hydrogen, Ci-Cis alkyl, C 2 -Ci 8 alkenyl, (C 0 - C 4 alkyl)CONH 2 , (C 0 -C 4 alkyl)COOH, (C 0 -C 4 alkyl)NH 2 , (C 0 -C 4 alkyl)OH, and halo;
  • Ri is alkyl or (Co-C 4 alkyl)(C 6 -Cio aryl)R 7 , then Ri and R5 together with the atoms to which they are attached form a 4-11 heterocyclic ring.
  • the dipeptide prodrug element is linked to a side chain amine of an internal amino acid of the insulin polypeptide.
  • prodrugs having a ti /2 e.g., of about 1 hour have the structu
  • Ri and R 2 are independently Ci-Cg alkyl or (Co-C 4 alkyl)(C 6 -Cio aryl)R 7 ; or Ri and R 2 are linked through -(CH 2 ) P -, wherein p is 2-9;
  • R 3 is C1-C18 alkyl
  • R 4 and R 8 are each hydrogen
  • R 5 is NH 2 ;
  • R 7 is selected from the group consisting of hydrogen, C 1 -C18 alkyl, C 2 -Ci 8 alkenyl, (C 0 - C 4 alkyl)CONH 2, (C 0 -C 4 alkyl)COOH, (C 0 -C 4 alkyl)NH 2 , (C 0 -C 4 alkyl)OH, and halo.
  • prodrugs having a t 1/2 e.g., between about 6 to about 24 hours and having the dipeptide prodrug element linked to an internal amino acid side chain are provided wherein the prodrug comprises a dipeptide p structure:
  • Ri and R 2 are independently selected from the group consisting of hydrogen, Ci-Cs alkyl, and (C 0 -C 4 alkyl)(C 6 -Cio aryl)R 7 , or Ri and R 2 are linked through -(CH 2 ) P -, wherein p is
  • R 3 is C 1 -C 18 alkyl or R and R 4 together with the atoms to which they are attached form a 4-12 heterocyclic ring;
  • R 4 and Rg are independently hydrogen, C 1 -C 18 alkyl or (C 0 -C 4 alkyl)(C 6 -Cio aryl)R 7 ;
  • R 5 is NHR 6 ;
  • R 6 is H or Ci-Cg alkyl, or R 6 and R 2 together with the atoms to which they are attached form a 4, 5 or 6 member heterocyclic ring;
  • R 7 is selected from the group consisting of hydrogen, Q-Qg alkyl, C 2 -Ci 8 alkenyl, (C 0 - C 4 alkyl)CONH 2> (C 0 -C 4 alkyl)COOH, (C 0 -C 4 alkyl)NH 2 , (C 0 -C 4 alkyl)OH, and halo;
  • a prodrug having a ti /2 e.g., of about 72 to about 168 hours and having the dipeptide prodrug element linked to an internal amino acid side chain of the insulin polypeptide is provided wherein the dipeptide p compture:
  • Ri is selected from the group consisting of hydrogen, Ci-Cig alkyl and (Co-C 4 alkyl)(C 6 -Cio aryl)R 7 ;
  • R 3 is Ci-Cig alkyl
  • R 4 and R 8 are each hydrogen
  • R 5 is NHR 6 or OH
  • R 6 is H or Ci-Ce alkyl, or R 6 and Ri together with the atoms to which they are attached form a 4, 5 or 6 member heterocyclic ring;
  • R 7 is selected from the group consisting of hydrogen, Ci-Cig alkyl, C 2 -Cig alkenyl, (Co-C 4 alkyl)CONH 2> (C 0 -C 4 alkyl)COOH, (C 0 -C 4 alkyl)NH 2 , (C 0 -C 4 alkyl)OH, and halo; with the proviso that, if Ri and R 2 are both independently an alkyl or (C 0 -C 4 alkyl)(C 6 -Cio aryl)R 7 , either Ri or R 2 is linked through (CH 2 ) P to R 5 , wherein p is 2-9.
  • the dipeptide prodrug element is linked to the insulin polypeptide via an amine present on an aryl group of an aromatic amino acid of the insulin polypeptide, wherein the prodrug has a ti /2 , e.g., of about 1 hour has a dipeptide structure of:
  • Ri and R 2 are independently Ci-Cig alkyl or (C 0 -C 4 alkyl)(C 6 -Cio aryl)R 7 ;
  • R 3 is Ci-Cig alkyl or R 3 and R 4 together with the atoms to which they are attached form a 4-12 heterocyclic ring;
  • R 4 and Rg are independently selected from the group consisting of hydrogen, Ci-Cig alkyl and (C 0 -C 4 alkyl)(C 6 -C 10 aryl)R 7 ;
  • R 5 is NH 2 or OH
  • R 7 is selected from the group consisting of hydrogen, Ci-Cig alkyl, C 2 -Cig alkenyl, (C 0 - C 4 alkyl)CONH 2, (C 0 -C 4 alkyl)COOH, (C 0 -C 4 alkyl)NH 2 , (C 0 -C 4 alkyl)OH, and halo.
  • an insulin polypeptide prodrug derivative comprising the structure of Formula IV, wherein mi is an integer from 0 to 3 and having a tl/2 of about 6 to about 24 hours in PBS under physiological conditions.
  • the insulin polypeptide prodrug having a tl/2 of about 6 to about 24 hours in PBS under physiological conditions comprises the structure of formula IV wherein,
  • Ri is selected from the group consisting of hydrogen, Q-Cig alkyl and aryl, or Ri and R 2 are linked through -(CH 2 ) P -, wherein p is 2-9;
  • R 3 is Ci-Cig alkyl or R 3 and R 4 together with the atoms to which they are attached form a 4-6 heterocyclic ring;
  • R 4 and R 8 are independently selected from the group consisting of hydrogen, Ci-Cig alkyl and aryl;
  • R5 is an amine or N-substituted amine. In one embodiment mi is 1.
  • prodrugs having the dipeptide prodrug element linked via an aromatic amino acid and having a ti /2 , e.g., of about 6 to about 24 hours are provided wherein the dipeptide comprises a structure of:
  • Ri is selected from the group consisting of hydrogen, Ci-Cig alkyl, (Ci-Cig alkyl)OH, (C1-C4 alkyl)NH 2 , and (C 0 -C 4 alkyl)(C 6 -Ci 0 aryl)R 7 ;
  • R 3 is Ci-Cig alkyl or R and R 4 together with the atoms to which they are attached form a 4-6 heterocyclic ring;
  • R 4 and Rg are independently selected from the group consisting of hydrogen, Ci-Cig alkyl and (C 0 -C 4 alkyl)(C 6 -Ci 0 aryl)R 7 ;
  • R 5 is NHR 6 ;
  • R 6 is H, Q-Cg alkyl, or R 6 and Ri together with the atoms to which they are attached form a 4, 5 or 6 member heterocyclic ring;
  • R 7 is selected from the group consisting of hydrogen, Q-Cig alkyl, C 2 -Cig alkenyl, (C 0 - C 4 alkyl)CONH 2> (C 0 -C 4 alkyl)COOH, (C 0 -C 4 alkyl)NH 2 , (C 0 -C 4 alkyl)OH, and halo.
  • an insulin polypeptide prodrug derivative comprising the structure of Formula IV, wherein mi is an integer from 0 to 3 and having a tl/2 of about 72 to about 168 hours in PBS under physiological conditions.
  • the insulin polypeptide prodrug derivative having a tl/2 of about 72 to about 168 hours in PBS under physiological conditions comprises the structure of formula IV wherein,
  • Ri and R 2 are independently selected from the group consisting of hydrogen, Ci-Cg alkyl and aryl;
  • R 3 is C 1 -C18 alkyl or R 3 and R 4 together with the atoms to which they are attached form a 4-6 heterocyclic ring;
  • R 4 and Rg are each hydrogen
  • R5 is selected from the group consisting of amine, N-substituted amine and hydroxyl. In one embodiment mi is 1.
  • prodrugs having the dipeptide prodrug element linked via an aromatic amino acid and having a ti /2 , e.g., of about 72 to about 168 hours are provided wherein the dipeptide comprises a structure of:
  • Ri and R 2 are independently selected from the group consisting of hydrogen, Ci-C 8 alkyl, (C 1 -C4 alkyl)COOH, and (C 0 -C 4 alkyl)(C 6 -Ci 0 aryl)R 7> or Ri and R 5 together with the atoms to which they are attached form a 4-11 heterocyclic ring;
  • R 3 is Ci-Ci 8 alkyl or R 3 and R 4 together with the atoms to which they are attached form a 4-6 heterocyclic ring;
  • R 4 is hydrogen or forms a 4-6 heterocyclic ring with R ;
  • R 8 is hydrogen
  • R 5 is NHR 6 or OH
  • R 6 is H or Ci-Cg alkyl, or R 6 and Ri together with the atoms to which they are attached form a 4, 5 or 6 member heterocyclic ring;
  • R 7 is selected from the group consisting of hydrogen, C C ⁇ alkyl, C 2 -Ci 8 alkenyl, (C 0 - C 4 alkyl)CONH 2, (C 0 -C 4 alkyl)COOH, (C 0 -C 4 alkyl)NH 2 , (C 0 -C 4 alkyl)OH, and halo.
  • the dipeptide of Formula X is further modified to comprise a large polymer that interferes with the insulin polypeptide's ability to interact with the insulin or IGF- 1 receptor. Subsequent cleavage of the dipeptide releases the insulin polypeptide from the dipeptide complex wherein the released insulin polypeptide is fully active.
