WO2014009209A2 - Immunoregulatory vaccine - Google Patents
Immunoregulatory vaccine Download PDFInfo
- Publication number
- WO2014009209A2 WO2014009209A2 PCT/EP2013/063959 EP2013063959W WO2014009209A2 WO 2014009209 A2 WO2014009209 A2 WO 2014009209A2 EP 2013063959 W EP2013063959 W EP 2013063959W WO 2014009209 A2 WO2014009209 A2 WO 2014009209A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- vaccine
- immunogen
- seq
- alpha
- tlr9
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/39—Medicinal preparations containing antigens or antibodies characterised by the immunostimulating additives, e.g. chemical adjuvants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0003—Invertebrate antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0008—Antigens related to auto-immune diseases; Preparations to induce self-tolerance
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/001—Preparations to induce tolerance to non-self, e.g. prior to transplantation
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
- A61K39/001102—Receptors, cell surface antigens or cell surface determinants
- A61K39/001103—Receptors for growth factors
- A61K39/001104—Epidermal growth factor receptors [EGFR]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
- A61K39/001102—Receptors, cell surface antigens or cell surface determinants
- A61K39/001103—Receptors for growth factors
- A61K39/001106—Her-2/neu/ErbB2, Her-3/ErbB3 or Her 4/ErbB4
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
- A61K39/00113—Growth factors
- A61K39/001131—Epidermal growth factor [EGF]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
- A61K39/001136—Cytokines
- A61K39/001141—Interferons [IFN]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
- A61K39/001166—Adhesion molecules, e.g. NRCAM, EpCAM or cadherins
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
- A61K39/001169—Tumor associated carbohydrates
- A61K39/00117—Mucins, e.g. MUC-1
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
- A61K39/00118—Cancer antigens from embryonic or fetal origin
- A61K39/001181—Alpha-feto protein
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
- A61K39/00118—Cancer antigens from embryonic or fetal origin
- A61K39/001182—Carcinoembryonic antigen [CEA]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/35—Allergens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/35—Allergens
- A61K39/36—Allergens from pollen
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/04—Drugs for disorders of the alimentary tract or the digestive system for ulcers, gastritis or reflux esophagitis, e.g. antacids, inhibitors of acid secretion, mucosal protectants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P13/00—Drugs for disorders of the urinary system
- A61P13/12—Drugs for disorders of the urinary system of the kidneys
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/04—Anorexiants; Antiobesity agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/04—Antibacterial agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/10—Antimycotics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/04—Immunostimulants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/08—Antiallergic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/555—Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
- A61K2039/55511—Organic adjuvants
- A61K2039/55516—Proteins; Peptides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/555—Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
- A61K2039/55511—Organic adjuvants
- A61K2039/55561—CpG containing adjuvants; Oligonucleotide containing adjuvants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/57—Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2
- A61K2039/577—Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2 tolerising response
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/60—Medicinal preparations containing antigens or antibodies characteristics by the carrier linked to the antigen
- A61K2039/6031—Proteins
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/64—Medicinal preparations containing antigens or antibodies characterised by the architecture of the carrier-antigen complex, e.g. repetition of carrier-antigen units
Definitions
- the invention refers to an immunoregulatory vaccine comprising an immunogen and a directed adjuvant linked thereto, thereby modulating the immune response to the immunogen.
- the invention further refers to a vaccine comprising an immunogenic composition comprising
- directed adjuvant comprising at least an anti-CD32 moiety linked to a TLR9 ligand
- an immunogen which is bound to the directed adjuvant, for use in treating a subject for eliciting a transient IgG immune response directed to the immunogen.
- Th1 cells are characterized by the production of proinflammatory cytokines like IFN- ⁇ , IL-2, and TNF- ⁇ . Th1 cells are involved in cell- mediated immunity. The cytokines produced by Th1 cells stimulate the phagocytosis and destruction of microbial pathogens. Several chronic inflammatory diseases have been described as Th1 dominant diseases i.e. multiple sclerosis, diabetes, and rheumatoid arthritis.
- Th2 cells Type 2 helper T cells are characterized by the production of IL-4, 5, IL-9, IL-10, and IL-13. Th2 cells are thought to play a role in allergy responses.
- Cytokines like IL-4 generally stimulate the production of antibodies.
- IL-5 stimulates eosinophil responses, also part of the immune response. Atopy and allergy are thought to be Th2 dominant conditions.
- Th1/Th2 or Th17 Treg immunity becomes the cause of various immune diseases.
- Allergens are antigens to which atopic patients respond with IgE antibody responses subsequently leading to allergic reactions.
- Antigens in the complexes or fusion proteins can be environmental allergens (e.g. house dust mite, birch pollen, grass pollen, cat antigens, cockroach antigens), or food allergens (e.g. cow milk, peanut, shrimp, soya), or a combination of both.
- IgE molecules are important because of their role in effector cell (mast cell, basophiles and eosinophiles) activation.
- IgE also plays an important role in the induction phase of allergic diseases, by up-regulating the antigen capture potential of B cells and dendritic cells (DC), both through low affinity (CD23) and high affinity receptors (FcsRI).
- the negative functions of IgE antibodies can be counteracted by allergen specific IgG antibodies, e.g. because they direct the immune response away from B cells to monocytes and DC and they are able to down regulate IgE receptor mediated activation of effector cells through co-cross linking the FcsRI with FcyRllb (CD32b) on these cells.
- FcsRI FcyRllb
- Allergies therefore can be treated, cured and prevented by the induction of allergen specific IgG molecules especially lgG1 .
- IgG molecules have a serum ha If- life of approximately 3 weeks as compared to roughly 3 days for IgE molecules.
- IgE molecules are induced by the interaction between (na ' ive) B cells and Th2 cells which provide the IL-4 and IL-13 together with CD40L expression necessary to induce a class switch to IgE in memory B cells and plasma cells.
- Th1 cells which produce IFN- ⁇ and IL-2, induce a class switch to IgG. Therefore, induction of Th1 , rather than Th2 helper T cell responses against allergens, is beneficial for the prevention, treatment and cure of allergic diseases.
- allergens which depend on frequent immunizations with relatively high concentrations of allergens.
- This technique is only moderately effective in a minority of allergic diseases such as bee venom allergy and in some cases of rhinitis and conjunctivitis, and recently some reports have shown
- WO2007098934A1 describes molecules capable of binding to TLR9 and to CD32 comprising at least one epitope of at least one antigen, its production and its use as medicament, especially for the treatment of allergies.
- Immunoregulation may work not only in the case of allergic diseases, but also in a series of other diseases.
- Enhancing the immune response to infectious agents is the goal of prophylactic or therapeutic anti-infectious immunotherapy.
- Th1 tumor antigen specific T helper type 1 cells in addition to cytotoxic T lymphocytes (CTL).
- CTL cytotoxic T lymphocytes
- Cancer known medically as a malignant neoplasm is a broad group of various diseases, all involving unregulated cell growth.
- cells divide and grow uncontrollably, forming malignant tumors, and invade nearby parts of the body. The cancer may also spread to more distant parts of the body through the lymphatic system or bloodstream. Not all tumors are cancerous. Benign tumors do not grow uncontrollably, do not invade neighboring tissues, and do not spread throughout the body.
- There are over 200 different known cancers that afflict humans. Determining what causes cancer is complex. Many things are known to increase the risk of cancer, including tobacco use, certain infections, radiation, lack of physical activity, obesity, and environmental pollutants. These can directly damage genes or combine with existing genetic faults within cells to cause the disease. Approximately five to ten percent of cancers are entirely hereditary.
- Cancer can be detected in a number of ways, including the presence of certain signs and symptoms, screening tests, or medical imaging. Once a possible cancer is detected it is diagnosed by microscopic examination of a tissue sample. Cancer is usually treated with chemotherapy, radiation therapy and surgery. The chances of surviving the disease vary greatly by the type and location of the cancer and the extent of disease at the start of treatment. While cancer can affect people of all ages, and a few types of cancer are more common in children, the risk of developing cancer generally increases with age. In 2007, cancer caused about 13% of all human deaths worldwide (7.9 million). Rates are rising as more people live to an old age and as mass lifestyle changes occur in the developing world.
- the immune system Since the immune system responds to the environmental factors it encounters on the basis of discrimination between self and non-self, many kinds of tumor cells that arise as a result of the onset of cancer are more or less tolerated by the patient's own immune system since the tumor cells are essentially the patient's own cells that are growing, dividing and spreading without proper regulatory control.
