WO2014022423A2 - Hla g-modified cells and methods - Google Patents

Hla g-modified cells and methods Download PDF

Info

Publication number
WO2014022423A2
WO2014022423A2 PCT/US2013/052767 US2013052767W WO2014022423A2 WO 2014022423 A2 WO2014022423 A2 WO 2014022423A2 US 2013052767 W US2013052767 W US 2013052767W WO 2014022423 A2 WO2014022423 A2 WO 2014022423A2
Authority
WO
WIPO (PCT)
Prior art keywords
hla
cell
genetically modified
cells
nucleic acid
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2013/052767
Other languages
English (en)
French (fr)
Other versions
WO2014022423A9 (en
WO2014022423A3 (en
Inventor
Basil M. Hantash
Longmei Zhao
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Individual
Original Assignee
Individual
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to CA2882028A priority Critical patent/CA2882028C/en
Priority to ES13825511T priority patent/ES2716577T3/es
Priority to KR1020187034048A priority patent/KR102055438B1/ko
Priority to KR1020157005165A priority patent/KR101923632B1/ko
Priority to AU2013296564A priority patent/AU2013296564C1/en
Priority to EP13825511.2A priority patent/EP2880054B1/en
Priority to SG11201500799YA priority patent/SG11201500799YA/en
Priority to EP21209423.9A priority patent/EP4015530A1/en
Priority to KR1020197036122A priority patent/KR102184947B1/ko
Priority to EP20196775.9A priority patent/EP3805261A1/en
Priority to JP2015525519A priority patent/JP6297559B2/ja
Priority to CN201380051169.3A priority patent/CN105612176B/zh
Priority to EP18211100.5A priority patent/EP3483178B1/en
Priority to KR1020207033804A priority patent/KR102366081B1/ko
Application filed by Individual filed Critical Individual
Publication of WO2014022423A2 publication Critical patent/WO2014022423A2/en
Publication of WO2014022423A3 publication Critical patent/WO2014022423A3/en
Priority to US14/608,004 priority patent/US9714280B2/en
Anticipated expiration legal-status Critical
Publication of WO2014022423A9 publication Critical patent/WO2014022423A9/en
Priority to US15/625,964 priority patent/US10502738B2/en
Priority to AU2018220087A priority patent/AU2018220087B2/en
Priority to US16/659,918 priority patent/US11977073B2/en
Priority to US16/832,321 priority patent/US20200309776A1/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/85Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/569Immunoassay; Biospecific binding assay; Materials therefor for microorganisms, e.g. protozoa, bacteria, viruses
    • G01N33/56966Animal cells
    • G01N33/56977HLA or MHC typing
    • AHUMAN NECESSITIES
    • A01AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01KANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K67/00Rearing or breeding animals, not otherwise provided for; New or modified breeds of animals
    • A01K67/027New or modified breeds of vertebrates
    • A01K67/0271Chimeric vertebrates, e.g. comprising exogenous cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K35/00Medicinal preparations containing materials or reaction products thereof with undetermined constitution
    • A61K35/12Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K35/00Medicinal preparations containing materials or reaction products thereof with undetermined constitution
    • A61K35/12Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
    • A61K35/28Bone marrow; Haematopoietic stem cells; Mesenchymal stem cells of any origin, e.g. adipose-derived stem cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K35/00Medicinal preparations containing materials or reaction products thereof with undetermined constitution
    • A61K35/12Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
    • A61K35/33Fibroblasts
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K35/00Medicinal preparations containing materials or reaction products thereof with undetermined constitution
    • A61K35/12Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
    • A61K35/37Digestive system
    • A61K35/407Liver; Hepatocytes
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K35/00Medicinal preparations containing materials or reaction products thereof with undetermined constitution
    • A61K35/12Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
    • A61K35/44Vessels; Vascular smooth muscle cells; Endothelial cells; Endothelial progenitor cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00Drugs for dermatological disorders
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/08Drugs for disorders of the metabolism for glucose homeostasis
    • A61P3/10Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • A61P37/06Immunosuppressants, e.g. drugs for graft rejection
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • C07K14/70539MHC-molecules, e.g. HLA-molecules
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/06Animal cells or tissues; Human cells or tissues
    • C12N5/0602Vertebrate cells
    • C12N5/0603Embryonic cells ; Embryoid bodies
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/566Immunoassay; Biospecific binding assay; Materials therefor using specific carrier or receptor proteins as ligand binding reagents where possible specific carrier or receptor proteins are classified with their target compounds
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/68Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
    • G01N33/6893Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids related to diseases not provided for elsewhere
    • AHUMAN NECESSITIES
    • A01AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01KANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K2207/00Modified animals
    • A01K2207/12Animals modified by administration of exogenous cells
    • AHUMAN NECESSITIES
    • A01AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01KANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K2227/00Animals characterised by species
    • A01K2227/10Mammal
    • A01K2227/105Murine
    • AHUMAN NECESSITIES
    • A01AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01KANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K2267/00Animals characterised by purpose
    • A01K2267/02Animal zootechnically ameliorated
    • A01K2267/025Animal producing cells or organs for transplantation
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2510/00Genetically modified cells
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2333/00Assays involving biological materials from specific organisms or of a specific nature
    • G01N2333/435Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
    • G01N2333/705Assays involving receptors, cell surface antigens or cell surface determinants
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2333/00Assays involving biological materials from specific organisms or of a specific nature
    • G01N2333/435Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
    • G01N2333/705Assays involving receptors, cell surface antigens or cell surface determinants
    • G01N2333/71Assays involving receptors, cell surface antigens or cell surface determinants for growth factors; for growth regulators
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2800/00Detection or diagnosis of diseases
    • G01N2800/24Immunology or allergic disorders
    • G01N2800/245Transplantation related diseases, e.g. graft versus host disease