  • the dipeptide of Formula X is further modified to comprises a large polymer that interferes with the bound insulin polypeptide's ability to interact with the insulin or IGF-1 receptor.
  • the insulin polypeptide comprises a dipeptide of the general structure of Formula X:
  • amino acid side chains of the dipeptide of Formula X is pegylated or acylated.
  • an insulin polypeptide comprising the structure IB- LM-IA, wherein IB comprises sequence
  • LM comprises a linking moiety as described herein;
  • IA comprises the sequence GIVX 4 X 5 CCX8X9XioCX 1 2LX 14 X 1 5LEX 18 X 1 9CX 2 i -R13 (SEQ ID NO: 70), wherein
  • J is H or a dipeptide element of formula X
  • X 4 is glutamic acid or aspartic acid
  • X5 is glutamine or glutamic acid
  • X 8 is histidine, threonine or phenylalanine
  • X 9 is serine, arginine, lysine, ornithine or alanine
  • Xio is isoleucine or serine
  • X 12 is serine or aspartic acid
  • X 14 is tyrosine, arginine, lysine, ornithine or alanine;
  • X 15 is glutamine, glutamic acid, arginine, alanine, lysine, ornithine or leucine;
  • Xis is methionine, asparagine, glutamine, aspartic acid, glutamic acid or threonine;
  • X 19 is an amino acid of the general structure:
  • X is selected from the group consisting of OH or NHR 0 , wherein R 0 is
  • X 21 is selected from the group consisting of alanine, glycine, serine, valine, threonine, isoleucine, leucine, glutamine, glutamic acid, asparagine, aspartic acid, histidine, tryptophan, tyrosine, and methionine;
  • X 2 5 is histidine or threonine
  • X 29 is selected from the group consisting of alanine, glycine and serine;
  • X30 is selected from the group consisting of histidine, aspartic acid, glutamic acid, homocysteic acid and cysteic acid;
  • X33 is selected from the group consisting of aspartic acid, glutamine and glutamic acid;
  • X34 is selected from the group consisting of alanine and threonine;
  • X 41 is selected from the group consisting of glutamic acid, aspartic acid or asparagine;
  • X 42 is selected from the group consisting of alanine, lysine, ornithine and arginine;
  • X 4 5 is an amino acid of the general structure
  • X 13 is selected from the group consisting of H, OH and NHR 12 , wherein R 12 is H or dipeptide element comprising the general structure of Formula X;
  • R 22 is selected from the group consisting of AYRPSE (SEQ ID NO: 46), FVNQ (SEQ ID NO: 47), PGPE (SEQ ID NO: 48), a tripeptide glycine-proline- glutamic acid, a tripeptide valine-asparagine-glutamine, a dipeptide proline- glutamic acid, a dipeptide asparagine- glutamine, glutamine, glutamic acid and an N-terminal alpha amine;
  • R 23 is a bond or G(X 60 ) d (X 6 i) g K (SEQ ID NO: 71)
  • X 6 o, X 6 i are independently glutamic acid or aspartic acid; and d and g are integers independently ranging from 1-6; and
  • R 13 is COOH or CONH, further wherein the dipeptide of Formula X is acylated or pegylated.
  • J comprises an acylated or pegylated dipeptide of Formula X.
  • the insulin polypeptides and prodrug derivative thereof disclosed herein can be further modified to improve the peptide's solubility in aqueous solutions at physiological pH, while enhancing the effective duration of the peptide by preventing renal clearance of the peptide.
  • Peptides are easily cleared because of their relatively small molecular size when compared to plasma proteins. Increasing the molecular weight of a peptide above 40 kDa exceeds the renal threshold and significantly extends duration in the plasma.
  • the peptide prodrugs are further modified to comprise a covalently linked hydrophilic moiety.
  • the hydrophilic moiety is a plasma protein, polyethylene glycol chain or the Fc portion of an immunoglobin. Therefore, in one embodiment the presently disclosed insulin analogs are further modified to comprise one or more hydrophilic groups covalently linked to the side chains of amino acids.
  • the insulin prodrugs disclosed herein are further modified by linking a hydrophilic moiety to either the N-terminal amino acid of the B chain or to the side chain of a lysine amino acid (or other suitable amino acid) located at the carboxy terminus of the B chain, including for example, at position 29 of SEQ ID NO: 2.
  • a single-chain insulin prodrug derivative is provided wherein one of the amino acids of the linking moiety is modified by linking a hydrophilic moiety to the side chain of the peptide linker.
  • the modified amino acid is cysteine, lysine or acetyl phenylalanine.
  • a prodrug derivative of the insulin polypeptide wherein the dipeptide element of Formula X further comprises an polyethylene glycol, alkyl or acyl group.
  • one or more polyethylene glycol chains are linked to the dipeptide of Formula X wherein the combined molecular weight of the polyethylene glycol chains ranges from about 20,000 to about 80,000 Daltons, or 40,000 to 80,000 Daltons or 40,000 to 60,000 Daltons.
  • at least one polyethylene glycol chain having a molecular weight of about 40,000 Daltons is linked to the dipeptide of Formula X.
  • the dipeptide of Formula X is acylated with an acyl group of sufficient size to bind serum albumin and thus inactivate the IGF B16B17 analog peptide upon administration.
  • the acyl group can be linear or branched, and in one embodiment is a C 16 to C30 fatty acid.
  • the acyl group can be any of a C 16 fatty acid, CI 8 fatty acid, C20 fatty acid, C22 fatty acid, C24 fatty acid, C26 fatty acid, C28 fatty acid, or a C30 fatty acid.
  • the acyl group is a C16 to C20 fatty acid, e.g., a C18 fatty acid or a C20 fatty acid.
  • the insulin polypeptide peptides, and their prodrug analogs, disclosed herein are further modified by the addition of a modified amino acid to the carboxy or amino terminus of the A chain or the amino terminus of the B chain of the insulin polypeptide peptide, wherein the added amino acid is modified to comprise a hydrophilic moiety linked to the amino acid.
  • the amino acid added to the C-terminus is a modified cysteine, lysine or acetyl phenylalanine.
  • the hydrophilic moiety is selected from the group consisting of a plasma protein, polyethylene glycol chain and an Fc portion of an immunoglobin.
  • a pharmaceutical composition comprising any of the novel insulin dimers disclosed herein, preferably at a purity level of at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99%, and a pharmaceutically acceptable diluent, carrier or excipient.
  • compositions may contain an insulin dimer as disclosed herein at a concentration of at least 0.5 mg/ml, 1 mg/ml, 2 mg/ml, 3 mg/ml, 4 mg/ml, 5 mg/ml, 6 mg/ml, 7 mg/ml, 8 mg/ml, 9 mg/ml, 10 mg/ml, 11 mg/ml, 12 mg/ml, 13 mg/ml, 14 mg/ml, 15 mg/ml, 16 mg/ml, 17 mg/ml, 18 mg/ml, 19 mg/ml, 20 mg/ml, 21 mg/ml, 22 mg/ml, 23 mg/ml, 24 mg/ml, 25 mg/ml or higher.
  • an insulin dimer as disclosed herein at a concentration of at least 0.5 mg/ml, 1 mg/ml, 2 mg/ml, 3 mg/ml, 4 mg/ml, 5 mg/ml, 6 mg/ml, 7 mg/ml, 8 mg/ml, 9 mg/m
  • the pharmaceutical compositions comprise aqueous solutions that are sterilized and optionally stored contained within various package containers.
  • the pharmaceutical compositions comprise a lyophilized powder.
  • the pharmaceutical compositions can be further packaged as part of a kit that includes a disposable device for administering the composition to a patient.
  • the containers or kits may be labeled for storage at ambient room temperature or at refrigerated temperature.