- Immune tolerance or immunological tolerance is the process by which the immune system does not attack an antigen. In natural or self-tolerance, the body does not mount an immune response to self-antigens. It occurs in three forms: central tolerance, peripheral tolerance and acquired tolerance
- T and B lymphocytes that recognize self -antigens are deleted before they develop into fully immunocompetent cells, preventing
- Peripheral tolerance is immunological tolerance developed after T and B cells mature and enter the periphery.
- the T cells that leave the thymus are relatively but not completely safe. Some will have receptors (TCRs) that can respond to self-antigens that are present in such high concentration that they can bind to "weak" receptors the T ceil did not encounter in the thymus (such as, tissue-specific molecules like those in the islets of Langerhans, brain or spinal cord). Those self-reactive T cells that escape intrathymic negative selection in the thymus can inflict cell injury unless they are deleted or effectively muzzled in the peripheral tissue.
- TCRs receptors
- Those self-reactive T cells that escape intrathymic negative selection in the thymus can inflict cell injury unless they are deleted or effectively muzzled in the peripheral tissue.
- Several feedback mechanism to silence such potentially auto reactive T cells are known to exist. They include following: Anergy, Activation-induced cell death, Perip
- Acquired or induced tolerance refers to the immune system's adaptation to external antigens characterized by a specific non-reactivity of the lymphoid tissues to a given antigen that in other circumstances would likely induce cell-mediated or humoral immunity.
- One of the most important natural kinds of acquired tolerance is immune tolerance in pregnancy, where the fetus and the placenta must be tolerated by the maternal immune system.
- Cancer immunotherapy is the use of the immune system to reject cancer.
- the main premise is stimulating the patient's immune system to attack the malignant tumor cells that are responsible for the disease. This can be done either through active immunization of the patient (e.g., by administering a cellular cancer vaccine, such as Provenge, Dendreon, Seattle, Washington, US) 4 , in which case the patient's own immune system is trained to recognize tumor cells as targets to be destroyed, or through the administration of therapeutic antibodies as drugs, in which case the patient's immune system is recruited to destroy tumor cells by the therapeutic antibodies.
- TAA's tumor associated antigens
- TAAs are formulated and presented to the body in an immunogenic fashion such that the immune system will build a response despite the fact that these proteins are self. Obviously this approach will only be useful for TAAs against which the patient has developed peripheral or acquired tolerance.
- G17 gastrin 6"9
- G17 gastrin 6"9
- neutralization of G17 may also be beneficial in any gastrin related disease condition, including gastric ulcers, Gastro Esophageal Reflux Disease (GERD) 10 , since the pH of the stomach is regulated by gastrin, and for End Stage Renal Failure (ESRF) 1 , since gastrin circulates at higher than normal concentrations in ESRF patients.
- US5023077 describes immunogenic compositions and methods for the treatment and prevention of gastric and duodenal ulcer disease, which immunogenic compositions are based on gastrin peptides, which are coupled to an immunogenic carrier, such as diptheria toxoid, tetanus toxoid, keyhole limpet hemocyanin or bovine serum albumin.
- an immunogenic carrier such as diptheria toxoid, tetanus toxoid, keyhole limpet hemocyanin or bovine serum albumin.
- Gastrin has several important functions in the gastrointestinal tract, the two most important being stimulation of acid secretion and stimulation of the growth of cells in the gastrointestinal tract.
- the hormone exists in at least two molecular forms, heptadecagastrin, the so-called little gastrin (“G17”), and tetratriacontagastrin (“G34”) named according to the number of amino acid residues ("AA's") in each molecule, wherein the G17 constitutes the 17 amino terminal (“N-terminal”) residues of G34.
- US5609870 describes the preparation of an anti-G17 immunogen which raises antibodies in a mammal against its own G17 which do not react with G34 comprising conjugating a peptide which consists of a sequence corresponding to a fragment of the N-terminal amino acid sequence of G17 up to amino acid residue number 12 by its C- terminus to a spacer peptide which is conjugated to an immunogenic carrier, such as diphtheria toxoid, tetanus toxoid, keyhole limpet hemocyanin, and bovine serum albumin.
- an immunogenic carrier such as diphtheria toxoid, tetanus toxoid, keyhole limpet hemocyanin, and bovine serum albumin.
- Th 1 /Th2 Th 17/Treg cells plays a significant part in the development of immune therapies.
- TLR9 In autoimmune diseases there is a need to regulate the Th1 Th2/Th17/Treg imbalance, i.e. in conditions where the immune system attacks self-tissue.
- TLRs Toll-like receptors
- PAMPs pathogen-associated molecular patterns
- TLRs exhibit different patterns of expression. This gene is preferentially expressed in immune cell rich tissues, such as spleen, lymph node, bone marrow and peripheral blood leukocytes.
- TLRs (named simply TLR1 to TLR13) have been identified in humans and mice together, and equivalent forms of many of these have been found in other mammalian species. However, not every TLR receptor in mice is also found in humans or vice versa. In addition, not for every TLR receptor the ligand and function is known, e.g. TLR10 is orphan receptor with unknown function.
- TLR9 Activation of TLR receptors has been used for the treatment of various diseases e.g activation of TLR9 by pharmaceutical products has been shown to be beneficial in treatment of allergy and oncology.
- TLR9 is expressed by numerous cells of the immune system such as dendritic cells, B lymphocytes, monocytes and natural killer (NK) cells. However in healthy humans the TLR9 is expression is restricted to plasmacytoid dendritic cells (pDCs) and B cells. The expression is intracellular ⁇ , within the endosomal
- TLR9 expression has been reported on the cell surface of cells as well 12"14 .
- TLR9 activating TLR9 activating
- CpG class A in particular CpG-A (D) 15
- ODN oligodeoxynucleotides
- D oligodeoxynucleotides
- TLR9 agonists induce a strong IFNa induction and minimal maturation of dendritic cells, and are herein called “group 1 " TLR9 Sigand.
- An example is ODN2216 16 :
- CpG class B in particular CpG-B (K) 17
- ODN oligodeoxynucleotides
- K oligodeoxynucleotides
- TLR9 agonists induce a weak IFNa induction and maturation of dendritic cells, and are herein called “group 2" TLR9 ligand.
- An example is ODN2006 18 19 :
- CpG class C also known as CpG-C 20
- oligodeoxynucleotides Such TLR9 agonists induce IFNa and maturation of immature dendritic cells, and are herein called "group 3" TLR9 ligand.
- An example is ODNM362 21 :
- TLR9 All of the ligands for TLR9 described to date are based on nucleotides. Although antibodies specific for TLR9 have been reported and used to demonstrate the presence and location of the receptor, these molecules have not been described as ligands for TLR9, there was no report of any TLR9 activating or inhibiting activity.
- CD32 is strongly expressed on monocytes/dendritic cells and B cells and thus such molecules are designed to direct the immune response to these important immunological cells, with the intention to prevent antigen presentation by the B cells, while promoting antigen presentation by especially dendritic cells (DCs), the latter leads to induction of Th1 responses against the antigen, when sufficiently stimulated.
- DCs dendritic cells
- mDC myeloid
- pDC plasmacytoid dendritic cells
- DC1 cells promote the induction of Th1 cell development after antigen specific stimulation
- DC2 cells support the development of Th2 cells.
- Monocyte derived DC (or mDC) are generally considered to be of DC1 type, whereas pDC are considered to be DC2 type. Both types of DC express CD32a and will induce an antigen specific T cell response; however it is not guaranteed that the outcome will be of Th1 type. In fact, in allergic donors Th2 responses are more likely.
- the pDC express the TLR9 receptor, which binds CpG-ODNs (oligodeoxynucleotides (ODNs) containing unmethylated CpG motifs). Activation of this receptor in the pDC leads to a very strong production of IFN-alpha and IL-12, which promotes Th1 induction and thus transforms the potential DC2 into DC1 cells. Thus, such molecules can combine the activation of the TLR9 receptor in pDC with the specific stimulation and induction of antigen specific Th1 cells.
- Th1 tumor antigen specific T helper type 1 cells in addition to cytotoxic T lymphocytes (CTL).
- CTL cytotoxic T lymphocytes
- Coiled coils are consisting of structural motifs in proteins, in which 2-7 alpha- helices are coiled together like the strands of a rope; dimers and trimers are the most common types.
- the coiled coil helixes have been used to stabilize Fv antibody fragments resulting in heterodimeric coiled-coil domains 22 .