Definitions

  • compositions and methods for cell transplantation therapy based on the long-term forced expression of at least an exogenous HLA-G protein in donor cells to be transplanted into a subject in need of such donor cells.
  • the invention provides data that shows that cells (whether pluripotent or differentiated) modified to express exogenous HLA- G in the manner described herein have reduced immunogenicity and/or increased immunosuppression.
  • the reduced immunogenicity and/or increased suppression abilities provided by the HLA-G genetic modification are stable and persist over long periods of time, including through processes of differentiation.
  • HLA-G modified cells of the invention can serve as universal donor cells or tissue (i.e., reducing or eliminating the requirement for matching the type of classical human leukocyte antigen (HLA) class I and class II molecules between donor cells and the recipient) for numerous injuries, diseases, or disorders.
  • HLA human leukocyte antigen
  • the genetically modified mammalian cell comprises: (a) an exogenous nucleic acid (e.g., an expression vector) comprising a nucleic acid sequence encoding an HLA-G protein having an amino acid sequence at least 85% identical to human HLA-G, and comprising one or more amino acid mutations that reduce retention of HLA-G in the endoplasmic reticulum-golgi recycling pathway, and/or (b) a 3' UTR (untranslated region) sequence that does not contain microRNA binding sites such as SEQ ID NO:3 or a sequence that does not comprise SEQ ID Oi4; and (ii) the encoded HLA-G protein is expressed by the genetically modified mamm
  • the invention provides a genetically modified mammalian cell that has reduced immunogenicity and/or improved immunosuppression as compared to the mammalian cell without said genetic modification, wherein: (i) the genetically modified mammalian cell comprises an exogenous nucleic acid comprising: (a) a nucleic acid sequence (such as SEQ ID NO:2) encoding an HLA-G protein having an amino acid sequence at least 95% identical to consensus wild-type human HLA-G (such as SEQ ID NO: 1), and comprising one or more amino acid mutations that reduce retention of HLA-G in the endoplasmic reticulum-golgi recycling pathway; and (b) a 3' untranslated region (UTR) (such as SEQ ID NO:3) that is at least 85% identical to the 3' untranslated region sequence of the consensus wild-type human HLA-G gene and does not comprise SEQ ID NO:4; and (if) the encoded HLA-G protein is expressed by the genetically
  • a nucleic acid sequence such
  • a genetically modified ceil has reduced immunogenicity and/or improved immunosuppression if it shows: (1 ) a reduction of NK-92 cytotoxicity of the genetically modified cell as compared to the mammalian cell without said genetic modification, (2) a reduction of in vitro peripherai blood mononuclear cell proliferation of the genetically modified cell as compared to the mammalian cell without said genetic modification, and/or (3) an increase in the size and weight of tumor formation by the genetically modified cell as compared to the mammalian cell without said genetic modification in humanized NSG mice.
  • the genetically modified mammalian cell does not have matches (i.e., same allele(s)) in one or more HLA antigens as compared to the allogeneic recipient, wherein the HLA antigens are selected from the group consisting of HLA- A, HLA- B, HLA-C, HLA-DP, HLA-DQ, and HLA-DR.
  • the genetically modified mammalian cell only has I, 2, 3, 4, or 5 matches in one or more HLA antigens as compared to the allogeneic recipient, wherein the HLA antigens are selected from the group consisting of HLA-A, HLA-B, HLA-C, HLA-DP, HLA-DQ, and HLA-DR.
  • the genetically modified mammalian cell has no matches in with the allogeneic recipient with respect to HLA-A, HLA-B, HLA-C, HLA-DP, HLA-DQ, and HLA-DR.
  • the genetically modified cell comprises an HLA-G transgene without one or more amino acid mutations that reduce retention of HLA-G in the endoplasmic reticulum-golgi recycling pathway (i.e., an HLA-G wild-type consensus sequence such as SEQ ID NO: 1 ), but has an HLA-G transgene that comprises a 3' L!TR (untranslated region) sequence that does not contain microRNA binding sites such as SEQ ID NO:3, or a sequence that does not comprise SEQ ID NO:4.
  • the one or more mutations that reduce retention of HLA-G in the endoplasmic reticulum-golgi recycling pathway include a di-Lysine (KK) motif mutation.
  • the KK motif mutation incudes a K334A mutation, a K335A mutation, or both mutations.
  • the exogenous nucleic acid to be expressed in the genetically modified cell includes a 3' UTR sequence that does not contain SEQ ID NO.4. In one embodiment, where the 3' UTR sequence of the exogenous nucleic acid does not include SEQ ID NO:4, the nucleic acid sequence contains SEQ ID NO:3.
  • the expressed HLA-G is present on the cell surface of the genetically modified mammalian cell.
  • the genetically modified mammalian cell is a human cell, a mouse cell, a rat cell, a monkey cell, or a pig cell.
  • the genetically modified mammalian ceil is a stem cell, a progemtor cell, or a cell obtained by directed differentiation of the stem cell or the progenitor cell.
  • the genetically modified mammalian cell is a cell that was already differentiated (whether naturally or in vitro) prior to introduction of an exogenous HLA-G transgene.
  • the genetically modified mammalian cell is a stem cell (e.g., a pluripotent stem ceil).
  • the stem cell is an embryonic stem cell, an induced pluripotent stem cell, or a totipotent stem cell.
  • the genetically modified mammalian cell is an embryonic stem ceil. In another embodiment, the genetically modified mammalian cell is an induced pluripotent stem cell. In a further embodiment, the genetically modified mammalian cell is not of an immune system cell type. In another embodiment, the genetically modified mammalian cell is a cell obtained by in vitro differentiation of a stem cell or a progenitor cell wherein the stem cell or progenitor ceil is genetically modified and then differentiated in vitro.
  • the genetically modified cell is a fully differentiated cell, an epidermal progenitor cell, a pancreatic progenitor ceil, a hematopoietic stem cell, a cell obtained by differentiation of the pluripotent stem cell, a keratinocyte, a fibroblast, a mesenchymal stem cell, a carciiomyocyte, a neural stem ceil, a neuron, an astrocyte, or a pancreatic ⁇ celi progenitor.
  • the expression vector is a transposon vector or a retroviral vector.
  • the expression vector is a targeting vector, and the genetically modified mammalian cell was obtained by homologous recombination of the targeting vector.
  • the expression vector may further include a nucleic acid sequence encoding a reporter protein such as green fluorescent protein (GFP).
  • a reporter protein such as green fluorescent protein (GFP).
  • the exogenous nucleic acid also includes a nucleic acid sequence that (i) is at least 85% identical to the 3' untranslated region sequence of the hitman, HLA-G gene; and (ii) comprises at least one mutation that inhibits binding of a cognate microRNA to the mutated site within an mRNA comprising the mutated binding site within its 3' untranslated region.
  • a nucleic acid sequence comprises SEQ ID NO:3.
  • an artificial tissue is provided that contains the genetically modified cell.
  • an isolated nucleic acid that includes (i) a first nucleic acid sequence that encodes an amino acid sequence at least 85% identical to human, HLA-G; and (ii) a second nucleic acid sequence that is at least 85% identical the 3' untranslated region sequence of the human HLA-G gene and operably linked to the first nucleic acid sequence, where the amino acid sequence comprises a mutation that reduces retention of HLA-G in the endoplasmic reticulum-golgi recycling pathway, and the second nucleic acid sequence comprises at least one mutation that inhibits binding of a cognate microRNA to an mRNA comprising the mutated binding site within its 3 ' untranslated region.
  • the isolated nucleic acid the 3' untranslated region sequence does not comprise SEQ ID NO:4. In one embodiment, where the 3' untranslated region sequence does not comprise SEQ ID NO:4, the 3' untranslated region sequence comprises SEQ ID NO: 3
  • a mammalian expression vector that includes the isolated nucleic acid and a promoter operably linked to the first nucleic acid sequence, wherein the promoter is not silenced in a stem ceil.
  • the promoter contains the nucleic acid sequence of the Chinese hamster EF-la (CHEF- l a) promoter or human EF-la promoter.
  • the CHEF- la promoter comprises SEQ ID NO:7.
  • the promoter used to drive expression of an HLA-G transgene is a tissue or cell type-selective promoter.
  • the mammalian expression vector includes comprising a third nucleic acid sequence encoding a reporter protein.
  • the mammalian expression vector is a transposon vector.
  • a genetically modified mammalian ceil is provided that contains the mammalian expression vector.
  • an isolated nucleic acid comprises: (i) a first nucleic acid sequence that encodes an amino acid sequence at least 95% identical to human HLA-G, wherein the amino acid sequence comprises a mutation that reduces retention of HLA-G in the endoplasmic reticulum-golgi recycling pathway; and (ii) a second nucleic acid sequence that is at least 95% identical the 3' untranslated region sequence of the human HLA-G gene and operably linked to the first nucleic acid sequence, wherein the second nucleic acid sequence comprises at feast one mutation that inhibits binding of a cognate microRNA to an mRNA comprising the mutated binding site within its 3' untranslated region.
  • the first nucleic acid sequence encodes an amino acid sequence of SEQ ID NO:2.
  • the second nucleic acid sequence does not comprise SEQ ID NO:4.
  • the second nucleic acid sequence comprises SEQ ID NO:3.
  • a mammalian expression vector is provided that comprises said fsrst and second nucleic acid sequences, and further comprises a promoter operably finked to the first nucleic acid sequence, wherein the promoter is not silenced in a stem cell or a in a cell generated by differentiation of the stem ceil.
  • a promoter can comprise the nucleic acid sequence of the Chinese hamster EF-la promoter.
  • the mammalian expression vector further comprises a nucleic acid sequence encoding a reporter protein.
  • the mammalian expression vector is a transposon vector.
  • the mammalian expression vector comprises all of the elements shown in Figure 1.
  • a mammalian expression vector is provided that comprises: (a) a Chinese hamster EF- 1 promoter, (b) a nucleic acid sequence that is operably linked to the promoter and that encodes human HLA-G with an amino acid sequence of SEQ ID NO:2, and (c) a 3'UTR sequence comprising SEQ ID NO:3.
  • a genetically modified mammalian cell is provided that comprises such an expression vector.
  • HLA-G modified mammalian cells are administered to a subject suffering from any of a number of conditions including, but not limited to cardiovascular disease, eye disease (e.g., macular degeneration), auditory disease, (e.g., deafness), diabetes, neurodegenerative disease, Alzheimer's Disease, Parkinson's Disease, multiple sclerosis, osteoporosis, liver disease, kidney disease, autoimmune disease, arthritis, gum disease, a dental condition, or a proliferative disorder (e.g., a cancer).
  • cardiovascular disease e.g., macular degeneration
  • auditory disease e.g., deafness
  • diabetes e.g., neurodegenerative disease, Alzheimer's Disease, Parkinson's Disease, multiple sclerosis, osteoporosis, liver disease, kidney disease, autoimmune disease, arthritis, gum disease, a dental condition, or a proliferative disorder (e.g., a cancer).
  • proliferative disorder e.g., a cancer
  • the subject is suffering from, or at high risk of suffering from, an acute health condition, e.g., stroke, spinal cord injury, burn, or a wound.
  • an acute health condition e.g., stroke, spinal cord injury, burn, or a wound.
  • the subject is suffering from loss of tissue such as lipatrophy or aging-related losses in collagen.
  • the subject suffers from a non-healing ulcer, or is need for an agent to assist in closure of defects like hypospadias and epispadias.
  • the subject is need for a permanent or temporary skin graft for would healing or for skin substitutes.
  • the invention provides a universal method of cellular or tissue repair or regeneration to a subject in need thereof, the method comprising injecting or grafting (o the subject a cellular or tissue composition comprising a population of eHLA-G modified cells, wherein the subject has at least one mismatched classical HLA class I or HLA. class II molecule as compared to the population of eHL A-G modified cells, and wherein the population of eHLA-G modified ceils exhibits reduced immunogenieity and/or improved immunosuppression as compared to cells of the same-type without the eHLA-G modification.
  • the reduced immunogenieity and/or improved immunosuppression can be determined, for example, by comparing the eHLA-G modified cell to a control cell of the same type without the eHLA-G modification in an NK-92 cytotoxicity assay, a humanized NSG tumor growth assay, and/or a PBMC proliferation assay.
  • the population of genetically modified cells comprises a population of eHL A-G genetically modified human dermal fibroblasts.
  • the population of genetically modified cells comprises a population of eHLA-G genetically modified human epidermal progenitors.
  • the population of genetically modified cells comprises a population of eHL A-G genetically modified human mesenchymal stem cells.
  • the population of genetically modified cells comprises a population of eHLA-G genetically modified human embryonic stem cells.
  • the population of genetically modified cells comprises a population of cell differentiated in vitro from eHLA-G genetically modified human embryonic stem cells, in other embodiments, the population of genetically modified cells are not rejected by the subject's immune system for at least 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 24, 36, 48, or 52 weeks.
  • the invention provides a method for regenerating skin to a subject in need thereof, the method comprising injecting a population of eHLA-G modified dermal fibroblasts and/or eHLA-G modified embryonic epidermal progenitors to a site of skin injury on the subject, wherein the subject has at least one mismatched classical HLA class I or HLA class II molecule as compared to the population of eHLA-G modified dermal fibroblasts and/or eHLA-G modified embryonic epidermal progenitors.
  • a cell therapy method is pro vided ihai comprises administering to a subject in need thereof a population of genetically modified mammalian cells comprising an exogenous human 2-microglobulin ( ⁇ 2 ⁇ ) molecule and an eHLA-G transgene of the invention.
  • FIG. 1 shows a schematic depiction of a non-limiting embodiment of an enhanced HLA-G (eHLA-G) transgene expression transposon vector containing a selection marker (neomycin phosphotransferase) driven by a phosphoglycerate kinase (PGK) promoter; "INS" flanking insulator elements; a Chinese Hamster EF-l a promoter drive expression of eHLA- G; a PGK promoter driving expression of EGFP; and 5' terminal repeat (TR) transposition elements.
  • a selection marker neomycin phosphotransferase
  • PGK phosphoglycerate kinase
  • An eHLA-G transgene contains a combination of mutations and/or non-coding elements (such as, for example, a promoter or modified 3' UTR) that enhance expression, particularly cell surface expression, of the HL A-G protein.
  • non-coding elements such as, for example, a promoter or modified 3' UTR
  • the eHLA-G transgene the above elements, and more specifically included a human HLA-G coding sequence as listed in SEQ ID NO:2 with mutations of HLA-G's ER retrieval motif (K334A/K335A); and 2) mutation of HL A-G's 3' UTR microR A binding sites, wherein this modified 3' UTR had the sequence as listed in SEQ ID NO:3. See Example 3 for further description.
  • FIG. 2 shows a schematic depiction of a non-limiting embodiment of a transposase expression helper vector used to drive genomic integration of a co-transfected transposon expression vector.
  • FIG. 3 shows fluorescence micrographs of human ES cell colonies at various times after stable transfection with a transposon expression vector driving expression of eHLA-G and EGFP.
  • FIG. 4 shows a bar graph depicting the relationship between the starting number of hES cells transfeeied with an EGFP-coniaming expression vector and the fraction of EGFP ceils detected in the cell population at 10 days post-transfection.
  • the numbers on the x-axis are the number of GFP' colonies per 5x10 5 cells.
  • the numbers on the y-axis are the cell number.
  • (Bottom Panel) shows a bar graph depicting the relationship between various transposon vectors (using different promoters) and the fraction of EGFP cells detected in the cell population.
  • the numbers on the x-axis are the number of GFP + colonies per 5 l0 5 cells.
  • FIG. 5 shows a series of immunofluorescence micrographs showing expression in
  • HLA-G modified human ES cells of HLA-G expression and DAPI stainingitop images HLA-G modified human ES cells of HLA-G expression and DAPI stainingitop images
  • FIG. 6 shows a flow cytometry scattergram showing the distribution of
  • Panel shows the distribution of Oct 3/4 + cells in the population of eHLA-G-modified hES cells.
  • SSEA-4 and Oct 3/4 are pluripotency markers. This data, along with Fig. 5, indicate that eHLA-G-modified hES cells maintained their characteristic self-renewal pluripotency markers. Additionally, eHLA-G(EF- 1 )-GFP-hESCs maintained their pluripotency and normal karyotype in vivo. Humanized NSG mice were injected subcutaneously with eHLA-
  • FIG. 7 shows phase contrast photomicrographs of Wildtype (left picture) and eHLA-G modified hESC-generated (right picture) embryoid bodies (EBs) at day
  • FIG. 8 shows that eHLA-G ; hESCs are silencing resistant, (Top Panel) shows a flow cytometry distribution histogram for the expression of GFP in a eHLA-G modified hESC -line, which demonstrated similar strong expression of GFP after 6 and 16 passages, (Bottom Panel) shows a flow cytometry distribution histogram for the expression of HLA-G in the same hESC line, again showing persistent expression of the eHLA-G transgene at both passage 6 and 16,
  • FIG. A shows flow cytometry distribution histograms for total (intracellular) expression HLA-G in wildtype (left histogram), GFP-modified (middle histogram), and eHLA-G(EF-la)-GFP modified hESCs (right histogram).
  • Bottom Panel shows flow cytometry distribution histograms for surface expression HLA-G in wildtype (left histogram), GFP-modified (middle histogram), and eHLA-G (EF- l a)-GFP modified hESCs (right histogram).
  • FIG. 1 shows flow cytometry distribution histograms for total (intracellular) expression HLA-G in wildtype (left histogram), GFP-modified (middle histogram), and eHLA-G(EF-la)-GFP modified hESCs (right histogram).
  • FIG. 9B shows a flow cytometry distribution histogram for total expression HLA-G in eHLA-G(MSCV)-GFP modified hESCs.
  • FIG. 9B shows surface HLA-G expression eHLA-G(MSCV)-GFP modified hESCs.
  • FIG. 10 shows that expression of HLA class I and class II is similar on wildtype and eHLA-G+ hESCs.
  • the table compares expression levels of various HLA v ariants and ⁇ :2 microglobulin in wildtype versus HLA-G modified hESCs.
  • FIG. 11 shows that NK92 cytotoxicity effect is greatly suppressed by eHLA-G + hESCs.
  • the figure shows a bar graph illustrating the results of an ⁇ 92 cell cytotoxicity assay.
  • the 1 : 10 and 1 :30 values indicate the ratio of effector (NK92) to target cells (GFP transgene alone control wild-type cells or eHLA-G-GFP transgene modified cells)
  • This is an in vitro assay to determine the immunogenicity of eHLA-G modified hESCs (black bars; eHLA-G-GFP) compared to wildtype hESCs (grey bars; GFP).