  • the disclosed insulin dimers, and their corresponding prodrug derivatives are believed to be suitable for any use that has previously been described for insulin peptides. Accordingly, the insulin dimers disclosed herein, and their corresponding prodrug derivatives, can be used to treat hyperglycemia, or treat other metabolic diseases that result from high blood glucose levels. Accordingly, the present invention encompasses pharmaceutical compositions comprising an insulin dimers as disclosed herein, or a prodrug derivative thereof, and a pharmaceutically acceptable carrier for use in treating a patient suffering from high blood glucose levels.
  • the patient to be treated using an insulin dimer disclosed herein is a domesticated animal, and in another embodiment the patient to be treated is a human.
  • One method of treating hyperglycemia in accordance with the present disclosure comprises the steps of administering the presently disclosed insulin dimers, or depot or prodrug derivative thereof, to a patient using any standard route of administration, including
  • parenterally such as intravenously, intraperitoneally, subcutaneously or intramuscularly, intrathecally, transdermally, rectally, orally, nasally or by inhalation.
  • the composition is administered subcutaneously or intramuscularly.
  • the composition is administered parenterally and the insulin polypeptide, or prodrug derivative thereof, is prepackaged in a syringe.
  • the insulin dimers disclosed herein, and depot or prodrug derivative thereof may be administered alone or in combination with other anti-diabetic agents.
  • Anti-diabetic agents known in the art or under investigation include native insulin, native glucagon and functional analogs thereof, sulfonylureas, such as tolbutamide (Orinase), acetohexamide (Dymelor), tolazamide (Tolinase), chlorpropamide (Diabinese), glipizide (Glucotrol), glyburide (Diabeta, Micronase, Glynase), glimepiride (Amaryl), or gliclazide (Diamicron); meglitinides, such as repaglinide (Prandin) or nateglinide (Starlix); biguanides such as metformin (Glucophage) or phenformin; thiazolidinediones such as rosiglitazone (Avandia), piogli
  • compositions comprising the insulin dimers disclosed herein, or depot or prodrug derivatives thereof, can be formulated and administered to patients using standard pharmaceutically acceptable carriers and routes of administration known to those skilled in the art. Accordingly, the present disclosure also encompasses pharmaceutical compositions comprising one or more of the insulin dimers disclosed herein (or prodrug derivative thereof), or a pharmaceutically acceptable salt thereof, in combination with a pharmaceutically acceptable carrier.
  • the pharmaceutical composition comprises a lmg/ml concentration of the insulin dimer at a pH of about 4.0 to about 7.0 in a phosphate buffer system.
  • the pharmaceutical compositions may comprise the insulin dimer as the sole pharmaceutically active component, or the insulin dimer can be combined with one or more additional active agents.
  • insulin dimers, or prodrug derivatives thereof include all pharmaceutically acceptable salts thereof.
  • the kit is provided with a device for administering the insulin dimers composition to a patient.
  • the kit may further include a variety of containers, e.g. , vials, tubes, bottles, and the like.
  • the kits will also include instructions for use.
  • the device of the kit is an aerosol dispensing device, wherein the composition is prepackaged within the aerosol device.
  • the kit comprises a syringe and a needle, and in one embodiment the insulin dimer composition is prepackaged within the syringe.
  • the compounds of this invention may be prepared by standard synthetic methods, recombinant DNA techniques, or any other methods of preparing peptides and fusion proteins. Although certain non-natural amino acids cannot be expressed by standard recombinant DNA techniques, techniques for their preparation are known in the art. Compounds of this invention that encompass non-peptide portions may be synthesized by standard organic chemistry reactions, in addition to standard peptide chemistry reactions when applicable.
  • the first and second insulin polypeptides can be independently selected from any of the following pairings: A CHAIN 1 and B CHAIN 1, A CHAIN 1 and B CHAIN 2, A CHAIN 1 and B CHAIN 3, A CHAIN 1 and B CHAIN 4, A CHAIN 1 and B CHAIN 5, A CHAIN 1 and B CHAIN 6, A CHAIN 1 and B CHAIN 7, A CHAIN 1 and B CHAIN 8, A CHAIN 1 and B CHAIN 9, A CHAIN 1 and B CHAIN 10, A CHAIN 1 and B CHAIN 11, A CHAIN 1 and B CHAIN 12, A CHAIN 1 and B CHAIN 13, A CHAIN 1 and B CHAIN 14, A CHAIN 1 and B CHAIN 15, A CHAIN 1 and B CHAIN 16, A CHAIN 2 and B CHAIN 1, A CHAIN 2 and B CHAIN 2, A CHAIN 2 and B CHAIN 3, A CHAIN 2 and B CHAIN 4, A CHAIN 2 and B CHAIN 5, A CHAIN 2 and B CHAIN 6, A CHAIN 2 and B CHAIN 7, A CHAIN 2 and B CHAIN 8, A CHAIN 2 and B CHAIN 9, A CH
  • CHAIN 5 and B CHAIN 1 A CHAIN 5 and B CHAIN 2, A CHAIN 5 and B CHAIN 3, A
  • GYGSSSRX 68 APQT (SEQ ID NO: 9), A chains:
  • B chains B CHAIN 1. FVNQHLCGSHLVEALYLVCGERGFFYTPKT (SEQ ID NO: 2), B CHAIN 2. FVNQHLCGSHLVEALYLVCGERGFF (SEQ ID NO: 23),
  • Insulin A & B chains were synthesized on 4-methylbenzhyryl amine (MBHA) resin or 4-Hydroxymethyl-phenylacetamidomethyl (PAM) resin using Boc chemistry.
  • the peptides were cleaved from the resin using HF/p-cresol 95:5 for 1 hour at 0°C. Following HF removal and ether precipitation, peptides were dissolved into 50% aqueous acetic acid and lyophilized. Alternatively, peptides were synthesized using Fmoc chemistry.
  • the peptides were cleaved from the resin using Trifluoroacetic acid (TFA)/ Triisopropylsilane (TIS)/ H 2 0 (95:2.5:2.5), for 2 hour at room temperature.
  • TSA Trifluoroacetic acid
  • TIS Triisopropylsilane
  • H 2 0 95:2.5:2.5
  • the peptide was precipitated through the addition of an excessive amount of diethyl ether and the pellet solubilized in aqueous acidic buffer.
  • the quality of peptides were monitored by RP-HPLC and confirmed by Mass Spectrometry (ESI or MALDI).
  • Insulin A chains were synthesized with a single free cysteine at amino acid 7 and all other cysteines protected as acetamidomethyl A-(SH) 7 (Acm) 6 ' U ' 20 .
  • Insulin B chains were synthesized with a single free cysteine at position 7 and the other cysteine protected as acetamidomethyl B-(SH) 7 (Acm) 19.
  • the crude peptides were purified by conventional RP- HPLC.
  • the synthesized A and B chains were linked to one another through their native disulfide bond linkage in accordance with the general procedure outlined in Fig. 1.
  • the respective B chain was activated to the Cys -Npys analog through dissolution in DMF or DMSO and reacted with 2,2' -Dithiobis (5-nitropyridine) (Npys) at a 1: 1 molar ratio, at room temperature.
  • the activation was monitored by RP-HPLC and the product was confirmed by ESI-MS.
  • the first B7-A7 disulfide bond was formed by dissolution of the respective A- (SH) 7 (Acm) 6 ' U ' 20 and B-(Npys) 7 (Acm) 19 at 1: 1 molar ratio to a total peptide concentration of 10 mg/ml.
  • the chain combination reaction was complete the mixture was diluted to a concentration of 50% aqueous acetic acid.
  • the last two disulfide bonds were formed simultaneously through the addition of iodine.
  • a 40 fold molar excess of iodine was added to the solution and the mixture was stirred at room temperature for an additional hour.
  • the reaction was terminated by the addition of an aqueous ascorbic acid solution.