- the stability and folded structure of complex proteinaceous molecules is crucial when designing immunogens. It is thus the object of the invention to provide a vaccine with improved stability and structure to regulate the immune response to specific immunogens.
- an immunoregulatory vaccine comprising
- directed adjuvant comprising at least an anti-CD32 moiety linked to a TLR9 ligand and a first peptidic alpha-helix
- an immunogen with at least one epitope and a second peptidic alpha- helix coiled to the first alpha-helix.
- the epitope is a T cell and/or B cell epitope.
- each of said first and second alpha-helices comprises 3-5 amino acid repeats of an amino acid motive, specifically binding to each other with a Kd of less than 10 "6 M, preferably with a Kd of less than 10 ⁇ 7 M, more preferred less than 10 ⁇ 8 M or 10 ⁇ 9 M.
- said anti-CD32 moiety is selected from the group consisting of an anti-CD32 antibody, an antibody fragment and a peptide, preferably targeting CD32a.
- the antibody fragment specifically may e.g. be an Fab, Fv, scFv, dAb, F(ab)2 or Fcab fragment, or any other possible binding entity, as long as it specifically binds to the receptor and is internalized after binding.
- the TLR9 ligand is a TLR9 agonist selected from the group consisting of CpG class A, in particular CpG-A (D) 23 oligodeoxynucleotides (ODN), also known as "D"-type ODN.
- TLR9 agonists induce a strong IFNa induction and minimal maturation of dendritic cells, and are herein called "group 1 " TLR9 ligand.
- the TLR9 ligand is a TLR9 agonist selected from the group consisting of CpG class B, in particular CpG-B (K) 24 oligodeoxynucleotides (ODN), also known as "K"-type ODN.
- TLR9 agonists induce a weak IFNa induction and maturation of dendritic cells, and are herein called "group 2" TLR9 ligand.
- said TLR9 ligand specifically is a TLR9 agonist selected from the group consisting of CpG class C, also known as CpG- C 25 ' 26 oligodeoxynucleotides (ODN).
- TLR9 agonists induce IFNa and maturation of immature dendritic cells, and are herein called "group 3" TLR9 ligand.
- said TLR9 ligand specifically is an immunostimulatory peptide mimicking any of the CpG class A, B or C oligodeoxynucleotides, i.e. a peptide specifically binding to TLR9 with activating, agonistic function.
- the TLR9 ligand is a TLR9 antagonist selected from the group consisting of inhibitory ODNs 27 28
- Specific inhibitory ODNs have proven not to induce IFNa and not to induce maturation of dendritic cells, also blocking activation through an agonist of TLR9.
- Such TLR9 agonist or antagonist can be determined in a suitable cell based assay, which measures stable expression of either of IFNa, or at least one of the markers CD80, CD83 and CD86, which reflect the maturation of immature dendritic cells (DC).
- DC dendritic cells
- plasmacytoid dendritic cells (pDCs) are purified from blood of a healthy donor as described by Tel et al 30 and subsequently incubated with the appropriate concentration of the TLR9 ligand. After 24 h IFNa is measured in the supernatant using standard ELISA protocols.
- pDCs are stained for expression of CD80, CD83 or CD86 using standard FACS procedures with commercially available specific antibodies before and after the incubation with the TLR9 ligand.
- the induction of IFNa may be determined by the level of IFNa expression and the respective increase with respect to a reference level.
- the increase relative to non- stimulated cells may be compared to the induction levels induced by established references for each type of CpG as defined by group 1 , 2 or 3 TLR9 ligand and is typically between 30% and 300% of the respective reference, preferably at least 100%, more preferably at least 120%, at least 150%, at least 200% or at least 250%.
- the maturation of immature dendritic cells may be determined by the level of expression of any of the markers CD80, CD83 and CD86.
- the respective increase relative to non-stimulated cells may be compared to the induction levels induced by established references for each type of CpG as defined by group 1 , 2 or 3 TLR9 ligand and is typically between 30% and 300% of the respective reference, preferably at least 100%, more preferably at least 120%, at least 150%, at least 200% or at least 250%.
- the TLR9 agonist of group 1 and 3 would result in an increased
- TLR9 antagonist would result in a reduced IFNa expression and a reduced expression of any of the DC maturation factors CD80, CD83 and CD86, even in the presence of a TLR9 agonist of either group 1 -3.
- the immunogen is derived from either
- a tumor associated-antigen for use in the immunotherapy of cancer diseases, or
- Such vaccine is typically an immunostimulating vaccine, e.g. stimulating the humoral and T-cell (Th1 ) immune response.
- This embodiment of an immunostimulating vaccine specifically employs a TLR9 ligand which is a TLR9 agonist.
- the vaccine predominantly induces Th1 responses against the immunogen.
- said anti-CD32 moiety is targeting CD32a, preferably with a high affinity of Kd ⁇ 10 ⁇ 6 M, more preferred less than 10 ⁇ 7 M or less than 10 "8 M. More specifically said anti-CD32 moiety is a specific or selective CD32a binder, i.e. not targeting CD32b or targeting CD32b with a low affinity of Kd > 10 ⁇ 6 M, preferably higher than 10 "5 M, more preferred higher than 10 "4 M.
- the differential affinity of binding to CD32a and CD32b is preferably at least 1 log, more preferred at least 2 logs or at least 3 logs, or higher difference in the Kd value.
- the specifically preferred high affinity or high differential affinity of the anti-CD32 moiety to bind CD32a rather than CD32b is typically used in an immunostimulating vaccine further employing the TLR9 agonist. It is further preferred that such vaccine employs an immunogen selected from a series of oncology targets or pathogenic targets, where a Th1 response and specific IgG antibodies are necessary to effectively combat diseases.
- said anti-CD32 moiety is targeting both, CD32a and CD32b, with a high affinity of Kd ⁇ 10 "6 M, preferably higher affinity than 10 ⁇ 7 M, more preferred higher affinity than 10 ⁇ 8 M.
- the specifically preferred high affinity of the anti-CD32 moiety to bind both, CD32a and CD32b is typically used in a vaccine further employing the TLR9 agonist. It is further preferred that such vaccine employs an immunogen selected from a series of allergy targets, where a redirection of a Th2 response to obtain a Th1 response is obtained. Typically, antibodies against the vaccine itself are not preferred. Further, a specific vaccine is preferred that binds to CD32b with about the same affinity as to CD32a.
- Binding affinity of the anti-CD32 moiety targeting specifically any of CD32a or CD32b, or both, CD32a and CD32b can be determined in a suitable assay such as a typical ELISA using commercially available HIS-tagged recombinant forms of CD32a and CD32b, coated to Ni-NTA ELISA plates, e.g. Ni-NTA HisSorb Plates (Qiagen, Austria).
- the anti-CD32 moieties may be biotinylated and as such may be detected using streptavidine-HRP or streptavidine AP and the appropriate substrates.
- the moieties may be tested in a FACS assay using U937 cells (e.g.
- the immunogen is derived from either
- Such vaccine for use in autoimmune disease is typically an immunotolerance vaccine, e.g. inducing T-cell tolerance against the immunogen by the regulatory T-cells and down-modulating the humoral immune response.
- This embodiment of an immunotolerance specifically employs a TLR9 ligand which is a TLR9 agonist of group 1 or is a TLR9 antagonist.
- the vaccine would predominantly down-regulate Th1/2/17 responses against the immunogen, but activate Treg cells.
- Such vaccine for use in allergy can be either:
- an immuntolerance vaccine e.g. inducing T-cell tolerance against the immunogen by the regulatory T-cells and down-modulating the humoral immune response, employing a TLR9 ligand which is a TLR9 agonist of group 1 or is a TLR9 antagonist.
- the vaccine would predominantly down-regulate Th 1/2/17 responses against the immunogen, but activate Treg cells;
- TLR9 ligand which is a TLR9 agonist of group 3.
- said anti-CD32 moiety is specifically targeting either CD32b or both, CD32a and CD32b, with a high affinity of Kd ⁇ 10 ⁇ 6 M, preferably a higher affinity with a Kd ⁇ 10 "7 M, more preferred Kd ⁇ 10 "8 M. It is preferred that the anti-CD32 moiety is specifically targeting both CD32a and CD32b.
- said anti-CD32 moiety is specifically targeting CD32a and CD32b, with a high affinity of Kd ⁇ 10 ⁇ 6 M, preferably with a higher affinity, e.g. a Kd ⁇ 10 ⁇ 7 M, more preferred Kd ⁇ 10 "8 M. It is preferred that the anti-CD32 moiety is specifically targeting both CD32a and CD32b.