  • eHLA-G modified hESCs exhibit substantially reduced cytotoxicity in the presence of NK92 cells as compared to the case for wildtype hESCs.
  • This data indicates that exogenous HLA-G expression can provide improved donor capabilities for such genetically modified cells, as reduced cytotoxicity in the presence of NK92 cells shows that such genetically modified cells have reduced immunogenicity and/or improved
  • FIG. 12 shows a series of bar graphs depicting the time course of gene expression levels of several piuripotency markers and epidermal progenitor markers during directed differentiation of hESCs in vitro into embryonic epidermal progenitors (EEPs).
  • the y-axis values are relative mRNA expression levels as determined by semi-quantitative RT-PCR.
  • the x-axis values are the days at which expression was assessed. See Example 2 for further description.
  • the Fig. 12 data indicates that the epidermal differentiation markers K14, Tap63, and ⁇ 63 were gradually enhanced during differentiation.
  • immunofluorescence studies of K14 and additional epidermal markers p63, CD29, and CD49f were conducted. Differentiated eHLA-G(EF- 1 a)-GFP hEEPs were positive for K14, p63, CD29, and CD49f protein expression as indicated by immunofluorescence.
  • FIG. 13 shows time course of eHLA-G transgene expression in an hESC line stably tratisfected with EF-1 a promoter- driven expression of eHLA-G.
  • Bottom Panel shows a comparison of the time course (black bars indicate at 0 days; horizontal striped bars indicate at 7 days; and grey bars indicate at 14 days); of HLA-G (mRNA) expression in a GFP-modified hESC fine (negative control), an MSCV-promoter driven eHLA-G hESC line, and in an EF-1 a driven eHLA-G hESC line. Note the higher and more persistent level of eHLA-G expression driven by the EF- 1 a promoter.
  • FIG. 14 (Effect of K562-HLA-G1 14 base pair (bp) insertion/deletion
  • the figure shows a bar graph comparing NK cell-mediated cytotoxicity (% specific lysis) on wildtype K562 cells (grey bars), K562 cells expressing an HLA-G variant with a. 14 bp insertion in the 3' UTR (Insl4bp) (black bars), and K562 cells expressing an HLA-G variant with a 14 bp deletion in the 3' UTR (Dell4bp) (grey bars).
  • NK cell effector
  • K562 cells target cell ratios.
  • FIG. 15 provides data that indicates that HLA-G transgene expression is significantly influenced by promoter activity.
  • RT-PCR shows that both GFP and HLA-G transcripts were highly expressed in eHLA-G (EF- la)-GFP-hESC cell lines.
  • Immunofluorescence also shows that both GFP and HLA-G proteins were highly expressed in HLA-G (EF- 1 a)-GFP-hESC cell lines (not shown here). However, HLA-G transcripts or proteins were rarely detected in HLA-G pMSCV)-GFP-hESC lines, whether by RT-PCR or immunofluorescence, even though GFP expression was high in these cells. (Data not shown here.) Thus, EF- l a promoters are preferred in certain embodiments of HLA-G transgene expression.
  • FIG. 1 Purified hEEPs exhibited homologous keratinocyte morphology as shown by phase contrast microscopy.
  • eHLA-G-GFP-hEEP clones 18 and 21 were differentiated from modified eHLA-G(EF- 1 a)-GFP-hESCs as described in Example 2.
  • FIG. 17 The stability of the HLA-G transgene in differentiated hEEPs was confirmed by flow cytometry. Both HLA-G total expression (top panels) and surface expression (bottom panels) was robust for differentiated eHLA-G(EF- la)-GFP-hEEPs (greater than 90% of cells) as compared to control cells with no exogenous HLA-G (GFP only hEEPs) and wild-type hEEPs.
  • FIG. 18 The results of Figure 1 1 were repeated and confirmed in additional NK cytotoxicity experiments. As shown, killing of eHLA-G(EF- 1 )-GFP-hESCs was reduced more than 100% as compared to controls hESCs that contained only a GFP transgene (no HLA-G transgene). (Note: as used herein, an "mHLA-G(EF- 1 aVGFP" transgene is synonymous with "eHLA-G(EF- 1 a)-GFP".) This data shows that HLA-G transgene expression imparts immunosuppressive and/or reduced immunogeniciry characteristics in hESCs. See Example 6 for further description.
  • FIG. 19 NK cytotoxicity experiments were conducted on hEEPs differentiated from hESCs. As shown, killing of eHLA(EF-lcc)-GFP-hEEPs was reduced well more than 100% (about 3-fold) as compared to control hEEPs. This data shows that HLA-G transgene expression imparts immunosuppressive and/or reduced immunogeniciry characteristics in differentiated cells, which also shows that these enhanced functional immune evasion characteristics of HLA-G expression via the eliLA-G transgenescalableved the directed differentiation process. See Example 6 for further description.
  • FIG. 20 shows the results of hESC allografts in humanized mice.
  • the "GO" hESCs were the control wild-type hESCs that do not contain an eHLA-G transgene, but rather only GFP.
  • "mGl(#l)” and “mGl(#2)” refer to two different eHLA-G(EF- la)-GFP nucleofected hESC clones.
  • the GO, mGl (#1), and mGl(#2) tumors as shown were measured and weighed.
  • the GO hESCs formed a tumor with a volume of 126,9 cubic millimeters and a weight of 32 milligrams.
  • the mG l(#l ) hF ⁇ SCs formed a tumor with a volume of 748.4 cubic millimeters and a weight of 318 milligrams.
  • the mGI (#2) hESCs formed a tumor with a volume of 1 1 16.7 cubic millimeters and a weight of 675 milligrams. See Example 7 for further description.
  • FIG. 21 shows the averaged results of tumors from liESC allografts onto five humanized SG mice.
  • Top panel shows tumor weight (mg) results.
  • the bottom panel shows tumor volume (cubic millimeters) results.
  • the data shows that HLA-G nucleofected hESCs ("mGI ”) formed much larger (more than 3-fold by volume) and heavier (more than 2-fold by weight) tumors than wild-type hESCs ("GO”) transplanted into humanized NSG mice. This indicates that HLA-G transgene expression can provide reduced immunogenieity and/or increased immunosuppression in an allograft human environment (i.e., NSG humanized mice).
  • FIG. 22 Human dermal fibroblasts stably ttansfected with the eHLA-G(EF-l )- GFP transgene ("HFD-ml -GFP” cells) or GFP-alone control construct ("HFD-G0-GFP” cells) were assessed for their ability to inhibit PBMC proliferation. As shown, the HFD-mGl- GFP clone "niGI -Rl" suppressed PBMC proliferation greater than controls and other clones, indicating that exogenous HLA-G expression can provide immunosuppression for differentiated cells, such as fibroblasts.
  • HFD-mGl-GFP eHLA-G(EF-l )- GFP transgene
  • HFD-G0-GFP GFP-alone control construct
  • Example 9 See Example 9 for further description, including a summary of NK-92 cytotoxicity studies with HFD-ml-GFP and controls, which shows that the eHLA-G modification to human dermal fibroblasts reduced their immunogenieity.
  • these data further support the use of the eHLA-G transgene constructs described herein for modifying any desired cell-type, whether phtripotent, multipotent, or fully differentiated, into a universal or superior allogeneic donor for therapy, transplants, tissue repair, cell and tissue substitutes, and the like.
  • the present disclosure features genetically modified mammalian cells that express exogenous HLA-G persistently (HLA-G modified cells), as well as nucleic acid compositions to generate such modified mammalian cells.
  • HLA-G modified cells genetically modified mammalian cells that express exogenous HLA-G persistently
  • nucleic acid compositions to generate such modified mammalian cells.
  • the eHLA-G genetic modifications described herein provide the cells with characteristics of reduced immunogenieity and/or improved immunosuppression, such that these cells have the promise of being universal or improved donor cells for transplants, cellular and tissue regeneration or reconstruction, and other therapies.
  • HLA-G modified ceils a wide range of mammalian ceil types that express exogenous HLA-G (HLA-G modified ceils) can be generaied.
  • Such cell types include, but are not limited to, totipotent cells, embryonic ste ceils (e.g., human embryonic stem ceils), induced pluripotent stem cells (e.g., human induced pluripotent stem ceils), multipotent stem ceils, epidermal progenitor cells, mesenchymal stem cells, pancreatic ⁇ cell progenitors, pancreatic ⁇ cells, cardiac progenitors, cardiomyocytes, hepatic progenitors, hepatocytes, muscle cell progenitors, muscle cells, kidney ceils, osteoblasts, hematopoietic progenitors, dental follicle cells, hair follicle cells, retinal pigment epithelial cells, neural stem celis, neurons, astrocytes, oligodendrocytes, inner ear celis, and
  • the HLA-G modified cells are not cells having an immune system cell type.
  • mammalian cells can be derived one of several species including, e.g., human, mouse, rat, monkey, or pig.
  • any cell-type can be transfected with the constructs described herein and then tested for HLA-G expression and how such expression can impart reduced immunogeniciry and/or improved immunosuppression to the modified cell.
  • a genetically modified pluripotent stem cell line such as a human embryonic stem cell line, or a human induced pluripotent stem cell line, or any cell line that has multipotent traits including mesenchymal stem cells and immune system progenitor cells, that expresses HLA-G is generated and then subjected to directed differentiation to obtain a cell population that expresses HLA-G and that is substantially enriched for a desired cell type.
  • the substantially enriched cell population includes at least about 2% to about 100% of the desired ceil type, e.g., at least about 3%, 4%, 5%, 7%, 8%, 10%, 20%, 22%, 25%, 35%, 40%, 45%, 50%, 60%, 70%, 75%, 80%, 85%, or another percentage of the desired cell type from at least about 2% to about 100%.
  • Methods for enriching cells of a desired cell type are known in the art. See, e.g., U.S. Patent Application No. 12/532,512
  • Methods for obtaining human embryonic stem cells or induced pluripotent stem cells are known in the art, as described in, e.g., U.S. Patent Nos. 6,200,806 and 7,217,569 (for human embryonic stem cell derivation) and 8,048,999, 8,058,065, and 8,048,675 (for generation of human induced pluripotent stem cells).
  • genetically modified mammalian pluripotent or rn.ullipot.ent stem cell lines e.g., human embryonic stem cells or human induced pluripotent stem cells, etc.
  • the cell line is genetically modified by stable transfection with one or more nucleic acid expression vectors (e.g., a plasmid vector or a minicircle vector) (hat include an expression cassette for expression of an HLA-G protein as described herein, a selection marker, and optionally a reporter protein.
  • suitable selection markers encoded by such vectors include proteins that confer resistance to a selection agent.
  • proteins and their corresponding selection agents include, without limitation, puromycin N-acetyltransferase (puromycin), hygromycin phosphotransferase (hygromycin), blasticidin-S-deaminase (blasticidin), and neomycin phosphotransferase (neomycin).
  • Selection with the appropriate selection agent may last for at least about. 3 to about 14 days, e.g., about 4, 5, 6, 7, 8, 9, 10, 12, 13, or another period from about 3 to about 14 days until resistant colonies are apparent.
  • fluorescent reporter proteins include, but are not limited to, EGFP and its variants such as YFP, Cyan, and dEGFPs; DS-Red, monomeric Orange, the far- red fluorescent protein "Katushka” (Sheherbo et al (2007), Nat Methods, 4:741-746), or variants of any of the foregoing.
  • the reporter is an enzyme that converts a substrate that, in the process, yields a detectable signal, e.g., a fluorescent or luminescent signal in the presence of a fluorogenic or luminogenic substrate, respectively .
  • the selection marker enzyme comprises the amino acid sequence of a luciferase, e.g., a firefly luciferase, click beetle luciferase, or Renilla luciferase.
  • Luciferase activity can be detected by providing an appropriate luminogenic substrate, e.g., firefly luciferin for firefly luciferase or coelenterazine for Renilla luciferase.
  • Luciferase activity in the presence of an appropriate substrate can be quantified by iuminornetry to assay total luciferase activity of whole cell populations in culture dish wells, or, alternatively, luciferase activity of individual cells or colonies can be detected by use of a microscope in combination with a photon counting camera. Details of luciferase assays, including high- throughput methods, are disclosed in, e.g., U.S. Pat. Nos. 5,650,135, 5,744,320, and
  • the reporter enzyme comprises the amino acid sequence of a modified beta-lactamase, the expression of which can be detec ted and quantified in living cells by a ratiometric fluorescence assay for breakdown of fluorogenic .beta. -lactam substrates as described in, e.g., U.S. Pat. Nos, 5,741,657, 6,031 ,094, and U.S. Patent Publication No. 200701 84513. See also Qureshi (2007), Biotechniques, 42(l):91-96 for a review.
  • reporter enzymes include, but are not limited to, the Halo-Tag* " hydrolase (Promega, Madison, Wis., as described in, e.g., U.S. Pat. No. 7,238,842 and Patent Publication Nos. 20080026407 and 20080145882) and beta.-galactosidase.
  • the genetically modified mammalian cells are also genetically modified to express a human ⁇ 2 microglobulin (GenBank Accession No, AY 187687.1). Without wishing to be bound by theory, it is believed that expression of human ⁇ 2 microglobulin will enhance surface expression of transgenic HLA-G in the genetically modified mammalian cells.
  • the nucleic acid expression vector is a transposed! vector that includes transposition elements that facilitate integration of the transposition of the transposon vector into a host genome when introduced into a host cell in the presence of a cognate transposase (e.g., the piggyBAC transposase), as described in, e.g., U.S. Patent Application No. 12/728,943.
  • Transposon expression vectors e.g., PiggyBac vectors
  • transposase expression vectors are commercially available from, e.g., System Biosciences (Mountain View, CA).
  • the expression vector may be a targeting vector, which allows site-specific integration of the eHLA-G transgene in the host cell genome.
  • targeting vectors is routine in the art as exemplified by U.S. Patent No, 5,464,764.
  • genetically modified cells e.g., differentiated, muhipotent, pluripotent, or totipotent stem cell lines, are generated by transduction with a recombinant virus.
  • suitable recombinant viruses include, but are not limited to, retroviruses (including lentiviruses); adenoviruses; and adeno-associated viruses.
  • the recombinant retrovirus is murine moloney leukemia virus (MMLV), but other recombinant retroviruses may also be used, e.g., Avian Leukosis Virus, Bovine Leukemia Vims, Murine Leukemia Virus (MLV), Mink-Cell focus-Inducing Vims, Murine Sarcoma Virus,
  • MMLV murine moloney leukemia virus
  • retroviruses may also be used, e.g., Avian Leukosis Virus, Bovine Leukemia Vims, Murine Leukemia Virus (MLV), Mink-Cell focus-Inducing Vims, Murine Sarcoma Virus,
  • Reticuloendotheliosis virus Gibbon Ape Leukemia Vints, Mason Pfizer Monkey Vims, or Rous Sarcoma Virus, see, e.g., U.S. Pat. No. 6,333, 195,
  • the recombinant retrovirus is a lentivirus (e.g., Human
  • the recombinant retrovirus may comprise a viral polypeptide (e.g., retroviral env) to aid entry into the target cell.
  • a viral polypeptide e.g., retroviral env
  • the viral polypeptide may be an aniphotropic viral polypeptide, e.g., aniphotropic env, that aids entry into cells derived from multiple species, including cells outside of the original host species. See, e.g., id.
  • the viral polypeptide may be a xenotropic viral polypeptide that aids entry into cells outside of the original host species. See, e.g., id.
  • the viral polypeptide is an ecotropic viral polypeptide, e.g., ecotropic env, that aids entry into cells of the original host species. See, e.g., id.
  • Viral transduction of ceils may be accomplished by any method known in the art. e.g., Palsson, B., et al , (1995), WO95/10619; Morling, F. J. et al, (1995), Gene Therapy, 2:504-508; Gopp et al, (2006), Methods Enzymol, 420:64-81 .
  • the infection may be accomplished by spin- infection or "spinoculation" methods that involve subjecting the cells to centrirugation during (he period closely following the addition of virus to the cells.
  • vims may be concentrated prior to the infection, e.g., by ultracentrifugatton.
  • the multiplicity of infection (m.o.i.) used to transduce the cells to be genetically modified can range from about I m.o.i. to about 50 m.o.i., e.g., about 1 m.o.i., about 5 m.o.i., about 7.5; m.o.i., about 10 m.o.i., about 15 m.o.i., about 20 m.o.i., about 30 m.o.i., about 40 m.o.i., or about 50 m.o.i.; [0063] Methods for generating various cell types from pl ripotent stem cells (e.g., human embryonic stem cells or human induced pluripotent stem cells) by directed differentiation are known in the art, as described in, e.g., U.S. Patent Nos. 7,955,849, 7,763,466, 7,264,968; and U.S. Patent Application Application Nos. 12/179,462, and 12
  • hitman embryonic epidermal progenitors are derived from a human pluripotent stem cell line, e.g., human embryonic stem cells or human induced pluripotent stem cells as follows.
  • Pluripotent stem cells are maintained in Embryonic Stem Cell (ESC) growth medium containing DMEM/F 12 ( 1 : 1 ) supplemented with 20% knockout serum replacement, 0.1 mM MEM non-essential amino acids, 1 mM GlutaMax, 0.1 mM ⁇ -mercaptoethanol (Sigma).
  • ESC growth medium is conditioned by plating mitotically inactivated mouse embryonic fibroblasts (MEFs) (CF-1 , ATCC) at a density of 5x1 () 4 cells/cn and incubating for 18-24 hours. After conditioning, 4 ng/ml bFGF is added and complete conditioned medium is sterile filtered.
  • MEFs mitotically inactivated mouse embryonic fibroblasts
  • hESCs are subcultured every 5-6 days (at a 1 :3 or 1 :4 split) on Matrigel* (BD BiosciencesVcoated plates using I mg/mf Dispase to remove cell colonies.
  • hEEPs Differentiation of pluripotent s tem cells into K147p63 hEEPs, by first culturing the pluripotent stem cells in 6-well plates for 4 days in ESC growth medium and then changing over to 2 ml/well of differentiation medium, comprised of unconditioned hESC growth medium containing I ⁇ all-trans retinoic acid (Sigma) and 25 ng/ml BMP4.
  • DSFM defined keratinocyte serum-free medium
  • hEEPs To enhance purity of isolated hEEPs, cells were sorted using magnetic activated cell sorting (MASC) with CD29 antibodies. About 92 percent of CD29 MASC sorted hEEP cell culture cells differentiated from eHLA- G(EF-la)-GFP modified hESCs were positive for K14, a specific keratinocyte marker.
  • MSC magnetic activated cell sorting
  • immunogenicity may be reduced by at least about 5% to about 95%, relative to a corresponding cell type that does not express exogenous HLA-G, e.g., about 6%, 7%, 10%, 12%, 15%, 20%, 30%, 40%, 50%, 65%, 70%, 80%, 85%, 90%, or another percent reduced immunogenicity relati v e to cells of the same cell type that do not express exogenous HLA-G.
  • HLA-G modified mammalian cells e.g., human embryonic stem cells, or differentiated ceils from HLA-G modified embryonic stem cells, or ceils that are already fully differentiated prior to modification, etc.
  • unmodified mammalian cells are cultured in the presence of an allogenic natural killer cell line (e.g., NK-92) and then cytotoxicity to the HLA-G modified versus unmodified cells by induced by the NK-92 cells is determined by any of a number of standard cell viability assays.
  • an allogenic natural killer cell line e.g., NK-92
  • the isolated nucleic acids used to generated HLA-modified mammalian cells, as described herein, contain an enhanced HLA-G "eHLA-G" transgene that drives increased cell surface expression and/or secretion of HLA-G relative to cell surface expression driven by a wildtype HLA-G transgene.
  • eHLA-G enhanced HLA-G
  • Such a transgene typically includes at least three distinct components: a promoter and 5' untranslated region (5' LiTR) sequence; a coding sequence; and a 3' untranslated region (3' LiTR) sequence.