  • the mixture was purified by RP-HPLC and the final compound was confirmed by MALDI-MS. As shown in Fig. 2 and the data in Table 1, the synthetic insulin prepared in accordance with this procedure compares well with purified insulin for insulin receptor binding.
  • Insulin peptides comprising a modified amino acid can also be synthesized in vivo using a system that allows for incorporation of non-coded amino acids into proteins, including for example, the system taught in US Patent Nos. 7,045,337 and 7,083,970.
  • Insulin or an insulin analog
  • mPEG20k-Aldyhyde or an insulin analog
  • NaBH 3 CN in a molar ratio of 1:2:30, were dissolved in acetic acid buffer at a pH of 4.1-4.4.
  • the reaction solution was composed of 0.1 N NaCl, 0.2 N acetic acid and 0.1 N Na 2 C0 3 .
  • the insulin peptide or an insulin analog
  • the reaction mixture was diluted 2-5 fold with 0.1% TFA and applied to a preparative RP-HPLC column.
  • HPLC condition C4 column; flow rate 10 ml/min; A buffer 10% ACN and 0.1% TFA in water; B buffer 0.1% TFA in ACN; A linear gradient B% from 0-40% (0-80 min); PEG-insulin or analogues was eluted at approximately 35% buffer B.
  • the desired compounds were verified by MALDI-TOF, following chemical modification through sulftolysis or trypsin degradation.
  • Insulin or an insulin analog
  • mPEG20k-NHS were dissolved in 0.1 N Bicine buffer (pH 8.0) at a molar ratio of 1: 1.
  • the insulin peptide concentration was approximately 0.5 mg/ml. Reaction progress was monitored by HPLC. The yield of the reaction is approximately 90% after 2 hours at room temperature.
  • reaction mixture was diluted 2-5 fold and loaded to RP-HPLC.
  • HPLC condition C4 column; flow rate 10 ml/min; A buffer 10% ACN and 0.1% TFA in water; B buffer 0.1% TFA in ACN; A linear gradient B% from 0-40% (0-80 min); PEG-insulin or analogues was collected at approximately 35% B. .
  • the desired compounds were verified by MALDI-TOF, following chemical modification through sulftolysis or trypsin degradation.
  • Insulin (or an insulin analogue), mPEG20k-Hydrazide, and NaBH 3 CN in a molar ratio of 1:2:20 were dissolved in acetic acid buffer (pH of 4.1 to 4.4).
  • the reaction solution was composed of 0.1 N NaCl, 0.2 N acetic acid and 0.1 N Na 2 C0 3 .
  • Insulin or insulin analogue concentration was approximately 0.5 mg/ml. at room temperature for 24h.
  • the reaction process was monitored by HPLC. The conversion of the reaction was approximately 50%. (calculated by HPLC)
  • reaction mixture was diluted 2-5 fold and loaded to RP-HPLC.
  • HPLC condition C4 column; flow rate 10 ml/min; A buffer 10% ACN and 0.1% TFA in water; B buffer 0.1% TFA in ACN; A linear gradient B% from 0-40% (0-80 min); PEG-insulin, or the PEG-insulin analogue was collected at approximately 35%B.
  • the desired compounds were verified by MALDI-TOF, following chemical modification through sulftolysis or trypsin degradation.
  • each peptide for the insulin or IGF- 1 receptor was measured in a competition binding assay utilizing scintillation proximity technology.
  • Serial 3-fold dilutions of the peptides were made in Tris-Cl buffer (0.05 M Tris-HCl, pH 7.5, 0.15 M NaCl, 0.1% w/v bovine serum albumin) and mixed in 96 well plates (Corning Inc., Acton, MA) with 0.05 nM (3-[125I]-iodotyrosyl) A TyrA14 insulin or (3-[125I]-iodotyrosyl) IGF-1 (Amersham
  • % Specific Binding (Bound-NSB / Total bound- NSB) x 100. IC50 values were determined by using Origin software (OriginLab, Northampton, MA).
  • Insulin Receptor Phosphorylation Assay To measure receptor phosphorylation of insulin or insulin analog, receptor transfected HEK293 cells were plated in 96 well tissue culture plates (Costar #3596, Cambridge, MA) and cultured in Dulbecco's modified Eagle medium (DMEM) supplemented with 100 IU/ml penicillin, 100 g/ml streptomycin, 10 mM HEPES and 0.25% bovine growth serum (HyClone SH30541, Logan, UT) for 16-20 hrs at 37 °C, 5% C0 2 and 90% humidity.
  • DMEM Dulbecco's modified Eagle medium
  • HSRGTF-NH 2 A specific hexapeptide (HSRGTF-NH 2 ; SEQ ID NO: 72) was used as a model peptide upon which the rate of cleavage of dipeptide N-terminal extensions could be studied.
  • the dipeptide-extended model peptides were prepared Boc-protected sarcosine and lysine were successively added to the model peptide-bound resin to produce peptide A (Lys-Sar-HSRGTF- NH 2 ; SEQ ID NO: 74).
  • Peptide A was cleaved by HF and purified by preparative HPLC. Preparative purification using HPLC:
  • Peptide A was dissolved at a concentration of 1 mg/ml in PBS buffer. The solution was incubated at 37°C. Samples were collected for analysis at 5h, 8h, 24h, 31h, and 47h. The dipeptide cleavage was quenched by lowering the pH with an equal volume of 0.1%TFA. The rate of cleavage was qualitatively monitored by LC- MS and quantitatively studied by HPLC. The retention time and relative peak area for the prodrug and the parent model peptide were quantified using Peak Simple Chromatography software. Analysis using mass spectrometry
  • the mass spectra were obtained using a Sciex API- III electrospray quadrapole mass spectrometer with a standard ESI ion source. Ionization conditions that were used are as follows: ESI in the positive-ion mode; ion spray voltage, 3.9 kV; orifice potential, 60 V. The nebulizing and curtain gas used was nitrogen flow rate of 0.9 L/min. Mass spectra were recorded from 600-1800 Thompsons at 0.5 Th per step and 2 msec dwell time. The sample
  • HPLC analyses were performed using a Beckman System Gold Chromatography system equipped with a UV detector at 214 nm and a 150 mm x 4.6 mm C8 Vydac column. The flow rate was 1 ml/min. Solvent A contained 0.1% TFA in distilled water, and solvent B contained 0.1% TFA in 90% CH 3 CN. A linear gradient was employed (0% to 30%B in 10 minutes). The data were collected and analyzed using Peak Simple Chromatography software.
  • the rate of cleavage was determined for the respective propeptides.
  • the concentrations of the propeptides and the model parent peptide were determined by their respective peak areas.
  • the first order dissociation rate constants of the prodrugs were determined by plotting the logarithm of the concentration of the prodrug at various time intervals. The slope of this plot provides the rate constant 'k' .
  • the half-life of the Lys-Sar extension to this model peptide HSRGTF-NH 2 was determined to be 14.0h.
  • the rate of cleavage was determined for the respective propeptides.
  • the concentrations of the propeptides and the model parent peptide were determined by their respective peak areas.
  • the first order dissociation rate constants of the prodrugs were determined by plotting the logarithm of the concentration of the prodrug at various time intervals. The slope of this plot provides the rate constant 'k' .
  • the half-life of the Lys-Sar extension to this model peptide dHdTdRGdTdF-NH 2 (SEQ ID NO: 74) was determined to be 18.6h.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Epidemiology (AREA)
  • Organic Chemistry (AREA)
  • Diabetes (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Endocrinology (AREA)
  • Toxicology (AREA)
  • Genetics & Genomics (AREA)
  • Molecular Biology (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Zoology (AREA)
  • Hematology (AREA)
  • Obesity (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Emergency Medicine (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
PCT/US2013/061676 2012-09-26 2013-09-25 Insulin analog dimers Ceased WO2014052451A2 (en)