- a vaccine according to the invention wherein said immunogen is derived from an allergen, for use in the immunotherapy of allergy diseases and wherein said anti-CD32 moiety is targeting CD32a and CD32b.
- Specific embodiments of the invention may be depicted from the following table, indicating the selection of the anti-CD32 moiety according to its specificity and affinity of binding CD32a and/or CD32b, the type of TLR9 ligand and the type of immunogen.
- Table 1 Specific embodiments:
- CD32b CD32a meaning binding to both CD32a and CD32b to about the same extent (difference in binding affinity/Kd of less than 1 log).
- the anti-CD32 moiety is specifically targeting both CD32a and CD32b with about equally high affinity, e.g. a differential affinity of binding to each of the CD32a and CD32b targets of less than 2 logs, preferably less than 1 log difference in the Kd values.
- an immunogenic composition comprising
- a directed adjuvant comprising at least an anti-CD32 moiety linked to a TLR9 ligand and a first peptidic alpha-helix
- said peptide immunogen is a linear peptide comprising or consisting of
- the immunogenic composition of the invention comprises at least two of the peptide immunogens linked to the second peptidic alpha-helix, preferably 2, 3 or 4 of the peptide immunogens.
- the peptide immunogens may e.g. be conjugated to the alpha-helix consecutively, i.e. linking the peptide imunogens in a row, e.g. linking the C-terminus of a first peptide immunogen to an N-terminus of a second peptide immunogen, which first and second peptide immunogens are identical or differ from each other.
- further peptide immunogens may be incorporated into the immunogenic composition of the invention by cross-linking e.g. two or more peptide immunogens, which are either identical or differ from each other, are linked to the same alpha-helix by chemical reaction, such as chemical cross-linking permitting the establishment of inter-molecular cross-linkages, e.g. with homo-bifunctional reagents such as Dimethyl adipimidate (DMA), Dimethyl suberimidate (DMS), or glutaraldehyde.
- DMA Dimethyl adipimidate
- DMS Dimethyl suberimidate
- glutaraldehyde glutaraldehyde
- cross-linking may be performed employing glutaraldehyde crosslinking by free lysine groups of the alpha-helix or a spacer/linker, respectively.
- two or more peptide immunogens as used according to the invention are coupled to the alpha-helix in parallel, or side-by-side.
- the immunogenic composition comprises one or more linker sequences, preferably composed of glycine and/or serine and/or lysine residues, preferably an amino acid sequence of SEQ ID 89 or 90.
- the linker sequences may be linear or branched, e.g. to provide linkage or cross-linkage between two or more peptide or polypeptide entities.
- the immunogenic composition comprises or consists of the amino acid sequence of SEQ ID 87 or SEQ ID 88.
- a vaccine comprising the immunogenic composition of the invention, and a pharmaceutically acceptable carrier.
- Such vaccine is typically an immunostimulating vaccine, e.g. stimulating the humoral and T-cell (Th1 ) immune response.
- the humoral and T-cell (Th1 ) immune response is transient, e.g. with a specific maximum IgG titer induced upon vaccination that is typically achieved within a period of 2 to 8 weeks upon vaccination, followed by a titer reduction by at least 30%, preferably at least 40%, or at least 50%, or at least 60%, or at least 70%, or at least 80%, or at least 90%, or up to 100%, within 6 months upon vaccination, preferably within 5 months, or within 4 months, or within 3 months, or within 2 months.
- Such reduced titer may be again increased upon a booster injection.
- the transient immune response is possibly determined upon the last injection of the immunogenic composition or vaccine.
- the transient immune response has the advantage of a controlled treatment with, e.g. the possibility to interrupt or stop treatment as necessary.
- the invention particularly provides for a vaccine comprising an immunogenic composition comprising
- directed adjuvant comprising at least an anti-CD32 moiety linked to a TLR9 ligand
- an immunogen which is bound to the directed adjuvant, preferably by linkage or affinity binding; e.g. fusion by recombinant DNA
- IgG immune response directed to the immunogen which is transient preferably with a specific maximum IgG titer induced upon vaccination that is typically achieved within a period of 2 to 8 weeks upon vaccination, followed by a titer reduction by at least 30%, preferably at least 40%, or at least 50%, or at least 60%, or at least 70%, or at least 80%, or at least 90%, or up to 100%, within 6 months upon vaccination, e.g. upon the last vaccination in a series of vaccinations..
- Such vaccine is preferably used with an immunogen that is or comprises an antigen or epitope of a self-antigen, e.g. selected from the group consisting of a tumor associated antigen (TAA), preferably a tumor cell surface receptor or a soluble antigen produced by the tumor cell, such as Her2/neu, gastrin, interferon alpha (INFa), epidermal growth factor (EGF), EGF receptor (EGF-R), epithelial cell adhesion molecule (EpCAM), alphafetoprotein (AFP), carcinoembryonic antigen (CEA), MUC-1 or LewisY, prehormones and hormones, such as any of the digestive hormones, including secretin or insulin, thyroid hormones, or sexual hormones.
- TAA tumor associated antigen
- the self-antigen is particular of human origin when treating a human subject.
- Th1 immune response induced with this type of vaccine, there is no irreversible autoimmune response, but a reversible one, which is indicated by the level of specific circulating IgG, e.g. that is less than, 50%, preferably less than 60%, preferably less than 70%, preferably less than 80%, or less than 90%, even up to 100% reduction of circulating IgG, after the IgG has been induced.
- the IgG induction is, typically, followed by the IgG reduction within a specific time period e.g within 1 year after last immunization, or within 6 months, or within 3 months.
- the invention further provides for a method of treating a subject in need of a transient reduction of self-antigens or autoantigens by administering an effective amount of the vaccine to the subject, e.g. in one or more doses, wherein at least the last dose provides for the transient effect.
- kit for preparing the immunogenic composition of the invention comprising the following components
- a directed adjuvant comprising at least an anti-CD32 moiety linked to a TLR9 ligand and a first peptidic alpha-helix
- the kit may specifically be used to facilitate the production of the vaccine by using the preformed directed adjuvant component for the combination with an immunogen that may be provided according to the need of a subject group or the individual subject.
- gastrin dependent diseases or disease conditions Such disease or disease condition is primarily caused by or associated with the endogenous gastrin production or over-production in the subject.
- the gastrin dependent diseases or disease conditions specifically include gastrin dependent tumors or gastrin dependent cancer, such as pancreatic cancer, or gastrointestinal cancers, gastric ulcer, gastroesophageal reflux disease (GERD), end- stage renal failure (ESRF), or obesity.
- the invention specifically provides for a method of treating a subject suffering from gastrin dependent diseases, such as gastrin dependent tumors or gastrin dependent cancer, such as pancreatic cancer, or gastrointestinal cancers, gastric ulcer, gastroesophageal reflux disease (GERD), end-stage renal failure
- gastrin dependent diseases such as gastrin dependent tumors or gastrin dependent cancer, such as pancreatic cancer, or gastrointestinal cancers, gastric ulcer, gastroesophageal reflux disease (GERD), end-stage renal failure
- ESRF ESRF
- obesity by administering to the subject an effective amount of the immunogenic composition or the vaccine of the invention, either prophylactically, e.g. to prevent the outbreak of a disease or disease condition or the progress of disease, or therapeutically, e.g. to ameliorate a disease or disease condition.
- composition is administered to the subject in an effective amount employing a prime-boost strategy.
- the effective amount is ranging between 0.0001 and 2 mg per administration, preferably between 0.001 and 2 mg per dose.
- the subject is further treated by chemotherapy, e.g. in the course of treating a gastrin dependent cancer.
- the immunogenic composition of the invention triggers a protective immune response in the subject, preferably with a serum IgG titer against human gastrin-17 of at least 1/1000, preferably at least 1/10 4 , preferably at least 1/10 5 , preferably at least 1/10 6 , or lower, thus, detectable at a higher dilution.
- a serum IgG titer against human gastrin-17 of at least 1/1000, preferably at least 1/10 4 , preferably at least 1/10 5 , preferably at least 1/10 6 , or lower, thus, detectable at a higher dilution.
- Figure 1 shows the high affinity interaction of the coiled coil used in the invention (Example 4).
- the immunogen with coil-K is coated to a BIACore Chip and the warhead with coil-E is in the flow-buffer.