  • the promoter to be used to drive eHLA-G transgene expression is one capable of driving expression of the eHLA-G transgene in a cell type of interest for a period of at least about seven weeks to about 50 weeks, e.g., 8 weeks, 9 weeks, 10 weeks, 12 weeks, 15 weeks, 20 weeks, 25 weeks, 30 weeks, 35 weeks, 40 weeks, 42 weeks, 45 weeks, 47 weeks, 48 weeks, or another period from at least about seven weeks to about 50 weeks.
  • Promoters capable of driving expression for such extend periods of time are effective in evading silencing that occurs in a number of cell types including, e.g., stem cells such as embryonic stem cells, induced pluripotent stem cells, or mesenchymal stem cells.
  • stem cells such as embryonic stem cells, induced pluripotent stem cells, or mesenchymal stem cells.
  • Suitable, silencing-resistant promoters include, but are not limited to, the Chinese hamster elongation factor- 1 alpha (CHEF- la) promoter (see Running Deer et al (2004), Biotechnol. Prog., 20:880-889; and GenBank Accession No. AY 188393.1 ), the M-U3/R- variant promoter of the Murine Stem Cell Virus (MSCV) promoter (as described in Swindle et al (2004), J Biol Chem, 279:34-41), the phosphoglycerate kinase (PGK) promoter, the human ⁇ -actin promoter, and the ubiquitin C promoter.
  • CHEF- la Chinese hamster elongation factor- 1 alpha
  • MSCV Murine Stem Cell Virus
  • PGK phosphoglycerate kinase
  • the promoter used to drive expression of an eHLA-G transgene is expressed in one or more desired ceil types at a level that is higher than in other cell types.
  • a promoter that is active within or even selective for that particular cell type may be advantageous to select a promoter that is active within or even selective for that particular cell type.
  • the expression level may be about two fold to 100 fold higher in the desired ceil type compared to another cell type, e.g., about 3 fold, 4 fold, 5 fold, 10 fold, 20 fold, 25 fold, 30 fold, 40 fold, 50 fold, 70 fold, 80 fold, 90 fold, or another fold higher level of expression in the desired cell type compared to another cell type.
  • tissue and/or cell type-selective promoters include, but are not limited to, the promoters for: Neuron-Specific Enolase (neuronal), Synapsin (neuronal), CamKII (forebrain neurons), HB9 (motor neurons), and Dopamine Transporter (dopaminergic neurons); Glial Fibrillary Acidic Protein (astrocytes); Albumin (liver); a-Myosin Heavy Chain (oMHC-cardiomyocytes); Neurogenin 3 and Pancreas-Duodenum Homeobox 1 (pancreas); Keratin 14 (skin); and Bestrophinl (retinal pigment epithelium);
  • Neuron-Specific Enolase neuron-Specific Enolase
  • Synapsin neuroneuronal
  • CamKII forebrain neurons
  • HB9 motor neurons
  • Dopamine Transporter dopaminergic neurons
  • Glial Fibrillary Acidic Protein astrocytes
  • Albumin liver
  • the eHLA-G transgene sequence encodes an HLA-G protein that contains at least one to about ten point mutations relative to the human (GenBank No. NP_0021 18.1 ), or chimpanzee consensus sequence, e.g., 2, 3, 4, 5, 6, 7, 8, 9, or 10 point mutations relative to the above-mentioned HLA-G protein consensus sequences.
  • MVVMAPRTLFL LSGALTLTETWAGSHSMRYFSAAVSRPGRGEPRFIAMGYVD DTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTL RGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSW TAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPP
  • the at least one to about ten point mutations increase the level of expression of the HLA-G protein on the cell surface of the expressing host cell by reducing retention of HLA-G in the endoplasmic reticulum during processing and maturation of the protein.
  • Such mutations include, for example, an HLA-G "KK" motif mutation. See, e.g.. Park el al (2001), Immunity, 15:213-224.
  • the KK motif mutation includes a K334A mutation, a K335A mutation, or both substitution mutations.
  • the substitution may be made with a different aliphatic amino (e.g., leucine) acid or another type of type of amino acid that is non-basic,
  • the encoded HLA-G protein has the amino acid sequence of (SEQ ID NO:2), in which K334A and K335A substitutions, relative to the wikltype sequence, have been introduced (underlined):
  • an eHLA-G transgene encodes an HLA-G protein the amino acid sequence of which is at least 75% to 100% identical to that of SEQ ID NO:2, e.g., 77%, 80%, 82%, 85%, 87%, 88%, 90%, 92%, 95%, 96%, 97%, 98%, 99%, or another percent identical to the amino acid sequence of SEQ ID NO:2.
  • the eHLA-G transgene disclosed herein also includes a 3' untranslated (3' UTR) region containing a number of regulatory elements affecting the expression/translational efficiency of HLA-G transcripts.
  • the eHLA-G transgene 3' UTR sequence is a nucleic acid sequence that includes a nucleic acid sequence thai is at least 75% identical to the sequence of (SEQ ID NO:3), e.g., at least 77%, 80%, 82%, 85%, 87%, 88%, 90%, 92%, 94%, 95%, 96%, 97%, or another percent identical to the sequence of HLA-G 3' UTR (SEQ ID NO:3):
  • Such sequences contain mutations (underlined) that decrease binding of two microRNA binding sites that result in increased expression of the trangene-encoded HLA-G.
  • These sequences include a deletion of a 14 base pair sequence present in ex on 8 of some HLA-G alleles. This 14 base pair sequence is shown below as SEQ ID NO NO:4: SEQ ID NO:4 14-bp insertion sequence in HLA 3' UTR
  • SEQ ID NO:5 corresponds to SEQ ID NO:3 with the insertion of this 14 base pair sequence (lower case):
  • HLA-G alleles having a 3' UTR yield a more stable HLA-G mRNA transcript. See Rouseau et al (2003), Human Immunology, 64: 1005-1010.
  • SEQ ID NO:3 shows that expression of the allele with a 14 base pair deletion (shown in SEQ ID NO:3) appeared to be more immunoprotective than the allele that includes the 14 pair insertion. See Fig. 13.
  • the effect of the 14 bp deletion on expression levels of HLA-G may be cell type-specific, e.g., the 14 bp deletion apparently enhances expression of eHLA-G in human cells, including at least hESCs, hEEPs, and human dermal fibroblastcells.
  • the nucleic acid sequence containing the eHLA-G transgene also includes insulators sequences that flank the eHLA-G expression cassette. Insulator sequences mitigate genomic position effects that could spuriously affect expression of an integrated exogenous expression cassette.
  • the insulator sequences to be used contain the chicken ⁇ -globin HS4 core insulator sequence.
  • the nucleic acid containing the eHLA-G transgene will also include a selection marker as described herein.
  • the isolated nucleic acid containing the eHLA-G transgene may further contain a reporter protein as described herein.
  • generation of an eHLA-G-modified cell line is generated by the use of a transposon vector that comprises an eHLA-G expression cassette, but does not contain expression cassettes for a. selection marker or a reporter protein.
  • the vector is introduced to the cells to be modified along with a transposase expression vector, followed by limiting dilution cloning. As the population of ceils transfected is very efficiently modified, the need to use selection markers or reporter proteins can be avoided. This is an important consideration, especial ly for cells to be used in the context of cel l therapy in human patients.
  • the percentage of cells that is successfully modified by transposon-based stable transfection methods can range from about 0.5% to about 50%, e.g., 1%, 2%, 3%, 5%, 7%, 8%, 15%, 20%, 22%, 30%, 40%, or another percentage from about 0.5% to about 50% of the cells transfected.
  • a polycistronic expression cassette may incorporate one or more internal ribosomal entry site (IRES) sequences between open reading frames incorporated into the polycistronic expression cassette.
  • IRES sequences and their use are known in the art as exemplified in, e.g., Martinez- Salas (1999), Curr Opin Biotechnol, 10(5):458-464.
  • multiple open reading frames may be linked to each other by an intervening 2A peptide sequence of the foot-and- mouth disease virus (F2A) or 2A-like sequences from other viruses. See, e.g., Hasegawa et al (2007), Stem Cells, 25:1707-1712 and Symczak et al (2004), Nat Biotechnol, 589-594.
  • Inclusion of the 2A peptide sequence allows post-translational cleavage of a contiguous polypeptide containing eHLA-G and other sequences (e.g., a reporter protein sequence or a selection marker protein sequence) into separate proteins.
  • sequence comparison algorithm While identity between relatively short amino acid or nucleic acid sequences can be easily determined by visual inspection, analysis with an appropriate algorithm, typically facilitated through computer software, commonly is used to determine identity between longer sequences.
  • test and reference sequences typically are input into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated.
  • sequence comparison algorithm then calculates the percent sequence identity for the test sequence(s) reiative to the reference sequence, based on the designated program parameters.
  • a number of mathematical algorithms for rapidly obtaining the optimal alignment and calculating identity between two or more sequences are known and incorporated into a number of available software programs.
  • Examples of such programs include the MATCH-BOX, MULTAIN, GCG, FASTA, and ROBUST programs for amino acid sequence analysis, and the SIM, GAP, NAP, LAP2, GAP2, and PIPMAKER programs for nucleotide sequences.
  • Preferred software analysis programs for both amino acid and polynucleotide sequence analysis include the ALIGN, CLUSTALW (e.g., version 1.6 and later versions thereof), and BLAST programs (e.g., BLAST 2.1, BL2SEQ, and later versions thereof).
  • Identity refers to the percentage of amino acid residues or nucleotide bases, respectively, that are identical in the two amino acid or nucleotide sequences when two such amino acid sequences or two such nucleotide sequences are optimally aligned with one another. If, in the optimal alignment, a position in a first sequence is occupied by the same amino acid residue or nucleotide residue as the corresponding position in the second corresponding amino acid or nucleotide sequence, the sequences exhibit identity with respect to that residue position.
  • nucleic acids that that hybridize specifically under low, medium, or high stringency conditions to a probe of at least 100 nucleotides from a nucleic acid encoding the amino acid sequence of SEQ ID NO:2 or to the nucleic acid sequence of SEQ ID NOS:3 OR 5.
  • Low stringency hybridization conditions include, e.g., hybridization with a 100 nucleotide probe of about 40% to about 70% GC content; at 42 °C in 2X SSC and 0.1% SDS.
  • Medium stringency hybridization conditions include, e.g., at 50 °C in 0.5X SSC and 0.1% SDS.
  • High stringency hybridization conditions include, e.g., hybridization with the above-mentioned probe at 65 °C. in 0.2X SSC and 0.1 % SDS, Under these conditions, as the hybridization temperature is elevated, a nucleic acid with a higher sequence homology is obtained.
  • compositions comprising eHLA-G Genetically Modified Cells
  • compositions comprising or generated using one or more HLA-G modified mammalian cell types.
  • eHLA-G modified hESCs displayed stable and persistent HLA-G expression, even through directed differentiation into liEEPs.
  • the stable and persistent HLA-G expression provided the genetically modified cells with reduced imm nogenicity and/or improved immunosuppression.
  • eHLA-G modified human dermal fibroblasts which are fully differentiated cells, also have stable and persistent HLA-G expression that provides reduced
  • the eHLA-G constructs described herein can be used to generate universal donor cells of any type, whether from directed differentiation of a genetically modified pluripotent or multipotent cell, or from genetic modification of a fully differentiated cell.
  • a topical composition for skin regeneration or repair comprises a genetically modified dermal fibroblast cell comprising an eHLA-G transgene as described herein.
  • a pharmaceutical composition for injection is provided that comprises a genetically modified dermal fibroblast cell comprising an eHLA-G transgene as described herein.
  • a skin graft composition is provided that comprises a genetically modified dermal fibroblast cell comprising an eHLA-G transgene as described herein.
  • a permanent skin graft composition is provided that comprises a genetically modified embryonic epidermal progenitor cell comprising an eHLA- G transgene as described herein.
  • biocompatible synthetic scaffolds for artificial tissue and methods for their generation are described in the art and may be used with the HLA-G modified cells described herein to produce an artificial tissue having reduced immunogenicity and/or improved immunosuppression as compared to tissues containing cells that do not express exogenous HLA-G. See, e.g., U.S. Patent No. 7,960,166 entitled “Microfebricated compositions and processes for engineering tissues containing multiple cell types.
  • ceils modified to stably express exogenous HLA-G in the manner described herein have reduced immunogenicity and/or increased immunosuppression, these traits allow the modified cell to serve as a universal or improved donor cell or tissue. This is because the HLA-G mediated reduction of immunogenicity and/or improvement in immunosuppression provided to the cell can reduce or eiiminaie the requirement of matching the type of classical human leukocyte antigen (HLA) class I and class II molecules between donor cells and the recipient) for numerous injuries, diseases, or disorders.
  • HLA human leukocyte antigen
  • HLA-G modified cells that stably express eHLA-G (and optionally in addition, exogenous human ⁇ 2 microglobulin), as described herein, may be used as for therapy.
  • the therapy may be directed at treating the cause of the disease; or alternatively, the therapy may be to treat the effects of the disease or condition.
  • the genetically modified ceils may be transferred to, or close to, an injured site in a subject; or the cells can be introduced to the subject in a manner allowing the celis to migrate, or home, to the injured site.
  • the transferred cells may advantageously replace the damaged or injured cells and allow improvement in the overall condition of the subject.
  • the transferred celis may stimulate tissue regeneration or repair, including skin regeneration or skin repair.
  • HLA-G modified mammalian cells are administered to a subject suffering from any of a number of conditions including, but not limited to cardiovascular disease, eye disease (e.g., macular degeneration), auditory disease, (e.g., deafness), diabetes, neurodegenerative disease, Alzheimer's Disease, Parkinson's Disease, multiple sclerosis, osteoporosis, liver disease, kidney disease, autoimmune disease, arthritis, gum disease, a dental condition, or a proliferative disorder (e.g., a cancer).
  • cardiovascular disease e.g., macular degeneration
  • auditory disease e.g., deafness
  • diabetes e.g., neurodegenerative disease
  • Alzheimer's Disease Parkinson's Disease
  • multiple sclerosis e.g., osteoporosis
  • liver disease e.g., kidney disease
  • autoimmune disease e.g., arthritis
  • gum disease e.g., a dental condition
  • a proliferative disorder e.g., a cancer
  • the subject is suffering from, or at high risk of suffering from, an acute health condition, e.g., stroke, spinal cord injury, burn, or a wound.
  • an acute health condition e.g., stroke, spinal cord injury, burn, or a wound.
  • the subject is suffering from Joss of tissue such as lipatrophy or aging-related losses in collagen.
  • the subject suffers from a non-healing ulcer, or is need for an agent to assist in closure of defects like hypospadias and epispadias.
  • the subject is need for a permanent or temporary skin graft for would healing or for skin substitutes.
  • the invention provides a universal method of cellular or tissue grafting to a subject in need thereof, the method comprising injecting or grafting to the subject a cellular or tissue composition comprising a population of eHLA-G modified cells, wherein the subject has at least one mismatched classical HLA class I or HLA class II molecule as compared to the population of eHLA-G modified cells, and wherein the population of eHLA-G modified ceils exhibits reduced immunogenic ity and/or improved immunosuppression as compared to cells of the same-type without the eHLA-G modification.
  • the reduced immunogenicity and/or improved immunosuppression can be determined, for example, by comparing the eHLA-G modified cell to a control cell of the same type without the eHLA-G modification in an NK-92 cytotoxicity assay, a humanized NSG tumor growth assay, and/or a PBMC proliferation assay.
  • the invention provides a method for regenerating skin to a subject in need thereof, the method comprising injecting a population of eHLA-G modified dermal fibroblasts and/or eHLA-G modified embryonic epidermal progenitors to a site of skin injury on the subject, wherein the subject has at least one mismatched classical HLA class I or HLA class II molecule as compared to the population of eiiLA-G modified dermal fibroblasts and'or eHLA-G modified embryonic epidermal progenitors,
  • HLA-G modified cell types to be administered to a subject in need thereof include, but are not limited to, epidermal progenitor cells, mesenchymal stem cells, pancreatic ⁇ cell progenitors, pancreatic ⁇ cells, cardiac progenitors, cardiomyocytes, hepatic progenitors, hepatoeytes, muscle cell progenitors, muscle ceils, kidney cells, osteoblasts, hematopoietic progenitors, dental follicle cells, hair follicle cells, retinal pigment epithelial cells, neural stem cells, neurons, astrocytes, oligodendrocytes, or any combination thereof.
  • mammalian ceils can be derived one of several species including, e.g., human, mouse, rat, monkey, or pig.
  • the therapy may be directed at treating the cause of the disease; or alternatively, the therapy may be to treat the effects of the disease or condition.
  • the HLA-G modified cells may be transferred to, or close to, an injured site in a subject; or the cells can be introduced to the subject in a manner allowing the cells to migrate, or home, to the injured site.
  • the transferred cells may advantageously replace the damaged or injured cells and allow improvement in the overall condition of the subject. In some instances, the transferred cells may stimulate tissue regeneration or repair.
  • the transferred cells may be cells differentiated from HLA-G modified pluripotent (or totipotent) stem cells.
  • the transferred cells also may be multipotent stem cells differentiated from pluripotent, HLA-G modified ceils.
  • the number of administrations of treatment to a subject may vary. Introducing the HLA-G modified and/or differentiated cells into the subject may be a one-time event; but in certain situations, such treatment may elicit improvement for a limited period of time and require an on-going series of repeated treatments. In other situations, multiple administrations of the cells may be required before an effect is observed. As will be appreciated by those of ordinary skill in the art, the exact treatment protocols will depend upon the disease or condition, and the stage of the disease and parameters of the individual subject being treated.
  • the HLA-G modified cells may be introduced to the subject via any of the following routes: parenteral, intravenous, intraarterial, intramuscular, subcutaneous, transdermal, intratracheal, intraperitoneal, or into spinal fluid.
  • the HLA-G modified cells may be differentiated into cells and then transferred to subjects suffering from a wide range of diseases or disorders.
  • Pancreatic islet cells or primary cells of the islets of Langerhans
  • pancreatic beta cells derived from HLA-G modified cells are transplanted into a subject suffering from diabetes (e.g., diabetes mellitus, type 1 ).
  • hepatic cells or hepatic stem ceils derived from HLA-G modified cells are transplanted into a subject suffering from a liver disease, e.g., hepatitis, cirrhosis, or liver failure.