Priority Applications (7)

Application Number Priority Date Filing Date Title
CA2886228A CA2886228A1 (en) 2012-09-26 2013-09-25 Insulin analog dimers
JP2015534623A JP6387008B2 (ja) 2012-09-26 2013-09-25 インスリンアナローグダイマー
US14/431,040 US9593156B2 (en) 2012-09-26 2013-09-25 Insulin analog dimers
CN201380061231.7A CN104981251B (zh) 2012-09-26 2013-09-25 胰岛素类似物二聚体
EP18174352.7A EP3395358B1 (en) 2012-09-26 2013-09-25 Insulin analog dimers
EP13841334.9A EP2900255B1 (en) 2012-09-26 2013-09-25 Insulin analog dimers
AU2013323669A AU2013323669B2 (en) 2012-09-26 2013-09-25 Insulin analog dimers

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201261705834P 2012-09-26 2012-09-26
US61/705,834 2012-09-26

Publications (2)

Publication Number Publication Date
WO2014052451A2 true WO2014052451A2 (en) 2014-04-03
WO2014052451A3 WO2014052451A3 (en) 2014-06-19

Family

ID=50389126

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2013/061676 Ceased WO2014052451A2 (en) 2012-09-26 2013-09-25 Insulin analog dimers

Country Status (7)

Country Link
US (1) US9593156B2 (https=)
EP (2) EP3395358B1 (https=)
JP (1) JP6387008B2 (https=)
CN (2) CN108383902A (https=)
AU (1) AU2013323669B2 (https=)
CA (1) CA2886228A1 (https=)
WO (1) WO2014052451A2 (https=)

Cited By (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2016081670A2 (en) 2014-11-21 2016-05-26 Merck Sharp & Dohme Corp. Insulin receptor partial agonists
CN106459152A (zh) * 2015-04-28 2017-02-22 凯尔格恩有限公司 具有抗肥胖及抗糖尿病功效的肽及其的用途
WO2017189342A1 (en) 2016-04-26 2017-11-02 Merck Sharp & Dohme Corp. Insulin dimer-incretin conjugates
WO2017205309A1 (en) 2016-05-25 2017-11-30 Merck Sharp & Dohme Corp. Insulin receptor partial agonists
EP3530667A4 (en) * 2016-10-19 2019-11-27 Caregen Co., Ltd. PEPTIDE WITH ADRESSION TO OBESITY AND DIABETES AND USE THEREOF
US10919949B2 (en) 2017-08-17 2021-02-16 Novo Nordisk A/S Acylated insulin analogues and uses thereof
US10953076B2 (en) 2016-05-24 2021-03-23 Merck Sharp & Dohme Corp. Insulin receptor partial agonists and GLP-1 analogues

Families Citing this family (15)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
BR112012029611A2 (pt) 2010-05-21 2017-07-25 Merrimack Pharmaceuticals Inc proteína de fusão biespecífica, composição farmacêutica, método de tratamento de dano ao tecido em um indivíduo, método de promoção da regeração ou sobrevivência do tecido em um indivíduo e molécula de ácido nucleico
MX2015005662A (es) * 2012-11-05 2015-08-20 Univ Case Western Reserve Analogos de insulina de una sola cadena de larga accion.
AR105616A1 (es) 2015-05-07 2017-10-25 Lilly Co Eli Proteínas de fusión
CN115960249A (zh) 2015-10-02 2023-04-14 银溪制药股份有限公司 用于组织修复的双特异性治疗性蛋白质
WO2017210077A1 (en) * 2016-06-02 2017-12-07 Indiana University Research And Technology Corporation Single chain insulin prodrugs
US11643642B2 (en) * 2017-06-27 2023-05-09 Codexis, Inc. Penicillin-g acylases
CN114144426A (zh) * 2019-04-19 2022-03-04 印地安纳大学理事会 餐时或基础胰岛素类似物通过内部二硒桥的稳定化
US12435116B2 (en) 2019-10-16 2025-10-07 Clarence Hurt Compounds, compositions, methods, and uses for treating insulin resistance, type 2 diabetes and metabolic syndrome
CN113801236A (zh) * 2020-06-11 2021-12-17 宁波鲲鹏生物科技有限公司 一种赖脯胰岛素的制备方法
CN113801235A (zh) * 2020-06-11 2021-12-17 宁波鲲鹏生物科技有限公司 一种赖脯胰岛素衍生物及其应用
EP4210729A4 (en) * 2020-09-09 2025-01-01 Merck Sharp & Dohme LLC PARTIAL INSULIN RECEPTOR AGONISTS
KR20230090336A (ko) 2020-10-13 2023-06-21 베타바이브 리미티드 당뇨병 및 관련된 대사성 질환을 치료하기 위한 방법 및 화합물
US20220119549A1 (en) * 2020-10-15 2022-04-21 Tavotek Biotherapeutics (Hong Kong) Limited Shielded biologics with masking domains to shield antigen binding capability of biologics and uses thereof
US12447198B2 (en) 2021-10-12 2025-10-21 Betavive Ltd. Peptides and fragments for treating diabetes and associated metabolic diseases
WO2024137820A1 (en) * 2022-12-20 2024-06-27 The Board Of Trustees Of The Leland Stanford Junior University Insulin receptor antagonist

Citations (14)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4450150A (en) 1973-05-17 1984-05-22 Arthur D. Little, Inc. Biodegradable, implantable drug delivery depots, and method for preparing and using the same
EP0214826A2 (en) 1985-08-30 1987-03-18 Novo Nordisk A/S Insulin analogues and method of preparing the same
US5514646A (en) 1989-02-09 1996-05-07 Chance; Ronald E. Insulin analogs modified at position 29 of the B chain
WO1996034882A1 (en) 1995-05-05 1996-11-07 Eli Lilly And Company Single chain insulin with high bioactivity
WO1999040942A1 (en) 1998-02-10 1999-08-19 Yoshitomi Pharmaceutical Industries, Ltd. Preparations with controlled release
WO2000032218A1 (en) 1998-12-03 2000-06-08 Ferring Bv Controlled release formulation comprising gnrh-ii
DE19908041A1 (de) 1999-02-24 2000-08-31 Hoecker Hartwig Kovalent verbrückte Insulindimere
US6630348B1 (en) 2000-10-02 2003-10-07 Univ Yonsei Seoul Single-chain insulin analog and a polynucleotide sequence encoding the analog
WO2004033036A2 (en) 2002-10-04 2004-04-22 Microchips, Inc. Medical device for controlled drug delivery and cardiac monitoring and/or stimulation
US7045337B2 (en) 2001-04-19 2006-05-16 The Scripps Research Institute In vivo incorporation of unnatural amino acids
WO2008130158A1 (en) 2007-04-19 2008-10-30 Dong-A Pharmaceutical. Co., Ltd A biodegradable microsphere composition suitable for the controlled release of glucose controlling peptide and formulation thereof
WO2009068713A1 (es) 2007-11-27 2009-06-04 Mariano Segundo Jimenez Aposito utilizable como cobertura temporal para el tratamiento de heridas
WO2009099763A1 (en) 2008-01-30 2009-08-13 Indiana University Research And Technology Corporation Ester-based peptide prodrugs
WO2011159895A2 (en) 2010-06-16 2011-12-22 Indiana University Research And Technology Corporation Single chain insulin agonists exhibiting high activity at the insulin receptor