- Each coil comprises of a 5 time heptad repeat alpha helix
- FIG. 2 shows Immunogen 3 induced T cell reactivity (Example 6).
- PBMCs from Der p1 sensitized rhesus monkeys were cultured in triplicate with Der p1 or immunogen 3. Proliferation was assayed by the
- immunogen 3 neither in proliferation nor in cytokine production, indicating that the T cell epitopes in immunogen 3, which were selected on the basis of human HLA Class II expression, are equally well presented by rhesus monkey class II molecules and induce equally strong T cells responses
- FIG. 3 shows: Warhead mediated enhanced antigen presentation (Example 7)
- Warhead mediated antigen uptake is more efficient than uptake through pinocytosis
- Figure 4 shows autoimmune response induced by an autoantigen coupled to
- PBMCs rhesus monkeys (macaca mulatta) and normal human PBMCs were cultured were cultured for 24 h with CpG or CpG-biot or aCD32-biot + CpG.
- Super- natants were harvested and assayed for IL-4 and IFNg s (each indicated as pg/ml)
- CpG-biot a strong IL-4 (rhesus monkey and human PBMC) was induced compared to CpG without biot.
- Human PBMC also showed a strong IFNg response against CpG-biot.
- biot and CpG were not coupled (aCD32-biot+CpG) no increased response was seen compared to CpG in humans or rhesus monkey PBMCs
- FIG. 5 shows Immunogen 5 induced T cell reactivity (Example 10)
- Human T cells respond equally well to immunogen 5 as to Der p1 , as measured by IL-10 and IFNg induction.
- Figure 6 shows induction of autoimmune response by the warhead SG100 Immunization with warhead induced a strong lgG1 and lgG2a response to ScFV-1 -coil as well as to mAb IV.3 on day 28. A positive response was seen independent of the presence of Alum. Immunization with ScFV-1 -coil only induced an lgG1 response against ScFV-1 -coil and only in the presence of Alum, no lgG2a response was induced.
- Figure 10 shows the antibody (IgG induction) in cynomolgus monkeys. Time curve IgG anti G17 induction, after three injections with the vaccine
- Figure 1 1 shows the weight loss upon anti-gastrin immunization.
- FIG. 12 shows the sequence information of
- SEQ ID 78 human little gastrin, G17;
- SEQ ID 79 human gastrin peptide, first (N-terminal) 12 AA (amino acids) of little gastrin, G12;
- SEQ ID 80 N-terminal epitope of little gastrin, first (N-terminal) 4 AA, including specific functionally active variants with point mutations;
- SEQ ID 81 N-terminal epitope of little gastrin, first (N-terminal) 4 AA, including more specific functionally active variants with point mutations;
- SEQ ID 82 N-terminal epitope of little gastrin, first (N-terminal) 12 AA, including specific functionally active variants with point mutations;
- SEQ ID 83 N-terminal epitope of little gastrin, first (N-terminal) 12 AA, including more specific functionally active variants with point mutations
- SEQ ID 84 N-terminal epitope of little gastrin, first (N-terminal) 13 AA, including specific functionally active variants with point mutations;
- SEQ ID 85 N-terminal epitope of little gastrin, first (N-terminal) 13 AA, including more specific functionally active variants with point mutations;
- SEQ ID 86 human gastrin peptide, first (N-terminal) 13 AA (amino acids) of little gastrin, G13;
- SEQ ID 87 Immunogen component of TYG100_1 H: Part of an immunogenic composition of the invention, comprising one human gastrin peptide of SEQ ID 86, a linker sequence and a peptide alpha-helix (TYG100_1 H). This part may be linked to the suitable directed adjuvant by a coiled-coil linkage.
- Immunogen component of TYG100_2H Part of an immunogenic composition of the invention, comprising two human gastrin peptides of SEQ ID 86, a branched linker sequence and a peptide alpha-helix (TYG100_2H). This part may be linked to the suitable directed adjuvant by a coiled-coil linkage.
- SEQ ID 90 branched linker sequence.
- adjuvant as used herein shall mean an integrated or co-administered component of a vaccine, which:
- the immune response is typically greater than the immune response elicited by an equivalent amount of the immunogenic composition administered without the adjuvant,
- the adjuvant is used to direct a particular type or class of immune response against the immunogen, e.g. a Th1 or Treg type of immune response, herein understood as "directed adjuvant".
- an "effective amount" of an adjuvant of the present invention specifically is an amount which enhances an immunological response to the immunogen such that, for example, lower or fewer doses of the immunogenic composition are required to generate an efficient immune response of the intended class.
- the directed adjuvant according to the invention not only mediates the efficient immune response, but also the regulation of the immune response in the desired way.
- the Th1 immune response is induced rather than the Th2 immune response, in particular when employing a TLR9 ligand that is a TLR9 agonist of group 3.
- a TLR9 antagonist is used in the vaccine composition, the respective immune response is down-modulated in any case.
- a TLR9 agonist of group 1 is combined with an anti-CD32 moiety that binds CD32b, the induction of Treg cells is usually anticipated.
- an "effective amount" of an adjuvant of the present invention specifically is an amount which enhances an immunological response to the immunogen such that, for example, lower or fewer doses of the immunogenic composition are required to generate an efficient immune response of the intended class.
- the directed adjuvant according to the invention not only mediates the efficient immune response, but also the regulation of the immune response in the desired way.
- the Th1 immune response is induced rather than the Th2 immune response, in particular when employing a TLR9 ligand that is a TLR9 agonist of group 3. If a TLR9 agonist of group 1 is combined with an anti-CD32 moiety that binds CD32b, the induction of Treg cells is usually anticipated.
- an "effective amount" of an immunogenic composition refers to an amount sufficient to show a meaningful benefit in a subject being treated, when administered as part of a vaccination dosing regimen.
- a particular composition may be considered to contain a prophylactically or therapeutically effective amount if it contains an amount appropriate for a unit dosage form
- an effective amount is one that has been correlated with beneficial effect when administered as part of a particular dosing regimen, e.g. a single administration or a series of administrations such as in a
- peptidic alpha-helix shall mean a coiled structural motif based on a peptide sequence comprising a number of repeats, also called coil repeats. Such alpha-helix is capable of binding to another counterpart, also called matching alpha-helix of the same type to form a dimer, trimer or further oligomer, also called coiled coil.
- a coiled coil is a structural motif in polypeptides or peptides, in which two to seven alpha-helices are coiled together like the strands of a rope.
- the coiled coil of the vaccine is one with two alpha-helices coiled together.
- Such alpha helical regions are likely to form coiled-coil structures and may be involved in oligomerization of the coil repeats as measured in a suitable coiled coil interaction binding assay.
- a dimer of alpha-helices can be formed by contacting the two monomers, such that the dimer is formed through an interaction with the two alpha helix coiled coil domains.
- the coils comprise a peptide with the amino acid sequence as set forth in SEQ ID NO: 1 or 2 (coil and anti-coil), which include x repeats.
- E5 EVSALEKEVSALEKEVSALEKEVSALEKEVSALEK-NH2 (SEQ ID 1 )
- K5 KVSALKEKVSALKEKVSALKEKVSALKEKVSALKE-NH2 (SEQ ID 2)
- Coil Type Type/ number of repeats Exemplary sequence
- E!AAL E3 EIAALEKEIAALEKEIAALEK-NH2 (SEQ ID 3)
- EIAAL E4 EIAALEKEIAALEKEIAALEKEIAALEK-NH2 (SEQ ID 4)
- KIAAL K3 KIAALKEKIAALKEKIAALKE-NH2 (SEQ ID 5)
- KIAAL K4 KIAALKEKIAALKEKIAALKEKIAALKE-NH2 (SEQ ID 6)
- EISAL E3 EISALEKEISALEKEISALEK-NH2 (SEQ ID 7)
- EISAL E4 EISALEKEISALEKEISALEKEISALEK-NH2 (SEQ ID 8)
- KISAL K3 KISALKEKISALKEKISALKE-NH2 (SEQ ID 9)
- KISAL K4 KISALKEKISALKEKISALKEKISALKE-NH2 (SEQ ID 10)
- EVAAL E3 EVAALEKEVAALEKEVAALEK-NH2 (SEQ ID 1 1 )
- EVAAL E4 EVAALEKEVAALEKEVAALEKEVAALEK-NH2 (SEQ ID 12)
- KVAAL K3 KVAALKEKVAALKEKVAALKE-NH2 (SEQ ID 13)
- KVAAL K4 KVAALKEKVAALKEKVAALKEKVAALKE-NH2 (SEQ ID 14)
- EVSAL E3 EVSALEKEVSALEKEVSALEK-NH2 (SEQ ID 15)
- EVSAL E4 EVSALEKEVSALEKEVSALEKEVSALEK-NH2 (SEQ ID 16)
- KVSAL K3 KVSALKEKVSALKEKVSALKE-NH2 (SEQ ID 17)
- KVSAL K4 KVSALKEKVSALKEKVSALKEKVSALKE-NH2 (SEQ ID 18)
- the preferred type of a coiled coil is a dimer, either a heterodimer (heterocoii) of two different, but matching helices, which differ in at least one amino acid in the coil repeat sequence, or else a homodimer of two identical matching helices, i.e. those comprising the matching coil repeat sequences (the "coils").