  • a liver disease e.g., hepatitis, cirrhosis, or liver failure.
  • Degenerative heart diseases such as ischemic cardiomyopathy, conduction disease, and congenital defects could benefit from stem cell therapies. See, e.g., Janssens et ai, (2006), Lancet, 367: 1 13- 121.
  • Hematopoietic cells or hematopoietic stem cells (HSCs) derived from HLA-G modified cells may be transplanted into a subject suffering from cancer of the blood, or other blood or immune disorder.
  • cancers of the blood that are potentially treated by hematopoietic cells or HSCs include: acute lymphoblastic leukemia, acute myefoblastic leukemia, chronic myelogenous leukemia (CML), Hodgkin's disease, multiple myeloma, and non-Hodgkiris lymphoma.
  • CML chronic myelogenous leukemia
  • Hodgkin's disease multiple myeloma
  • non-Hodgkiris lymphoma Often, a subject suffering from such disease must undergo radiation and/or chemotherapeutic treatment in order to kill rapidly dividing blood cells.
  • Introducing HSCs derived from HLA-G modified cells to these subjects may help to repopulate depleted reserv oirs of cells
  • HLA-G modified cells may be differentia! ed into neural stem cells or neurons and then transplanted to an injured site to treat a neurological condition, e.g., Alzheimer's disease, Parkinson's disease, multiple sclerosis, cerebral infarction, spinal cord injury, or other central nervous system disorder, see, e.g., Morizane et aL, (2008), Cell Tissue Res., 33 l(l):323-326; Coutts and Keirstead (2008), Exp. Neurol., 209(2):368-377; Goswami and Rao (2007), Drugs, 10(10):713-719.
  • a neurological condition e.g., Alzheimer's disease, Parkinson's disease, multiple sclerosis, cerebral infarction, spinal cord injury, or other central nervous system disorder, see, e.g., Morizane et aL, (2008), Cell Tissue Res., 33 l(l):323-326; Coutts and Keirstead (2008)
  • the HLA-G modified cells may be differentiated into dopamine-acting neurons and then transplanted into the striate body of a subject with Parkinson's disease.
  • neural stem cells may be differentiated into oligodendrocytes or progenitors of oligodendrocytes, which are then transferred to a subject suffering from MS.
  • a successful approach may be to introduce neural stem cells to the subject.
  • the HLA-G modified cells may be any neurologic disease.
  • HLA-G modified cells may also be engineered to respond to cues that can target their migration into lesions for brain and spinal cord repair, e.g., Chen et ah, (2007), Stem Cell Rev,, 3(4):280-288.
  • the HLA-G modified cells to be in ceil therapy methods also express a reporter protein as described herein.
  • the reporter protein to be used is one that facilitates in vivo detection (e.g., imaging) of the introduced cells.
  • the cells may express a far-red emitting fluorescent protein such as Katuslika, whose long excitation and emission wavelengths are well suited to imaging in tissues.
  • Katushka is commercially available under the tradename "TurboFP635" (Evrogen, Moscow, Russia),
  • MSCs were serially passaged and monitored for changes in the expression levels of the selected genes. By passage 3, native HLA-G expression was absent in MSCs, although other candidate markers remained unchanged. HLA-G expression was not altered in Jeg-3 cells. MSCs were then isolated based on expression of cell surface HL A-G using FACS and found that between 0.5-3% of MSCs expressed HLA-G at the cell surface. To assess the ability of HLA-G MSCs to escape donor rejection in vivo, 1 -3 xl0 J cells were injected into the tail veins of immunocompetent mice.
  • AH tissue culture reagents were from Life Technologies unless otherwise specified.
  • ESC growth medium contains DMEM/F I2 (1 : 1) supplemented with 20% knockout serum replacement, 0.1 mM MEM non-essential amino acids, 1 mM GlutaMax, 0.1 mM
  • ESC growth medium was conditioned by plating mitotically inactivated mouse embryonic fibroblasts (MEFs) (CF-1, ATCC) at a density of 5x1 (f cells/cm and incubating for 18-24 hours. After conditioning, 4 ng/ml bFGF was added and complete conditioned medium was sterile filtered. hESCs was subcultivated every 5-6 days (1 :3 or 1 :4 split) on Matrigel-coated plates using 1 mg/ml Dispase to remove cell colonies. Kl4 p63 1" hEEPs were generated according to the method of Metallo et ai supra.
  • hESCs were cultured in 6-well plates for 4 days and then treated with 2 ml/well of differentiation medium, comprised of unconditioned hESC growth medium containing 1 ⁇ all-trans retinoic acid (Sigma) and 25 ng/ml BMP4, After daily medium changes for 7 days, cells were treated with dispase, centrifuged, and resuspended in defined keratinocyte serum- free medium (DFSM) and seeded on gelatin-coated plates at a split ratio of 1 :3. DSFM is changed every other day for 3-4 weeks.
  • DFSM defined keratinocyte serum- free medium
  • HLA-G transgene in differentiated hEEPs was confirmed by flow cytometry. Both HLA-G total expression and surface expression was robust for differentiated eHLA-G(EF- 1 a)-GFP-hEEPs (greater than 90% of cells) as compared to control cells with no exogenous HLA-G (GFP only hEEPs) and wild-type hEEPs (see Figure 17). Only clones that yield a similar differentiation potential as wildtype ceils were selected for further study.
  • a novel HLA-G construct was designed by combining multiple modifications: 1 ) mutation of HLA-G's ER retrieval motif (K334A/K335A); and 2) mutation of HLA-G's 3' IJTR microRNA binding sites. Since viral gene delivery systems remain a serious regulatory challenge, the PiggyBac system was used, a transposon-based, nonviral approach that was recently shown to achieve a 90% transfection efficiency in HI hESCs (Lacoste et al (2009), Cell Stem Cell, 5:332-342.). This system requires a donor plasmid containing the transposon (Fig. 1A) and a helper plasmid expressing the transposase (Fig. 2).
  • the ePiggyBac codon humanized transposase cDNA was custom synthesized (GeneArt) and then cloned in pBluescript (Stratagene) downstream of a PGK promoter and upstream of an SV40 polyadenylation signal sequence (pA).
  • pA polyadenylation signal sequence
  • multiple promoters were compared including the M-U3/R promoter, MSCV promoter, and the Chinese hamster EFl (CHEF- la) promoter, ihe sequence of which is provided below as SEQ ID NO:6.
  • T53C/C136T mutant 5' terminal repeat (TR) of 313 bp and 3' TR of 235 bp was custom synthesized and cloned upstream and downstream, respectively, of the following expression cassette: eHLA-G, a 250 bp chicken ⁇ -globin HS4 core insulator (Recillas-Targa et al (2002), PNAS USA, 99:6883- 6888), EGFP, and pA.
  • HS4 was used to prevent spreading of repressive chromatin into the integrated construct.
  • EGFP expression was driven by the phosphoglycerate kinase (PGK) promoter (see Fig.
  • the sequence of the HS4 element is shown below as SEQ ID NO:7.
  • SEQ ID NO: 7 one embodiment of the HSF element GAGCTCACGGGGACAGCCCCCCCCCAAAGCCCCCAGGGATGTAATTACGTCCCT CCCCCGCTAGGGGGCAGCAGCGAGCCGCCCGGGGCTCCGCTCCGGTCCGGCGCT CCCCCCGCATCCCCGAGCCGGCAGCGTGCGGGGACAGCCCGGGCACGGGGAAGG TGGCACGGGATCGCTTTCCTCTGAACGCTTCTCGCTGCTCTTTGAGCCTGCAGAC
  • the empty vector donor piasmid (HLA-G " ) was identical to the eHLA-G donor piasmid except the eHLA-G construct is excluded (Fig, IB).
  • IxESCs Prior to gene transfer, IxESCs were treated for 1 hr with 10 ⁇ Y-27632, a ROCK inhibitor shown to substantially reduce dissociation-induced apoptosis and increases cloning efficiency (Watanabe et al (2007), Nat Biotechnol, 25:681 -686, liESCs were dissociated in 0.25% tr psin-EDTA at 37°C for five minutes, washed in conditioned m ' T ' eSR medium plus Y-27632, and resuspended in nucleofection solution L (Amaxa).
  • eHLA-G transfection efficiency was determined by plating transfected cells in CM plus Y-27632 at 2 x 10 ' cells per 6 cm dish for 24 hours, then changed to CM alone. Medium was then changed daily for seven days, and colonies were evaluated by live cell staining and immunofluorescence microscopy, as discussed in Example 5, For each clone, three high power fields were counted and the percentage of reporter proteinVeHLA-G 1" hESCs was calculated. Results of this experiment are shown in Figs 3-4. The eHLA-G insertion site was determined using a piasmid rescue strategy as described in Lacoste et al supra. Briefly, genomic DNA was isolated from transgenic JxESC clones and digested with
  • Live ceil staining was used to detect cell surface HLA class la, HLA-E, eHLA-G, and HLA class 11 expression in transgenic versus wildtype hESCs and hEEPs. Briefly, cells were harvested and washed in cold PBS, stained with the corresponding 1° mAb in PBS containing 10% goat serum and 3% BSA for 60 min at 4°C, washed, fixed with 1% paraformaldehyde for 10 min, and subsequently stained with a goat anti-mouse IgG conjugated with FITC for 30 minutes at 4°C. Control aliquots w stained with an isotype- matched IgG to evaluate nonspecific binding to target cells.
  • Each antibody (MEMG/9 for HLA-G, MEM-E/08 for HLA-E, Bu8 for HLA class la, and HKB 1 (Abbiotec, San Diego, CA) for HLA class H) was first tested at several dilutions in order to determine the optimal conditions for achieving specific-only binding. After staining, cells were smeared on a glass slide, allowed to air dry, and then mounted with anti-fade media containing DAPI (Vector Laboratories). Slides were observed immediately under a Leica CTR65G0 fluorescence microscope.
  • HLA-A,B,C; HLA-E, HLA-DP, DQ, DR, and ⁇ -microgiobulm were similar in wildtype and eHLA-G modified hitman ES ceils, whereas an approximately seven- fold higher level of HLA-G expression was observed in the eHLA-G modified human ES cells.
  • eHLA-G-expressing hESCs were cultured and differentiated into hEEPs as described in Example 2.
  • NK-92 cells CL-2407, American Type Culture Collection, Manassas, VA
  • a-MEM Minimum Essential Medium A lpha Medium
  • FBS 12.5% FBS
  • horse serum 12.5%
  • 0.2 mM inositol 0.1 mM ⁇ - mercaptoethanol
  • 0,02 mM folic acid 100 lU/mi recombinant IL-2. (Sigma) at 37 °C in a 5% C0 2 humidified incubator.
  • Cytotoxicity was performed using a CytoTox96 Non-Radioactive Cytotoxicity Assay Kit (Promega, Madison, WI) as the protocol instructed. Briefly, effector ceils were mixed with 5x 10 3 target ceils at various NK-92 (Effector or "E") to hESCs or hEEPs (target or "T”) E:T cell ratios in U-bottom 96 well plates (Costar, Cambridge, MA). After 4 h at 37 °C in a humidified 5% C0 2 incubator, 50 ⁇ of the supernatant was collected to determine the LDH release. Target cell spontaneous release and maximal release of LDH and the effector cell spontaneous release of LDH were determined by incubating these cells in medium alone.
  • Fig. 1 1 As shown in Fig. 1 1 , at an E:T ratio of 1 : 10, killing of eHLA-G expressing hESCs was reduced by over 50% relative to wildtype cells expressing GFP alone. At an E:T of 1 :30, killing of eHLA-G expressing hESCs was reduced by approximately 75%. Wildtype hESCs are killed at a reasonable rate as shown for both E:T ratios (GFP alone).
  • NK cytotoxicity experiments were also conducted on hEEPs differentiated from hESCs. As shown in Figure 19, killing of eHLA(EF-la)-GFP-hEEPs differentiated from eHLA(EF- 1 a)-GFP-hESCs was reduced well more than 100% (about 3-fold) as compared to control hEEPs. This data shows that eHLA(EF- 1 a)-GFP transgene is stable and persistent throughout the process of differentiation, and that HLA-G expression is able to impart immunosuppressive and/or reduced immunogenicity characteristics in differentiated cells.
  • Example 7 Determination of the immunoge city of c-HLA-G ' ' Cells in Vivo by
  • NSG mice females at six weeks of age were purchased from Jackson Laboratory and handled in accordance with the guidelines of the institutional Animal Care and Use Committee and the recommendations in the Guide for the Care and Use of Laboratory Animals (Institute of Laboratory Animal Resources, National Research Council, National Academy of Sciences).
  • Functional humanized NSG mice were generated by intravenous injection of about 20 x 10 6 human PBMCs into NSG mice according to (Pearson et al (2008), Curr Protoc Immunol, Ch. 15: Unit 15.21 ; and King et al supra). Engraftment was verified at about four weeks by collecting blood from the retroorbital venous plexus of anesthetized mice using EDTA-coated capillary tubes
  • hJBSCs can be decontaminated of NeuSGc using two approaches: 1) culturing in TeSRl media supplemented with bFGF, LiCl, GABA, and pipecolic acid on human matrix coated plates according to the method of Ludwig ei al (2006), Nat Bioteehnol, 24: 185-187, and 2) KSR replacement by heat-inactivated blood group AB Rh " human serum (Heiskanen et al (2007), Stem Cells, 25: 197-202.
  • hESCs cultured under both methods can be assessed by incubation with anti-Neu5Gc mAb and analyzed by flow cytometry.
  • the second approach may be adopted, as the method of Ludwig et al may require hESC adaptation.
  • hEEPs are cultured in DFSM that lacks animal derivatives per its manufacturer.
  • the objective of performing allografts with HLA-G modified cells is to assess whether HLA-G expression reduces immunogenicity as indicated by an increase in tumor size. Prior to transplantation, the intended injection site was shaved to facilitate clinical observation. Animal guidelines including appropriate use of anesthesia were followed at all times. 5 x 10° transgenic eHLA-G 1" and HLA-G " hESCs were resuspended in 100 ⁇ of the appropriate media containing India ink to mark the injection site. This facilitates histological assessment should insufficient fluorescence be observed.
  • the GO hESCs formed a tumor with a volume of 126.9 cubic millimeters and a weight of 32 milligrams.
  • the mGl(#l) hESCs formed a tumor with a volume of 748.4 cubic millimeters and a weight of 318 milligrams.
  • the mGl (#2) hESCs formed a tumor with a volume of 11 16.7 cubic millimeters and a weight of 675 milligrams.
  • Figure 21 shows the averaged results of tumors from hESC allografts onto five humanized NSG mice.
  • the data shows that HLA-G nucleofected hESCs ("mGl") formed much larger (more than 3-fold by volume) and heavier (more than 2-fold by weight) tumors than wild-type hESCs ("GO”) transplanted into humanized NSG mice.
  • mGl HLA-G nucleofected hESCs
  • GO wild-type hESCs
  • allografts in humanized mice can be monitored using a Spectrum In Vivo Imaging System (Caliper, Mountain View, CA) with a 620 nm emission filter and 2.5 second exposure time. At wavelengths of 620 nm or greater, the autofluorescence experienced with GFP is eliminated and signal can be detected as deep as 2.5 cm beneath the surface of the skin (Shaner et al (2004), Nat Biotechnol, 22: 1567-1572). Mice are longitudinally imaged and weighed on a weekly basis. If no signal is observed during the four week period, mice are sacrificed and the injected thoracic mammary fat pad is assessed histologically using fluorescence microscopy to detect the fluorescent reporter protein used.
  • Example 8 except that ceils are transplanted into non-humanized NSG mice. A total of 14 mice are monitored using longitudinal fluoresceni live animal imaging and weight assessment on a monthly basis for up to the earlier of nine months or meeting euthanasia criteria. Mice are then sacrificed and the injected thoracic mammar '- gland harvested in 4% neutral-buffered paraformaldehyde. Fixed tissue is transferred to 70% ethanol and embedded in paraffin. Sections are stained with hematoxylin and eosin and processed for fluorescent reporter protein microscopy. If the tissue sections are found to be reporter protein-negative, they will are stained using niAbs specific to human ⁇ 2 microglobulin and CD45, with the latter serving to ensure the presence of non-PBMCs at the injection site.
  • the eHLA-0(EF- 1 o)-GFP transgene and control constructs were transfected into human newborn dermal fibroblasts (a cell-type that is already fully differentiated) using nucleofection.
  • Human newborn dermal fibroblast cells (HFD) were purchased from ATCC and cultured in Iscove's Modified Dulbecco's Medium (IMDM) (ATCC) siEpplemenied with 10% FBS and 1% PS (Invitrogen). When the cells reached 80% confluence, cells were harvested by incubating with 0.25% Trypsin-EDTA (Invitrogen) for 3 minute at 37°C.
  • Stable GFP-positive cells were maintained in 500 ng/ml puromycin and HLA-G and GFP expression were detected with flow cytometry.
  • Stable transfectants were maintained in culture for use in peripheral blood mononuclear cell (PBMC) proliferation assays and NK-92 cytotoxicity assays as described below.
  • PBMC peripheral blood mononuclear cell
  • PBMC proliferation assays Human dermal fibroblasts stably transfected with the eHLA-G(EF- 1 a)-GFP transgene ("HFD-ml-GFP” cells) or GFP-aione control construct ("HFD-GO-GFP” cells) were assessed for their ability to inhibit PBMC proliferation. HFD- G0-GFP and -mGl-GFP cells were inactivated with Mitomycin C (10 ⁇ for 2.5 h) and seeded at 3.0xl0 3 /weil in 96-well plate and allowed to adhere for 24 h. ixlO 3 PBMC in the presence of 6 ug/ml PHA were added in triplicates in the corresponding HFD cells.
  • HFD- GO-GFP and -mGl -GFP cells alone were included for MTT-OD correction.
  • ⁇ ' is a pale yellow substrate reagent that is cleaved by living cells to yield a dark blue formazan product. This process requires active mitochondria, and even freshly dead cells do not cleave significant amounts of MTT. MTT therefore provides a colorimetric assay that can be used for either proliferation or cytotoxicity assays.
  • PBMC without PHA and PBMC with 6 ,ug/ml of PHA were included as controls.
  • PBMC- proliferation was estimated using MTT reagent using the following formula: % PBMC proliferation - [(OD570 of HFD/PBMC/PHA - OD570 of HFD)/ (OD570 of PBMC/PHA)] x 10.
  • % PBMC proliferation - [(OD570 of HFD/PBMC/PHA - OD570 of HFD)/ (OD570 of PBMC/PHA)] x 10.
  • the HFD-mGl -GFP clone "mGl-Rl" suppressed PBMC proliferation greater than controls and other clones, indicating ihai exogenous HLA-G expression can provide immunosuppression and/or reduced immunogenicity for differentiated cells, such as fibroblasts.
  • NK-92 cytotoxicity Assays were performed substantially as described previously. Briefly, 2.5xl0 3 target cells (i.e., HFD-ml-GFP cells or HFD-G0-GFP cells) were incubated with NK-92 cells at 3 : 1 , 10: 1 , 30: 1 E:T ratio in CTL media for 7 hr. K562- WT cells were included as positive control for NK-92 cytotoxicity. Cytotoxicity was determined with a CytoTox96 cytotoxicity assay kit.
  • % specific lysis [(experimental LDH release - effector spontaneous release - target spontaneous release)/ (target maximum release - target spontaneous release)] x 100.
  • Table 4 the HFD-mGl -GFP clones “mGl-Rl” and “mGl suppressed NK-92 cytotoxicity greater than controls and other clones, indicating ihai exogenous HLA-G expression can provide immunosuppression and/or decreased immunogenicity for differentiated cells, such as fibroblasts.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Chemical & Material Sciences (AREA)
  • Immunology (AREA)
  • Biomedical Technology (AREA)
  • Cell Biology (AREA)
  • Zoology (AREA)
  • General Health & Medical Sciences (AREA)
  • Biotechnology (AREA)
  • Medicinal Chemistry (AREA)
  • Organic Chemistry (AREA)
  • Animal Behavior & Ethology (AREA)
  • Developmental Biology & Embryology (AREA)
  • Genetics & Genomics (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Virology (AREA)
  • Molecular Biology (AREA)
  • Biochemistry (AREA)
  • Epidemiology (AREA)
  • Hematology (AREA)
  • Wood Science & Technology (AREA)
  • Microbiology (AREA)
  • Urology & Nephrology (AREA)
  • Environmental Sciences (AREA)
  • General Engineering & Computer Science (AREA)
  • Biophysics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Physics & Mathematics (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Food Science & Technology (AREA)
  • Analytical Chemistry (AREA)
  • Pathology (AREA)
  • General Physics & Mathematics (AREA)
  • Reproductive Health (AREA)
PCT/US2013/052767 2012-07-31 2013-07-30 Hla g-modified cells and methods Ceased WO2014022423A2 (en)