Family Cites Families (68)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US3740385A (en) 1970-05-07 1973-06-19 M Ondetti N-terminal derivatives of secretin
US4275152A (en) 1977-02-03 1981-06-23 Eastman Kodak Company Hydrolysis of protein-bound cholesterol esters
DK119785D0 (da) 1985-03-15 1985-03-15 Nordisk Gentofte Insulinpraeparat
PT83613B (en) 1985-10-28 1988-11-21 Lilly Co Eli Process for the selective chemical removal of a protein amino-terminal residue
US4741897A (en) 1986-07-08 1988-05-03 Baxter Travenol Thyroxine analogs and reagents for thyroid hormone assays
US4876242A (en) 1987-09-21 1989-10-24 Merck & Co., Inc. Human insulin-like growth factor analoges with reduced binding to serum carrier proteins and their production in yeast
GB8728561D0 (en) 1987-12-07 1988-01-13 Glaxo Group Ltd Chemical compounds
US6225449B1 (en) 1991-10-04 2001-05-01 Washington University Hormone analogs with multiple CTP extensions
AU631868B2 (en) 1989-04-20 1992-12-10 Mount Sinai School Of Medicine Of The City University Of New York, The Hepatospecific insulin analogues
US5268453A (en) 1991-08-08 1993-12-07 Scios Inc. Tissue-selective insulin analogs
CA2151134A1 (en) * 1992-12-18 1994-07-07 Ronald Eugene Chance Insulin analogs
WO1994020636A1 (en) 1993-03-09 1994-09-15 Abbott Laboratories Genetically engineered enzymes and their conjugates for diagnostic assays
US5359030A (en) 1993-05-10 1994-10-25 Protein Delivery, Inc. Conjugation-stabilized polypeptide compositions, therapeutic delivery and diagnostic formulations comprising same, and method of making and using the same
US6476290B1 (en) 1995-04-19 2002-11-05 Dalhousie University Transgenic tilapia comprising a humanized insulin gene
US6180767B1 (en) 1996-01-11 2001-01-30 Thomas Jefferson University Peptide nucleic acid conjugates
WO1998011126A1 (en) 1996-09-09 1998-03-19 Zealand Pharmaceuticals A/S Peptide prodrugs containing an alpha-hydroxyacid linker
UA65549C2 (uk) 1996-11-05 2004-04-15 Елі Ліллі Енд Компані Спосіб регулювання ожиріння шляхом периферійного введення аналогів та похідних glp-1 (варіанти) та фармацевтична композиція
US6197926B1 (en) 1998-02-23 2001-03-06 Neurocrine Biosciences Methods for treatment of diabetes using peptide analogues of insulin
JP4394279B2 (ja) 1998-03-09 2010-01-06 ジーランド ファーマ アクティーゼルスカブ 酵素加水分解に対する傾向が減少した薬理学的に活性なペプチド複合体
US6875741B2 (en) 1998-09-02 2005-04-05 Renuka Pillutla Insulin and IGF-1 receptor agonists and antagonists
US20030236190A1 (en) 1998-09-02 2003-12-25 Renuka Pillutla Isulin and IGF-1 receptor agonists and antagonists
PT1171465E (pt) 1999-03-29 2004-12-31 Uutech Ltd Analogos de petido inibidor gastrico e sua utilizacao para o tratamento de diabetes
US6746853B1 (en) 1999-05-19 2004-06-08 Xencor, Inc. Proteins with insulin-like activity useful in the treatment of diabetes
AUPQ661800A0 (en) 2000-03-31 2000-05-04 Metabolic Pharmaceuticals Limited Insulin-potentiating compounds
WO2002010195A2 (en) 2000-08-02 2002-02-07 Theratechnologies Inc. Modified peptides with increased potency
AU2001284697A1 (en) 2000-08-04 2002-02-18 Dmi Biosciences, Inc. Method of synthesizing diketopiperazines
US7052686B2 (en) 2000-09-29 2006-05-30 Schering Corporation Pegylated interleukin-10
KR101229995B1 (ko) 2000-12-11 2013-02-06 씨제이 주식회사 생체내 에리스로포이에틴 활성이 증진된 융합단백질
EP1243276A1 (en) 2001-03-23 2002-09-25 Franciscus Marinus Hendrikus De Groot Elongated and multiple spacers containing activatible prodrugs
PL374949A1 (en) 2001-12-20 2005-11-14 Eli Lilly And Company Insulin molecule having protracted time action
FR2842209B1 (fr) 2002-07-09 2007-11-23 Nouvelle protease aspartique dite saspase et son utilisation dans le domaine cosmetique et therapeutique
US20050059605A1 (en) 2003-01-31 2005-03-17 Krishna Peri Chemically modified metabolites of regulatory peptides and methods of producing and using same
WO2004078777A2 (en) 2003-03-04 2004-09-16 Biorexis Pharmaceutical Corporation Dipeptidyl-peptidase protected proteins
EP1605897B1 (en) 2003-03-19 2012-07-25 Eli Lilly And Company Polyethelene glycol link glp-1 compounds
CA2521784C (en) 2003-04-08 2012-03-27 Yeda Research And Development Co. Ltd. Reversible pegylated drugs
KR101241862B1 (ko) 2003-09-19 2013-03-13 노보 노르디스크 에이/에스 신규 glp-1 유도체
US20050187147A1 (en) 2003-09-22 2005-08-25 Newman Michael J. Compositions and methods for increasing drug efficiency
EP1997828B1 (en) 2003-11-05 2017-10-04 Dana-Farber Cancer Institute, Inc. Stabilized alpha helical peptides from BCL-2 and uses thereof
CN1902226A (zh) 2003-12-03 2007-01-24 诺和诺德公司 单链胰岛素
CA2582552A1 (en) 2004-10-21 2006-05-04 Igf Oncology, Llc Toxins and radionuclides coupled to igf-1 receptor ligands for treatment of cancer
EP1863840A1 (en) 2005-03-18 2007-12-12 Novo Nordisk A/S Pegylated single-chain insulin
US7521211B2 (en) 2005-04-05 2009-04-21 Regeneron Pharmaceuticals, Inc IGF-1 and IGF-2 chimeric polypeptides and therapeutic uses thereof
US20090209453A1 (en) 2005-04-13 2009-08-20 University Of Medicine And Dentistry Of New Jersey Glycoprotein Hormone Analogs
GB2427360A (en) * 2005-06-22 2006-12-27 Complex Biosystems Gmbh Aliphatic prodrug linker
US8304386B2 (en) 2006-02-03 2012-11-06 Prolor Biotech, Inc. Long-acting growth hormone and methods of producing same
US20090069216A1 (en) 2006-02-21 2009-03-12 Novo Nordisk A/S Single-Chain Insulin Analogues and Pharmaceutical Formulations Thereof
JP5312054B2 (ja) 2006-03-15 2013-10-09 ノボ・ノルデイスク・エー/エス アミリンとインスリンの混合物
JP5256199B2 (ja) 2006-08-07 2013-08-07 テヴァ バイオファーマシューティカルズ ユーエスエー,インコーポレーティッド アルブミン−インスリン融合タンパク質
AU2007284365A1 (en) 2006-08-17 2008-02-21 Amylin Pharmaceuticals, Inc. DPP-IV resistant GIP hybrid polypeptides with selectable properties
CL2007002502A1 (es) 2006-08-31 2008-05-30 Hoffmann La Roche Variantes del factor de crecimiento similar a insulina-1 humano (igf-1) pegilados en lisina; metodo de produccion; proteina de fusion que la comprende; y su uso para tratar la enfermedad de alzheimer.
CN106008699A (zh) 2006-09-08 2016-10-12 Ambrx公司 经修饰的人类血浆多肽或Fc骨架和其用途
US20090098130A1 (en) 2007-01-05 2009-04-16 Bradshaw Curt W Glucagon-like protein-1 receptor (glp-1r) agonist compounds
EP2036923A1 (en) 2007-09-11 2009-03-18 Novo Nordisk A/S Improved derivates of amylin
EP2036539A1 (en) 2007-09-11 2009-03-18 Novo Nordisk A/S Stable formulations of amylin and its analogues
CN101157725B (zh) * 2007-10-24 2012-07-25 中国药科大学 人胰岛素类似物的制备方法及用途
MX2010005317A (es) 2007-11-20 2010-06-02 Ambrx Inc Polipeptidos de insulina modificados y sus usos.
MX2010008024A (es) 2008-02-01 2010-12-21 Ascendis Pharma As Profarmaco que comprende un enlazador que se puede separar por si mismo.
WO2010011313A2 (en) 2008-07-23 2010-01-28 President And Fellows Of Harvard College Ligation of stapled polypeptides
CN102325539A (zh) 2008-12-19 2012-01-18 印第安纳大学研究及科技有限公司 基于酰胺的胰高血糖素超家族肽前药
WO2010080609A1 (en) * 2008-12-19 2010-07-15 Indiana University Research And Technology Corporation Amide-based insulin prodrugs
CN102300580A (zh) 2008-12-19 2011-12-28 印第安纳大学研究及科技有限公司 二肽连接的药剂
WO2010080606A1 (en) * 2008-12-19 2010-07-15 Indiana University Research And Technology Corporation Insulin analogs
US8569231B2 (en) 2009-03-20 2013-10-29 Smartcells, Inc. Soluble non-depot insulin conjugates and uses thereof
AU2010277559B2 (en) 2009-07-31 2016-08-11 Sanofi-Aventis Deutschland Gmbh Prodrugs comprising an insulin linker conjugate
CN101993485B (zh) 2009-08-20 2013-04-17 重庆富进生物医药有限公司 促胰岛素分泌肽类似物同源二聚体及其用途
RU2580317C2 (ru) 2010-06-24 2016-04-10 Индиана Юниверсити Рисерч Энд Текнолоджи Корпорейшн Пептидные пролекарства, принадлежащие к суперсемейству амид-содержащих глюкагонов
JP5912112B2 (ja) 2010-06-24 2016-04-27 インディアナ ユニバーシティー リサーチ アンド テクノロジー コーポレーションIndiana University Research And Technology Corporation アミド系インスリンプロドラッグ
WO2011163460A1 (en) 2010-06-24 2011-12-29 Indiana University Research And Technology Corporation Yl-based insulin-like growth factors exhibiting high activity at the insulin receptor