- the preferred number of coil repeats is 3-5, preferably any of the combinations 3+3, 3+4, 3+5, 4+4, 4+5, 5+5, 4+3, 5+3 or 5+4.
- heptad repeats As an alternative to heptad repeats (repeats of an amino acid sequence consisting of 7 amino acids, 7-mers), 6-mers, 8-mers, or 9-mers may be used. ln case of a homodimeric coiled coi!, the typical number of coil repeats is specifically not more than 5, so to avoid undesired mismatches of the structure. In case of a heterodimeric coiled coil, it is typically desirable to employ a length of the peptide sequence with at least 3 coils. Thereby the binding of the components of the vaccine, i.e.
- the directed adjuvant and the immunogen components, to each other is typically achieved with preferred high affinity of a Kd of less than 10 "7 M, more preferred less than 10 ⁇ 8 M or 10 ⁇ 9 M.
- Kd a Kd of less than 10 "7 M, more preferred less than 10 ⁇ 8 M or 10 ⁇ 9 M.
- this may be at the cost of increased homodimerisation
- the components of the immunogenic composition of the invention may also comprise a peptide spacer so to link the anti-CD32 moiety and/or the TLR9 ligand, and optionally also the epitope (e.g. of the peptide immunogen) with the coil repeats, respectively.
- the peptide spacer can be on either or both ends of a coiled coil.
- Each of the peptide spacers can be attached to a single alpha helix coiled coil domain of the coiled coil.
- the peptide spacer can be, for example, a peptide of at least 5, 6, 7, 8, 9, 10,
- amino acids or more either linear or branched, e.g. to provide for two, three, four, or more branches.
- the number of amino acids in the peptide spacer may be, in some embodiments, 20 amino acids or up to 10 amino acids greater or fewer, depending on the particular sequences and length of the coil.
- anti-CD32 moiety shall mean a ligand specifically binding to the cellular target CD32, either CD32a, CD32b or both, CD32a and CD32b.
- the moiety can be any binding structure, such as derived from proteins, polypeptides or peptides, including antibodies and antibody fragments or composite molecules with a binding part.
- the binding part of the molecules or molecule complex of the invention can be comprised of proteins such as antibodies or antibody fragments, such as Fab, Fv, VH/VL dimer, scFv, dAb, F(ab)2, minibody, small mutated immunoglobulin domains, Fcab, Mab 2 or other biological binders, such as soluble T-cell receptor, Darpins, etc.
- Antibodies and antibody fragments and derivatives may be generated and selected for binding to CD32 according to known methods such as hybridoma technology, B-cell cloning, phage display, yeast display, ribosome display or cell surface display of antibody libraries, array screening of variant antibodies.
- Exemplary anti-CD32 moieties are scFv derived from the anti-CD32 monoclonal antibody AT-10 35 , IV.3 36 , 2E6 37 or any other aCD32 monoclonal antibody The specific binding may be determined in a suitable binding assay, such as conventional immunoassays.
- radioimmunoassays ELISA (enzyme linked immunosorbent assay)
- cross-reactive with respect to antigens or antibodies as used herein shall refer to epitopes shared between antigens of different origin, e.g. from human, rhesus monkey or mouse origin.
- the N-terminal epitope consisting or comprising the first 4 AA of G17 was found to be cross-reactive in peptides of various origin, which epitope triggers an immune response and IgG antibodies that are cross-reactive with the epitopes.
- the immunogenic composition of the invention is specifically useful to treat gastrin dependent diseases or disease conditions that are associated with excess gastrin, e.g. gastrin dependent tumors or gastrin dependent cancer, such as pancreatic cancer, gastric ulcer, gastroesophageal reflux disease (GERD), end-stage renal failure (ESRF), or obesity.
- gastrin dependent diseases or disease conditions e.g. gastrin dependent tumors or gastrin dependent cancer, such as pancreatic cancer, gastric ulcer, gastroesophageal reflux disease (GERD), end-stage renal failure (ESRF), or obesity.
- tumor dependent tumor or "gastrin dependent cancer” as used herein shall refer to tumors or disease or disease conditions associated therewith, of e.g. gastrin-dependent colorectal adenocarcinoma and other gastrin-dependent cancers such as stomach, liver, pancreatic and small cell carcinoma of the lungs.
- gastrin-dependent colorectal adenocarcinoma and other gastrin-dependent cancers such as stomach, liver, pancreatic and small cell carcinoma of the lungs.
- the term is specifically used herein with regard to treating the tumor for preventing tumor disease progression, for a positive tumor response or for tumor shrinkage.
- minimal residual disease which would be successfully treated, e.g. targeting circulating tumor cells to reduce their number below a certain threshold, e.g. below the detection limit.
- Gastric ulcer disease may be caused by increased stomach acid and a breakdown of the complex stomach defenses that normally protect the gastric mucosa from acid damage. Although the two conditions have different etiologies, both benefit from a reduction in gastric acid secretion.
- Gastric acid is produced in a specialized stomach cell, the parietal cell.
- Parietal cells can be stimulated to secrete acid by acetylcholine, histamine and gastrin, upon the binding of each of these compounds with specific receptors on the surface of the cell. Of these the most potent stimulator of acid secretion is the peptide hormone gastrin.
- the anti-gastrin immunotherapy therapy as described herein, would ameliorate the gastric ulcer disease conditions.
- G17 peptide or “G17 peptide” or “G17” as used herein shall refer to the little gastrin G17, which consists of the N-terminal 17 AA of gastrin.
- the G17 peptide may be of human origin, or other mammalian origin, including rhesus monkey, or mouse, thus, has a human or other mammalian sequence, or may be an artificial construct, such as to incorporate artificial sequences, e.g. obtained by changing the type and/or sequence of amino acid residues in the native (naturally occurring) G17 sequence.
- the term shall specifically include variants of human G17, with an amino acid sequence of SEQ ID 78, or fragments thereof, but differs from its peptide sequence, in that it is derived from a homologous sequence of a different species. These are referred to as naturally occurring variants or analogs.
- the term "analogs” shall also refer to chimeric constructs originating from two or more origins, wherein at least one part is naturally occurring, e.g. which constitutes the major part (at least 50%) of the peptide immunogen, and another part is different thereto, either naturally occurring or synthetic (artificial).
- the term shall specifically include fragments or functionally active variants of G17, e.g. those comprising one or more point mutations, or else peptides or
- polypeptides comprising further amino acid sequences besides the G17, e.g. by extending the N-terminus and/or the C-terminus by additional one or more amino acid residues or sequences.
- An extension of the C-terminus is e.g. preferred with repeats of G17 sequences, either identical or not, or with further amino acid sequences of gastrin.
- the term shall specifically include the peptides with one or more modified amino acid residues. Common modifications include phosphorylation, methylation,
- the exemplary modification as described herein is the modification of the N-terminal glutamic acid of G17, i.e. the pyroGlu at position 1 , which is also known as
- the term "functionally active variants" as used herein with respect to the peptide immunogen of the invention shall mean a sequence resulting from modification of this sequence (a parent sequence), e.g. by insertion, deletion or substitution of one or more amino acids, such as by recombination techniques or chemical derivatization of one or more amino acid residues in the amino acid sequence, or nucleotides within the coding nucleotide sequence, or at either or both of the distal ends of the sequence, and which modification does not affect (in particular impair) the activity of this sequence.
- the functionally active variant of the peptide immunogen would still incorporate the antigenic determinant or epitope, though this could be changed, e.g. to increase the immunogenicity.