Priority Applications (19)

Application Number Priority Date Filing Date Title
EP18211100.5A EP3483178B1 (en) 2012-07-31 2013-07-30 Methods to produce hla-g-modified cells
KR1020187034048A KR102055438B1 (ko) 2012-07-31 2013-07-30 Hla g-변형된 세포 및 방법
KR1020157005165A KR101923632B1 (ko) 2012-07-31 2013-07-30 Hla g-변형된 세포 및 방법
AU2013296564A AU2013296564C1 (en) 2012-07-31 2013-07-30 HLA G-modified cells and methods
EP13825511.2A EP2880054B1 (en) 2012-07-31 2013-07-30 Hla g-modified cells and methods
SG11201500799YA SG11201500799YA (en) 2012-07-31 2013-07-30 Hla g-modified cells and methods
ES13825511T ES2716577T3 (es) 2012-07-31 2013-07-30 Células HLA-G modificadas y métodos
KR1020197036122A KR102184947B1 (ko) 2012-07-31 2013-07-30 Hla g-변형된 세포 및 방법
EP20196775.9A EP3805261A1 (en) 2012-07-31 2013-07-30 Hla-g transfected cells and their use in treating diabetes
JP2015525519A JP6297559B2 (ja) 2012-07-31 2013-07-30 Hlag改変された細胞および方法
CN201380051169.3A CN105612176B (zh) 2012-07-31 2013-07-30 Hla g修饰的细胞及方法
CA2882028A CA2882028C (en) 2012-07-31 2013-07-30 Human leukocyte antigen-g (hla-g) modified cells and methods
EP21209423.9A EP4015530A1 (en) 2012-07-31 2013-07-30 Hla-g transfected cells and their use in treating diabetes
KR1020207033804A KR102366081B1 (ko) 2012-07-31 2013-07-30 Hla g-변형된 세포 및 방법
US14/608,004 US9714280B2 (en) 2012-07-31 2015-01-28 HLA G-modified cells and methods
US15/625,964 US10502738B2 (en) 2012-07-31 2017-06-16 HLA G-modified cells and methods
AU2018220087A AU2018220087B2 (en) 2012-07-31 2018-08-23 Hla g-modified cells and methods
US16/659,918 US11977073B2 (en) 2012-07-31 2019-10-22 HLA G-modified cells and methods
US16/832,321 US20200309776A1 (en) 2012-07-31 2020-03-27 Hla g-modified cells and methods