Patent Citations (15)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4450150A (en) 1973-05-17 1984-05-22 Arthur D. Little, Inc. Biodegradable, implantable drug delivery depots, and method for preparing and using the same
EP0214826A2 (en) 1985-08-30 1987-03-18 Novo Nordisk A/S Insulin analogues and method of preparing the same
US5514646A (en) 1989-02-09 1996-05-07 Chance; Ronald E. Insulin analogs modified at position 29 of the B chain
WO1996034882A1 (en) 1995-05-05 1996-11-07 Eli Lilly And Company Single chain insulin with high bioactivity
WO1999040942A1 (en) 1998-02-10 1999-08-19 Yoshitomi Pharmaceutical Industries, Ltd. Preparations with controlled release
WO2000032218A1 (en) 1998-12-03 2000-06-08 Ferring Bv Controlled release formulation comprising gnrh-ii
DE19908041A1 (de) 1999-02-24 2000-08-31 Hoecker Hartwig Kovalent verbrückte Insulindimere
US6630348B1 (en) 2000-10-02 2003-10-07 Univ Yonsei Seoul Single-chain insulin analog and a polynucleotide sequence encoding the analog
US7045337B2 (en) 2001-04-19 2006-05-16 The Scripps Research Institute In vivo incorporation of unnatural amino acids
US7083970B2 (en) 2001-04-19 2006-08-01 The Scripps Research Institute Methods and compositions for the production of orthogonal tRNA-aminoacyl tRNA synthetase pairs
WO2004033036A2 (en) 2002-10-04 2004-04-22 Microchips, Inc. Medical device for controlled drug delivery and cardiac monitoring and/or stimulation
WO2008130158A1 (en) 2007-04-19 2008-10-30 Dong-A Pharmaceutical. Co., Ltd A biodegradable microsphere composition suitable for the controlled release of glucose controlling peptide and formulation thereof
WO2009068713A1 (es) 2007-11-27 2009-06-04 Mariano Segundo Jimenez Aposito utilizable como cobertura temporal para el tratamiento de heridas
WO2009099763A1 (en) 2008-01-30 2009-08-13 Indiana University Research And Technology Corporation Ester-based peptide prodrugs
WO2011159895A2 (en) 2010-06-16 2011-12-22 Indiana University Research And Technology Corporation Single chain insulin agonists exhibiting high activity at the insulin receptor

Non-Patent Citations (23)

* Cited by examiner, † Cited by third party
Title
"Chemical Modifications of Proteins: History and Applications", BIOCONJUGATE CHEM., 1990, pages 1,2 - 12
ALTSCHUL ET AL., J. MOL. BIOL., vol. 215, 1993, pages 403 - 410
BRANGE ET AL., CURRENT OPINION IN STRUCTURAL BIOLOGY, vol. 1, 1991, pages 934 - 940
BREMS ET AL., PROTEIN ENGINEERING, vol. 5, 1992, pages 527 - 533
G. RAJPAL ET AL.: "Single-Chain Insulin as Receptor Agonists", MOLECULAR ENDOCRINOLOGY, vol. 23, no. 5, 1 May 2009 (2009-05-01), pages 679 - 688, XP055085086, DOI: doi:10.1210/me.2008-0349
G. T. HERMANSON: "Bioconjugate Techniques", 1996, ACADEMIC PRESS
H. S. SAWHNEY; C. P. PATHAK; J. A. HUBBELL, MACROMOLECULES, vol. 26, 1993, pages 581 - 587
HASHIMOTO ET AL.: "Synthesis of Palmitoyl Derivatives of Insulin and their Biological Activity", PHARMACUETICAL RES., vol. 6, no. 2, 1989, pages 171 - 176, XP002050607, DOI: doi:10.1023/A:1015992828666
HUA QING-XIN ET AL.: "Design of an active ultrastable single-chain insulin analog - Synthesis, structure, and therapeutic implications", JOURNAL OF BIOLOGICAL CHEMISTRY, AMERICAN SOCIETY FOR BIOCHEMISTRY AND MOLECULAR BIOLOGY, vol. 283, no. 21, 23 May 2008 (2008-05-23), pages 14703 - 14716, XP002557729, DOI: doi:10.1074/jbc.M800313200
HUANG YIDING ET AL.: "Science in China. Serie C: Life Science", vol. 44, 1 December 2001, GORDON AND BREACH, article "The relationship between the connecting peptide of recombined single chain insulin and its biological function", pages: 593 - 600
J PHARM, vol. 374, 2009, pages 46 - 52
JOHN P MAYER ET AL.: "Biopolymers", vol. 88, 1 January 2007, JOHN WILEY & SONS, INC, article "Insulin Structure and Function", pages: 687 - 713
KINSTLER ET AL., ADV. DRUG. DELIVERY REV., vol. 54, 2002, pages 477 - 485
MAYER ET AL.: "Insulin Structure and Function", BIOPOLYMERS, vol. 88, no. 5, 2007, pages 687 - 713, XP008152505, DOI: doi:10.1002/bip.20734
MILLER, BIOCHEM BIOPHYS RES COMMUN, vol. 218, 1996, pages 377 - 382
PREVIERO ET AL., BIOCHIM BIOPHYS ACTA, vol. 263, 1972, pages 7 - 13
RINDERKNECHT ET AL., J. BIOL. CHEM., vol. 253, 1978, pages 2769 - 2776
ROBERTS ET AL., ADV. DRUG DELIVERY REV., vol. 54, 2002, pages 459 - 476
SAN; SILVIUS, J PEPT RES, vol. 66, 2005, pages 169 - 180
SCHUETTLER ET AL.: "Hoppe-Seyler's Zeitschrift fur Physiologische Chemie", vol. 363, 1 March 1982, WALTER DE GRUYTER, article "Preparation of Properties of covalently linked Insulin dimers", pages: 317 - 330
See also references of EP2900255A4
SHIMOHIGASHI; STAMMER, INT J PEPT PROTEIN RES, vol. 19, 1982, pages 54 - 62
ZALIPSKY ET AL., ADV. DRUG DELIVERY REV., vol. 16, 1995, pages 157 - 182