- the functionally active variants of the G17 peptide immunogen, or a fragment thereof, such as the G12 or G 3 fragment have the potency to elicit IgG anti-gastrin antibodies in a treated subject, which antibodies cross-react with the endogenous gastrin of the subject.
- Functionally active variants may be obtained, e.g. by changing the sequence of a parent peptide, e.g. the human, rhesus monkey or murine G17 peptide, or a fragment thereof, e.g. the G12 or G13 peptide, by introducing one or more parent peptide, e.g. the human, rhesus monkey or murine G17 peptide, or a fragment thereof, e.g. the G12 or G13 peptide, by introducing one or more
- substantially the same immunogenicity refers to the amount of an immune response or anti-gastrin IgG antibodies induced in a subject treated with the immunogenic composition, which amount is preferably at least 20% at least 30% at least 40%, at least 50% at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 98% or even at least 100% or at least 1 10%, or at least 120%, or at least 130%, or at least 140%, or at least 150%, or at least 160%, or at least 170%, or at least 180%, or at least 190%, e.g. up to 200% of the amount as determined for the parent peptide.
- the functionally active variant of a parent peptide a) is derived from the peptide by at least one amino acid substitution, insertion (addition) and/or deletion, e.g. comprising one or more point mutations wherein the functionally active variant has a specific sequence identity to the parent molecule, such as at least 50% sequence identity, preferably at least 60%, more preferably at least 70%, more preferably at least 80%, still more preferably at least 90%; and/or
- b) consists of the peptide and additionally at least one amino acid heterologous to the peptide.
- Functionally active variants may be obtained by sequence alterations in the peptide sequence, e.g. by one or more point mutations, wherein the sequence alterations substantially retains a function of the unaltered peptide sequence, when used in according to the invention.
- sequence alterations or point mutations can include, but are not limited to, (conservative) substitutions, additions, deletions, mutations and insertions, e.g. the alteration of 1 , 2, 3, or 4 amino acids, or by addition or insertion of one to several amino acids, e.g. 1 , 2, 3, or 4 amino acids, or by a chemical derivatization of one to several amino acids, e.g. 1 , 2, 3, or 4, or combination thereof, preferably by point mutations that are not contiguous.
- the substitutions in amino acid residues may be conservative substitutions, for example, substituting one hydrophobic amino acid for an alternative hydrophobic amino acid.
- Conservative substitutions are those that take place within a family of amino acids that are related in their side chains and chemical properties. Examples of such families are amino acids with basic side chains, with acidic side chains, with non-polar aliphatic side chains, with non-polar aromatic side chains, with uncharged polar side chains, with small side chains, with large side chains etc.
- Preferred point mutations refer to the exchange of amino acids of the same polarity and/or charge.
- amino acids refer to twenty naturally occurring amino acids encoded by sixty -four triplet codons. These 20 amino acids can be split into those that have neutral charges, positive charges, and negative charges:
- Alanine (Ala, A) nonpolar, neutral;
- Asparagine (Asn, N) polar, neutral
- Cysteine (Cys, C) nonpolar, neutral
- Glutamine (Gin, Q) polar, neutral
- Glycine (Gly, G) nonpolar, neutral
- Leucine (Leu, L) nonpolar, neutral
- Methionine (Met, M) nonpolar, neutral
- Phenylalanine (Phe, F) nonpolar, neutral;
- Proline (Pro, P) nonpolar, neutral
- Serine (Ser, S) polar, neutral
- Threonine (Thr, T) polar, neutral
- Tryptophan (Trp, W) nonpolar, neutral;
- Tyrosine (Tyr, Y) polar, neutral
- Valine (Val, V) nonpolar, neutral
- Histidine (His, H) polar, positive (10%) neutral (90%).
- the "positively" charged amino acids are:
- Arginine (Arg, R) polar, positive
- Lysine (Lys, K) polar, positive.
- the "negatively” charged amino acids are:
- Aspartic acid (Asp, D) polar, negative:
- Glutamic acid (Glu, E) polar, negative.
- Percent (%) amino acid sequence identity with respect to the peptide sequences described herein is defined as the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in the specific peptide sequence, after aligning the sequence and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity.
- Those skilled in the art can determine appropriate parameters for measuring alignment, including any algorithms needed to achieve maximal alignment over the full length of the sequences being compared.
- Functionally active variants may be obtained by any of the known mutagenesis methods, including point mutations at desired positions, e.g. obtained by
- positions are chosen randomly, e.g. with either any of the possible amino acids or a selection of preferred amino acids to randomise the peptide sequences.
- mutagenesis refers to any art recognized technique for altering a polynucleotide or polypeptide sequence.
- immunogen shall mean one or more antigens triggering an immune response in a subject.
- antigen as used herein shall in particular refer to any antigenic determinant, which can be possibly recognized by a binding site of an antibody or is able to bind to the peptide groove of HLA class I or class II molecules and as such may serve as stimulant for specific T cells.
- the target antigen is either recognized as a whole target molecule or as a fragment of such molecule, especially substructures, e.g. a polypeptide or carbohydrate structure of targets, generally referred to as "epitopes", e.g. B-cell epitopes, T-cell epitope), which are immunologically relevant, i.e. are also recognizable by natural or monoclonal antibodies.
- epitopes is preferred, e.g. to provide for allergy vaccines.
- peptide immunogen shall mean an antigen or immunogen of peptidic structure, in particular an immunogen that comprises or consists of a peptide of a specific amino acid sequence, which is either provided as a linear peptide or branched peptide, comprising natura!ly occurring amino acid residues or modified ones, e.g. a derivative obtained by modification or chemical derivatization, such as by phosphorylation, methylation, acetylation, amidation, formation of pyrrolidone carboxylic acid, isomerization, hydroxylation, sulfation, flavin-binding, cysteine oxidation and nitrosylation.
- the peptide immunogen is specifically designed to trigger an immune response in a subject, and particularly includes one or more antigenic determinants, which can be possibly recognized by a binding site of an antibody or is able to bind to the peptide groove of HLA class I or class I I molecules or other antigen presenting molecules such as CD1 and as such may serve as stimulant for specific T cells.
- the target antigen is either recognized as a whole target molecule or as a fragment of such molecule, especially substructures, e.g. a polypeptide or carbohydrate structure of targets, generally referred to as "epitopes", e.g. B-cell epitopes, T-cell epitope, which are immunologically relevant, i.e. are also recognizable by natural or monoclonal antibodies.
- epitopes e.g. B-cell epitopes, T-cell epitope, which are immunologically relevant, i.e. are also recognizable by natural or monoclonal antibodies.
- epitope as used herein according to the present invention shall in particular refer to a molecular structure which may completely make up a specific binding partner or be part of a specific binding partner to a binding site of modular antibody of the present invention.
- epitope may also refer to haptens.
- an epitope may either be composed of a carbohydrate, a peptide, a fatty acid, an organic, biochemical or inorganic substance or derivatives thereof and any combinations thereof. If an epitope is a polypeptide, it will usually include at least 3 amino acids, preferably at least 4, 5, 6, 7, 8, 9, 10, 1 1 , 12 or 13 amino acids. There is no critical upper limit to the length of the peptide, which could comprise nearly the full length of a polypeptide sequence of a protein. Epitopes can be either linear or conformational epitopes. A linear epitope is comprised of a single segment of a primary sequence of a polypeptide or carbohydrate chain. Linear epitopes can be contiguous or overlapping.
- Conformational epitopes are comprised of amino acids or carbohydrates brought together by folding of the polypeptide to form a tertiary structure and the amino acids are not necessarily adjacent to one another in the linear sequence.
- epitopes are at least part of diagnostically relevant molecules, i.e. the absence or presence of an epitope in a sample is qualitatively or quantitatively correlated to either a disease or to the health status of a patient or to a process status in manufacturing or to environmental and food status.
- Epitopes may also be at least part of therapeutically relevant molecules, i.e. molecules which can be targeted by the specific binding domain which changes the course of the disease.
- One or more epitopes of the same antigen or different antigens may be used according to the present invention, which can include antigens of all the self-antigens, pathogens, allergens or auto-antigens for which the regulation of the immune response is desired, e.g. against which induction of a substantial Th1 -type response or Treg response (depending on the type of vaccine) in the host is desired.
- self-antigen means any antigen, specifically polypeptide or peptide produced by a normal, healthy subject that does not elicit an immune response as such. These self-antigens may be produced at aberrant or high levels in certain disease states, including cancer disease, so called tumour associated antigens (TAAs).