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201261677739P 2012-07-31 2012-07-31
US61/677,739 2012-07-31

Related Child Applications (1)

Application Number Title Priority Date Filing Date
US14/608,004 Continuation US9714280B2 (en) 2012-07-31 2015-01-28 HLA G-modified cells and methods

Publications (3)

Publication Number Publication Date
WO2014022423A2 true WO2014022423A2 (en) 2014-02-06
WO2014022423A3 WO2014022423A3 (en) 2014-04-03
WO2014022423A9 WO2014022423A9 (en) 2015-09-03

Family

ID=50028654

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2013/052767 Ceased WO2014022423A2 (en) 2012-07-31 2013-07-30 Hla g-modified cells and methods

Country Status (10)

Country Link
US (4) US9714280B2 (https=)
EP (4) EP3483178B1 (https=)
JP (4) JP6297559B2 (https=)
KR (4) KR102366081B1 (https=)
CN (2) CN113151179A (https=)
AU (2) AU2013296564C1 (https=)
CA (1) CA2882028C (https=)
ES (2) ES2716577T3 (https=)
SG (1) SG11201500799YA (https=)
WO (1) WO2014022423A2 (https=)

Cited By (13)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2017218714A1 (en) * 2016-06-14 2017-12-21 Regents Of The University Of Minnesota Genetically modified cells, tissues, and organs for treating disease
WO2018227286A1 (en) * 2017-06-12 2018-12-20 Sinai Health System Allograft tolerance without the need for systemic immune suppression
US10278372B2 (en) 2014-12-10 2019-05-07 Regents Of The University Of Minnesota Genetically modified cells, tissues, and organs for treating disease
WO2020120666A1 (en) 2018-12-14 2020-06-18 Promethera Biosciences S.A./N.V. Liver progenitor cells expressing hla-g, and method for obtaining these cells compositions comprising said cells and their use
US10765704B2 (en) * 2014-11-26 2020-09-08 Accelerated Biosciences Corp. Induced hepatocytes and uses thereof
EP3805261A1 (en) 2012-07-31 2021-04-14 AgeX Therapeutics, Inc. Hla-g transfected cells and their use in treating diabetes
WO2021162731A1 (en) * 2020-02-10 2021-08-19 Rubius Therapeutics, Inc. Engineered erythroid cells including hla-g polypeptides and methods of use thereof
US20220241345A1 (en) * 2015-10-02 2022-08-04 The Regents Of The University Of California Induced pluripotent stem cell derived glial enriched progenitor cells for the treatment of white matter stroke
US11813318B2 (en) 2011-04-20 2023-11-14 University Of Washington Beta-2 microglobulin-deficient cells
US11866480B2 (en) 2016-07-26 2024-01-09 The University Of North Carolina At Chapel Hill Vector-mediated immune tolerance in the eye
US12365874B2 (en) 2020-01-28 2025-07-22 Immunitybio, Inc. Chimeric antigen receptor-modified NK-92 cells targeting EGFR super-family receptors
US12544406B2 (en) 2015-10-02 2026-02-10 The Regents Of The University Of California Induced pluripotent stem cell derived glial enriched progenitor cells for the treatment of white matter stroke
US12584138B2 (en) 2018-08-01 2026-03-24 Immunitybio, Inc. Quadricistronic system comprising a homing receptor and chimeric antigen receptor for stable genetic modification of cellular immunotherapies