Cited By (39)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP3666792A3 (en) * 2014-11-21 2020-07-29 Merck Sharp & Dohme Corp. Insulin receptor partial agonists
WO2016081670A3 (en) * 2014-11-21 2016-08-04 Merck Sharp & Dohme Corp. Insulin receptor partial agonists
CN112494656B (zh) * 2014-11-21 2024-01-30 默沙东有限责任公司 胰岛素受体部分激动剂
CN108064173B (zh) * 2014-11-21 2021-05-18 默沙东公司 胰岛素受体部分激动剂
CN112494656A (zh) * 2014-11-21 2021-03-16 默沙东公司 胰岛素受体部分激动剂
JP2018501203A (ja) * 2014-11-21 2018-01-18 メルク・シャープ・アンド・ドーム・コーポレーションMerck Sharp & Dohme Corp. インスリン受容体部分アゴニスト
CN108064173A (zh) * 2014-11-21 2018-05-22 默沙东公司 胰岛素受体部分激动剂
US10017556B2 (en) 2014-11-21 2018-07-10 Merck Sharp & Dohme Corp. Insulin receptor partial agonists
EA036714B1 (ru) * 2014-11-21 2020-12-10 Мерк Шарп И Доум Корп. Частичные агонисты инсулинового рецептора
US10183981B2 (en) 2014-11-21 2019-01-22 Merck Sharp & Dohme Corp. Insulin receptor partial agonists
US10800827B2 (en) 2014-11-21 2020-10-13 Merck Sharp & Dohme Corp. Insulin receptor partial agonists
KR20190069622A (ko) * 2014-11-21 2019-06-19 머크 샤프 앤드 돔 코포레이션 인슐린 수용체 부분 효능제
WO2016081670A2 (en) 2014-11-21 2016-05-26 Merck Sharp & Dohme Corp. Insulin receptor partial agonists
EP3660040A3 (en) * 2014-11-21 2020-07-29 Merck Sharp & Dohme Corp. Insulin receptor partial agonists
EP3660041A1 (en) 2014-11-21 2020-06-03 Merck Sharp & Dohme Corp. Insulin receptor partial agonists
EP3666792A2 (en) 2014-11-21 2020-06-17 Merck Sharp & Dohme Corp. Insulin receptor partial agonists
EP3660040A2 (en) 2014-11-21 2020-06-03 Merck Sharp & Dohme Corp. Insulin receptor partial agonists
JP2020097572A (ja) * 2014-11-21 2020-06-25 メルク・シャープ・アンド・ドーム・コーポレーションMerck Sharp & Dohme Corp. インスリン受容体部分アゴニスト
US10738081B2 (en) 2015-04-28 2020-08-11 Caregen Co., Ltd. Peptide with anti-obesity and anti-diabetes activity and use thereof
US10626145B2 (en) 2015-04-28 2020-04-21 Caregen Co., Ltd. Peptide with anti-obesity and anti-diabetes activity and use thereof
EP3613759A1 (en) * 2015-04-28 2020-02-26 Caregen Co., Ltd. Peptide having anti-diabetic and anti-obesity effects, and use thereof
CN106459152A (zh) * 2015-04-28 2017-02-22 凯尔格恩有限公司 具有抗肥胖及抗糖尿病功效的肽及其的用途
US11186611B2 (en) 2015-04-28 2021-11-30 Caregen Co., Ltd. Peptide with anti-obesity and anti-diabetes activity and use thereof
US10351597B2 (en) 2015-04-28 2019-07-16 Caregen Co., Ltd. Peptide with anti-obesity and anti-diabetes activity and use thereof
AU2019203655B2 (en) * 2015-04-28 2020-07-02 Caregen Co., Ltd. Peptide with anti-obesity and anti-diabetes activity and use thereof
JP2020007372A (ja) * 2015-04-28 2020-01-16 ケアジェン カンパニー, リミテッドCaregen Co., Ltd. 抗肥満及び抗糖尿作用を有するペプチド及びその用途
CN106459152B (zh) * 2015-04-28 2019-06-28 凯尔格恩有限公司 具有抗肥胖及抗糖尿病功效的肽及其的用途
EP3290434A4 (en) * 2015-04-28 2018-08-15 Caregen Co., Ltd. Peptide having anti-diabetic and anti-obesity effects, and use thereof
WO2017189342A1 (en) 2016-04-26 2017-11-02 Merck Sharp & Dohme Corp. Insulin dimer-incretin conjugates
US20190192675A1 (en) * 2016-04-26 2019-06-27 Merck Sharp & Dohme Corp. Insulin dimer-incretin conjugates
US11058775B2 (en) 2016-04-26 2021-07-13 Merck Sharp & Dohme Corp. Insulin dimer-incretin conjugates
US10953076B2 (en) 2016-05-24 2021-03-23 Merck Sharp & Dohme Corp. Insulin receptor partial agonists and GLP-1 analogues
EP3922260A2 (en) 2016-05-24 2021-12-15 Merck Sharp & Dohme Corp. Insulin receptor partial agonists and glp-1 analogues
US20190177393A1 (en) * 2016-05-25 2019-06-13 Merck Sharp & Dohme Corp. Insulin receptor partial agonists
WO2017205309A1 (en) 2016-05-25 2017-11-30 Merck Sharp & Dohme Corp. Insulin receptor partial agonists
US10689430B2 (en) 2016-05-25 2020-06-23 Merck Sharp & Dohme Corp. Insulin receptor partial agonists
US10723777B2 (en) 2016-10-19 2020-07-28 Caregen Co., Ltd. Peptide having anti-obesity and anti-diabetes efficacy and use thereof
EP3530667A4 (en) * 2016-10-19 2019-11-27 Caregen Co., Ltd. PEPTIDE WITH ADRESSION TO OBESITY AND DIABETES AND USE THEREOF
US10919949B2 (en) 2017-08-17 2021-02-16 Novo Nordisk A/S Acylated insulin analogues and uses thereof

Also Published As

Publication number Publication date
EP3395358B1 (en) 2019-11-06
EP2900255A4 (en) 2016-06-22
EP2900255B1 (en) 2019-01-30
JP2015532283A (ja) 2015-11-09
JP6387008B2 (ja) 2018-09-05
CN104981251A (zh) 2015-10-14
EP2900255A2 (en) 2015-08-05
CN108383902A (zh) 2018-08-10
AU2013323669A1 (en) 2015-03-26
CN104981251B (zh) 2018-03-20
CA2886228A1 (en) 2014-04-03
WO2014052451A3 (en) 2014-06-19
EP3395358A1 (en) 2018-10-31
US20150274802A1 (en) 2015-10-01
AU2013323669B2 (en) 2018-03-01
US9593156B2 (en) 2017-03-14

Similar Documents

Publication Publication Date Title
US9593156B2 (en) Insulin analog dimers
US10233225B2 (en) Single chain insulin agonists exhibiting high activity at the insulin receptor
JP6392123B2 (ja) 糖尿病治療のためのctp系インスリンアナローグ
US10696726B2 (en) Insulin-incretin conjugates
EP3206710B1 (en) Incretin-insulin conjugates
WO2011159882A2 (en) Novel stabilized insulin agonists

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 13841334

Country of ref document: EP

Kind code of ref document: A2

ENP Entry into the national phase

Ref document number: 2886228

Country of ref document: CA

Ref document number: 2015534623

Country of ref document: JP

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 14431040

Country of ref document: US

ENP Entry into the national phase

Ref document number: 2013323669

Country of ref document: AU

Date of ref document: 20130925

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 2013841334

Country of ref document: EP

121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 13841334

Country of ref document: EP

Kind code of ref document: A2