Families Citing this family (13)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10927384B2 (en) 2014-04-09 2021-02-23 Dna Twopointo Inc. DNA vectors, transposons and transposases for eukaryotic genome modification
US9534234B2 (en) 2014-04-09 2017-01-03 Dna2.0, Inc. Enhanced nucleic acid constructs for eukaryotic gene expression
CA3001312A1 (en) 2015-10-08 2017-04-13 Dna2.0, Inc. Dna vectors, transposons and transposases for eukaryotic genome modification
JP7717439B2 (ja) 2017-01-10 2025-08-04 ザ ジェネラル ホスピタル コーポレイション 修飾されたt細胞及びその使用方法
US20210061914A1 (en) * 2017-12-28 2021-03-04 Gritstone Oncology, Inc. Antigen-Binding Proteins Targeting Shared Antigens
US10883084B2 (en) 2018-10-05 2021-01-05 Xenotherapeutics, Inc. Personalized cells, tissues, and organs for transplantation from a humanized, bespoke, designated-pathogen free, (non-human) donor and methods and products relating to same
BR112021011273A2 (pt) * 2018-12-14 2021-09-28 Promethera Therapeutics Sa Composição celular que compreende células progenitoras do fígado que expressam hla-e
EP4159846A4 (en) * 2020-05-26 2024-08-14 Healios K.K. HYPOIMMUNOGENIC CELLS
EP4200023A4 (en) * 2020-08-23 2024-10-30 Applied StemCell, Inc. Hla-f-modified cells and methods
US11591381B2 (en) 2020-11-30 2023-02-28 Crispr Therapeutics Ag Gene-edited natural killer cells
WO2022144632A1 (en) 2020-12-30 2022-07-07 Crispr Therapeutics Ag Compositions and methods for differentiating stem cells into nk cells
CN113234664B (zh) * 2021-05-11 2024-05-10 澳门大学 一种胰腺祖细胞的制备方法及其应用
IL311786A (en) * 2021-10-21 2024-05-01 Vertex Pharma hypoimmune cells

Family Cites Families (33)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CA1339354C (en) 1988-09-01 1997-08-26 The Whitehead Institute For Biomedical Research Recombinant retroviruses with amphotropic and ecotropic host ranges
US5464764A (en) 1989-08-22 1995-11-07 University Of Utah Research Foundation Positive-negative selection methods and vectors
US5534423A (en) 1993-10-08 1996-07-09 Regents Of The University Of Michigan Methods of increasing rates of infection by directing motion of vectors
US6686198B1 (en) 1993-10-14 2004-02-03 President And Fellows Of Harvard College Method of inducing and maintaining neuronal cells
US6013517A (en) 1994-05-09 2000-01-11 Chiron Corporation Crossless retroviral vectors
US5650135A (en) 1994-07-01 1997-07-22 The Board Of Trustees Of The Leland Stanford Junior University Non-invasive localization of a light-emitting conjugate in a mammal
US5843780A (en) 1995-01-20 1998-12-01 Wisconsin Alumni Research Foundation Primate embryonic stem cells
US5741657A (en) 1995-03-20 1998-04-21 The Regents Of The University Of California Fluorogenic substrates for β-lactamase and methods of use
US5744320A (en) 1995-06-07 1998-04-28 Promega Corporation Quenching reagents and assays for enzyme-mediated luminescence
US6982431B2 (en) 1998-08-31 2006-01-03 Molecular Devices Corporation Sample analysis systems
US6031094A (en) 1998-07-23 2000-02-29 The Regents Of The University Of California Beta-lactam substrates and uses thereof
US7005252B1 (en) 2000-03-09 2006-02-28 Wisconsin Alumni Research Foundation Serum free cultivation of primate embryonic stem cells
IL158514A0 (en) 2001-04-23 2004-05-12 Amaxa Gmbh Buffer solution for electroporation and a method comprising the use of the same
WO2004098490A2 (en) 2002-05-17 2004-11-18 Mount Sinai School Of Medicine Of New York University Mesoderm and definitive endoderm cell populations
EP1594962B1 (en) 2003-01-31 2014-08-27 Promega Corporation Covalent tethering of functional groups to proteins
US7960166B2 (en) 2003-05-21 2011-06-14 The General Hospital Corporation Microfabricated compositions and processes for engineering tissues containing multiple cell types
PL1675956T3 (pl) * 2003-10-21 2011-06-30 Merck Serono Sa Minimalna sekwencja DNA działająca jako insulator chromatyny i jej zastosowanie do wyrażania białek
US8673634B2 (en) 2003-11-13 2014-03-18 Massachusetts Eye & Ear Infirmary Method for the treatment of hearing loss
EP1809750B1 (en) 2004-11-08 2012-03-21 ChromaGenics B.V. Selection of host cells expressing protein at high levels
US20070036773A1 (en) * 2005-08-09 2007-02-15 City Of Hope Generation and application of universal T cells for B-ALL
EP1937326B1 (en) * 2005-10-21 2018-09-12 CellResearch Corporation Pte Ltd Isolation and cultivation of stem/progenitor cells from the amniotic membrane of umbilical cord and uses of cells differentiated therefrom
BRPI0619794B8 (pt) 2005-12-13 2022-06-14 Univ Kyoto Uso de um fator de reprogramação, agente para a preparação de uma célula-tronco pluripotente induzida a partir de uma célula somática e métodos para preparar uma célula- tronco pluripotente induzida método e para preparar uma célula somática e uso de células-tronco pluripotentes induzidas
US8278104B2 (en) 2005-12-13 2012-10-02 Kyoto University Induced pluripotent stem cells produced with Oct3/4, Klf4 and Sox2
US20090156532A1 (en) * 2006-01-24 2009-06-18 The University Of Chicago SNP BINDING SITE FOR microRNAs IN HLA-G
WO2007091078A2 (en) * 2006-02-10 2007-08-16 Axordia Limited Polypeptide conjugate comprising hla-g and uses thereof, stem cells transfected with hla-g
EP2374875B1 (en) 2006-10-30 2015-09-02 Promega Corporation Mutant hydrolase proteins with enhanced kinetics and funcitional expression
US8647871B2 (en) * 2007-03-30 2014-02-11 Escape Therapeutics, Inc. Endogenous expression of HLA-G and/or HLA-E by mesenchymal cells
CN102369288A (zh) * 2008-11-14 2012-03-07 生命技术公司 用于工程化细胞的组合物和方法
US8592211B2 (en) 2009-03-20 2013-11-26 The Rockefeller University Enhanced PiggyBac transposon and methods for transposon mutagenesis
US8048675B1 (en) 2010-05-12 2011-11-01 Ipierian, Inc. Integration-free human induced pluripotent stem cells from blood
KR102366081B1 (ko) 2012-07-31 2022-02-23 에이지엑스 쎄라퓨틱스, 인크. Hla g-변형된 세포 및 방법
CN103333861A (zh) * 2013-06-03 2013-10-02 浙江省台州医院 特异性表达hla-g1抗原的细胞株k562
CN111808819A (zh) * 2020-05-26 2020-10-23 台州恩泽医疗中心(集团) 表达hla-g3异构体标准蛋白的细胞株及其应用

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
See references of EP2880054A4 *

Cited By (25)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11813318B2 (en) 2011-04-20 2023-11-14 University Of Washington Beta-2 microglobulin-deficient cells
EP4015530A1 (en) 2012-07-31 2022-06-22 AgeX Therapeutics, Inc. Hla-g transfected cells and their use in treating diabetes
EP3805261A1 (en) 2012-07-31 2021-04-14 AgeX Therapeutics, Inc. Hla-g transfected cells and their use in treating diabetes
US10765704B2 (en) * 2014-11-26 2020-09-08 Accelerated Biosciences Corp. Induced hepatocytes and uses thereof
US10278372B2 (en) 2014-12-10 2019-05-07 Regents Of The University Of Minnesota Genetically modified cells, tissues, and organs for treating disease
US12465029B2 (en) 2014-12-10 2025-11-11 Regents Of The University Of Minnesota Genetically modified cells, tissues, and organs for treating disease
US11234418B2 (en) 2014-12-10 2022-02-01 Regents Of The University Of Minnesota Genetically modified cells, tissues, and organs for treating disease
US10993419B2 (en) 2014-12-10 2021-05-04 Regents Of The University Of Minnesota Genetically modified cells, tissues, and organs for treating disease
US12544406B2 (en) 2015-10-02 2026-02-10 The Regents Of The University Of California Induced pluripotent stem cell derived glial enriched progenitor cells for the treatment of white matter stroke
US20220241345A1 (en) * 2015-10-02 2022-08-04 The Regents Of The University Of California Induced pluripotent stem cell derived glial enriched progenitor cells for the treatment of white matter stroke
WO2017218714A1 (en) * 2016-06-14 2017-12-21 Regents Of The University Of Minnesota Genetically modified cells, tissues, and organs for treating disease
AU2017285224B2 (en) * 2016-06-14 2023-05-18 Regents Of The University Of Minnesota Genetically modified cells, tissues, and organs for treating disease
US11866480B2 (en) 2016-07-26 2024-01-09 The University Of North Carolina At Chapel Hill Vector-mediated immune tolerance in the eye
IL270835B2 (en) * 2017-06-12 2025-01-01 Sinai Health Sys Allograft tolerance without the need for systemic immunosuppression
GB2588249B (en) * 2017-06-12 2023-01-04 Sinai Health Sys Allograft tolerance without the need for systemic immune suppression
GB2588249A (en) * 2017-06-12 2021-04-21 Sinai Health Sys Allograft tolerance without the need for systemic immune suppression
WO2018227286A1 (en) * 2017-06-12 2018-12-20 Sinai Health System Allograft tolerance without the need for systemic immune suppression
IL270835B1 (en) * 2017-06-12 2024-09-01 Sinai Health Sys Allograft tolerance without the need for systemic immune suppression
US12178835B2 (en) 2017-06-12 2024-12-31 Sinai Health System Allograft tolerance without the need for systemic immune suppression
EP3638258A4 (en) * 2017-06-12 2021-09-08 Sinai Health System ALLOGRAFT TOLERANCE WITHOUT REQUIRING SYSTEMIC IMMUNE SUPPRESSION
CN110869494A (zh) * 2017-06-12 2020-03-06 西奈卫生系统公司 无需全身性免疫遏制的同种异体移植物耐受
US12584138B2 (en) 2018-08-01 2026-03-24 Immunitybio, Inc. Quadricistronic system comprising a homing receptor and chimeric antigen receptor for stable genetic modification of cellular immunotherapies
WO2020120666A1 (en) 2018-12-14 2020-06-18 Promethera Biosciences S.A./N.V. Liver progenitor cells expressing hla-g, and method for obtaining these cells compositions comprising said cells and their use
US12365874B2 (en) 2020-01-28 2025-07-22 Immunitybio, Inc. Chimeric antigen receptor-modified NK-92 cells targeting EGFR super-family receptors
WO2021162731A1 (en) * 2020-02-10 2021-08-19 Rubius Therapeutics, Inc. Engineered erythroid cells including hla-g polypeptides and methods of use thereof

Also Published As

Publication number Publication date
JP6502544B2 (ja) 2019-04-17
CN105612176A (zh) 2016-05-25
KR101923632B1 (ko) 2018-12-03
CA2882028C (en) 2023-11-07
ES2837487T3 (es) 2021-06-30
KR102184947B1 (ko) 2020-12-01
WO2014022423A9 (en) 2015-09-03
AU2018220087A1 (en) 2018-09-13
JP2015529457A (ja) 2015-10-08
EP3483178B1 (en) 2020-10-28
AU2018220087B2 (en) 2020-05-14
CN105612176B (zh) 2021-01-19
KR102366081B1 (ko) 2022-02-23
EP3805261A1 (en) 2021-04-14
US20200309776A1 (en) 2020-10-01
US20200041512A1 (en) 2020-02-06
JP7379410B2 (ja) 2023-11-14
EP2880054A2 (en) 2015-06-10
EP3483178A1 (en) 2019-05-15
WO2014022423A3 (en) 2014-04-03
AU2013296564B2 (en) 2018-06-28
US9714280B2 (en) 2017-07-25
JP2021106601A (ja) 2021-07-29
AU2013296564C1 (en) 2019-01-17
US20170292952A1 (en) 2017-10-12
KR20180128096A (ko) 2018-11-30
KR20190139319A (ko) 2019-12-17
US20150158927A1 (en) 2015-06-11
KR20150038467A (ko) 2015-04-08
KR102055438B1 (ko) 2019-12-19
ES2716577T3 (es) 2019-06-13
US10502738B2 (en) 2019-12-10
JP6297559B2 (ja) 2018-03-20
JP7294838B2 (ja) 2023-06-20
EP4015530A1 (en) 2022-06-22
CA2882028A1 (en) 2014-02-06
AU2013296564A1 (en) 2015-02-26
JP2019088334A (ja) 2019-06-13
US11977073B2 (en) 2024-05-07
SG11201500799YA (en) 2015-03-30
CN113151179A (zh) 2021-07-23
KR20200136047A (ko) 2020-12-04
JP2018088929A (ja) 2018-06-14
EP2880054A4 (en) 2016-03-23
EP2880054B1 (en) 2019-01-16

Similar Documents

Publication Publication Date Title
US11977073B2 (en) HLA G-modified cells and methods
US20230272429A1 (en) Modification of blood type antigens
HK40066059A (en) Hla-g transfected cells and their use in treating diabetes
HK40008748A (en) Methods to produce hla-g-modified cells
HK40008748B (en) Methods to produce hla-g-modified cells

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 13825511

Country of ref document: EP

Kind code of ref document: A2

ENP Entry into the national phase

Ref document number: 2015525519

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2882028

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2013296564

Country of ref document: AU

Date of ref document: 20130730

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 2013825511

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 20157005165

Country of ref document: KR

Kind code of ref document: A

121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 13825511

Country of ref document: EP

Kind code of ref document: A2