- TAAs tumour associated antigens
- the human gastrin or human G17 is understood as a self-antigen in human subjects, and specifically as a TAA in subjects suffering from a gastrin dependent tumor.
- Self-antigens which are associated with auto-immune disease are herein called auto-antigens.
- the self-antigens can be naturally occurring, recombinantly or synthetically produced. It is also understood that the self-antigens need not be identical to the naturally produced antigen, but rather can include variations thereto having certain sequence identities, similarities or homology.
- tumour associated antigens possibly used in a vaccine according to the invention are Epithelial cell adhesion molecule (EpCAM), Lewis Y, alphafetoprotein (AFP) and carcinoembryonic antigen (CEA), HER2/Neu, MUC-1 , etc.
- an auto-antigen for use in the therapy of auto-immune diseases depends on the type of the auto-immune disease.
- Specific examples of selected auto- immune disease associated antigens possibly used in a vaccine according to the invention are C1 q, ADAMTS13, Desmogelin 3, keratin, gangliosides (e.g. GM1 , GD1 a, GQ1 b), collagen type IV, IgM, cardiolipin, annexin A5, etc
- the immunogen comprises one or more specific allergens.
- An "allergen” is an antigen which can initiate a state of hypersensitivity, or which can provoke an immediate hypersensitivity reaction in a subject already sensitized with the allergen. Allergens are commonly proteins or chemicals bound to proteins which have the property of being allergenic. However, allergens can also include organic or inorganic materials derived from a variety of synthetic or natural sources such as plant materials, metals, ingredients in cosmetics or detergents, latexes, or the like.
- an allergen for use in the anti-allergy therapy depends on the type and severity of allergy.
- Specific examples of selected allergy associated antigens possibly used in a vaccine according to the invention are any allergen conventionally used as immunogen, specifically house dust mite allergens (e.g. Der p1 , Der p2, Der p3/ Der p23, Der fl , Der f2, Derf3/— Der f23), cat dander, grass or tree pollen, cockroach allergens, etc.
- an antigen specifically inducing immune response against a pathogen for use in the prophylaxis or therapy of infectious diseases depends on the type of the pathogen, e.g. a microbial or viral infectious agent.
- Specific examples of selected pathogen derived antigens possibly used in a vaccine according to the invention are hepatitis B, hepatitis C, Cholera, HIV, Pertussis, Influenza, Typhoid, etc.
- the peptide immunogen or the immunogenic composition used in the vaccine according to the invention is usually contained in a vaccine in an effective amount, which is herein specifically understood as "immunologically effective amount".
- immunologically effective amount it is meant that the administration of that amount to a subject, either in a single dose or as part of a series of doses, is effective on the basis of the therapeutic or prophylactic objectives. This amount will vary depending upon the health and physical condition of the subject to be treated, age, the capacity of the subject's immune system to synthesize antibodies, the degree of immune response desired, the formulation of the vaccine, and other conditions.
- the invention also provides a method for treating a subject or raising an immune response in a subject, comprising the step of administering an
- An effective amount or dosage may range from 0.0001 to 2 mg, e.g. between 0.001 and 2 mg, of the immunogenic composition administered to the subject in need thereof, e.g. an adult human subject.
- the effective dosage of the immunogenic composition is capable of eliciting an immune response in a patient of effective levels of antibody titer to bind and neutralize endogenous mature and precursor G17 for, e.g. 1 -3 months after immunization.
- the effectiveness of the therapy may be assayed by the anti-gastrin antibody titers in samples of blood taken from the subject.
- TLR9 ligand as used herein is understood in the following way.
- TLR9 Toll-like receptor 9
- TLR9 Toll-like receptor 9
- microbial DNA or synthetic DNA e.g. synthetic CpG ODN may stimulate TLR9 with variations in the number and location of CpG dimers, as well as the precise base sequences flanking the CpG dimers.
- Synthetic CpG ODN differ from microbial DNA in that they have a partially or completely phosphorothioated backbone instead of the typical phosphodiester backbone and may or may not have a poly G tail at the 3' end, 5' end, or both.
- agonist in conjunction with the TLR9 ligand as used herein shall specifically refer to the binding and activation of TLR9 in a cell-based assay.
- the TLR9 ligand which is composed of a nucleotide sequence is typically coupled to the directed adjuvant component of the present immunogenic composition by chemical coupling e.g. using the commercially available KIT from Solulink.
- a peptidic TLR9 ligand may be coupled using standard peptide chemistry or may be integrated using recombinant DNA technology.
- Exemplary TLR9 ligands are ODN 2216 38 (group 1 ), ODN 2006/ODN 2007 39 (group2) and CpG-M362 40 (group 3).
- TLR9 ligands may be peptides that mimic the action of a
- CpG TLR9 agonist e.g. identified by or obtained from a peptide library, which are selected for the affinity to bind the TLR9 and proven agonistic activity, or protein ligands, including specific antibodies.
- TLR9 ligands are immunostimulatory peptides, e.g. those that mimick any of the CpG classes, such as peptides selected from a suitable peptide library.
- immunostimulatory peptides are selected from the group consisting of ESWDKFLSHYLP (SEQ ID 50), TDWSWFY (SEQ ID 51 ), YPVYWPW (SEQ ID 52), EWWFYWP (SEQ ID 53), WFPIEWW (SEQ ID 54), DQVDIGY (SEQ ID 55), THQVYIS (SEQ ID 56), WFPIEWWFYWP (SEQ ID 57), DSWQAFLTKFVL (SEQ ID 58), HDIQWFWQHWNS (SEQ ID 59), WSWWDHTFNYML (SEQ ID 60),
- TTQQTWNVRYPY (SEQ ID 61 ), DHTMPWTRNAKN (SEQ ID 62), SWDPYWPFPWFS (SEQ ID 63), AIYYVPSPMFTV (SEQ ID 64), ETTLLKMWLAQM (SEQ ID 65),
- YPWLDVAWSLY (SEQ ID 66), VPGWHYLATLRA (SEQ ID 67) and FDPLGSRDIKGS (SEQ ID 68), and functionally active variants thereof, which are fragments, mutants, or hybrids thereof.
- the functionally active variant stimulates pDCs, thereby inducing an increased level of IL-6 and TNFalpha as compared to a negative control.
- a) has at least 60% homology to any of the peptides of SEQ ID 50-68;
- b) is a mutant of any of the peptides of SEQ ID 50-68, obtainable by modifying the parent amino acid sequence by insertion, deletion or substitution of one or more amino acids within the sequence or at either or both of the distal ends of the sequence; or
- c) is a fragment of any of the peptides of SEQ ID 50-68 comprising at least 5 amino acids.
- Specific immunostimulatory peptides comprise a motif selected from the group consisting of EWWFYWP (SEQ ID 53), EWW (SEQ ID 125), WFY (SEQ ID 126), YWP (SEQ ID 127), and QVxl, x being any amino acid (SEQ ID 128).
- TLR9 ligand or agonist or antagonist may be determined in a suitable assay, e.g. in the following way: pDCs are purified from blood of a healthy donor as described by Tel et a! 41 and subsequently incubated with the appropriate concentration of the TLR9 ligand. After 24 h IFNa is measured in the supernatant using standard ELISA protocols. For determination of the maturation state of the cells, pDCs are stained for expression of CD80, CD83 or CD86 using standard FACS procedures with commercially available specific antibodies before and after the incubation with the TLR9 ligand.
- the number of reactive T cells that are activated upon exposure to the vaccine according to the invention may be determined by a number of methods including ELISPOT, FACS analysis, cytokine release, or T cell proliferation assays.
- the term “specificity” or “specific binding” refers to a binding reaction which is determinative of the cognate ligand of interest in a heterogeneous population of molecules.
- one or more antigens are specifically bound by the respective binding site(s) of a binder, which does not bind in a significant amount to other molecules present in a sample.
- the specific binding means that binding is selective in terms of target identity, high, medium or low binding affinity or avidity, as selected. Selective binding is usually achieved, if the binding constant or binding dynamics is at least 10 fold different, preferably the difference is at least 100 fold, and more preferred a least 1000 fold. It is well-understood that the term shall also refer to cross-reactive or multispecific binders that specifically recognize one or more different antigens.
- treatment shall always refer to treating subjects for prophylactic (i.e. to prevent infection and/or disease status) or therapeutic (i.e. to treat diseases regardless of their pathogenesis) purposes.
- Treatment of a subject will typically be therapeutic in cases of allergic, autoimmune or cancer disease conditions, or prophylactic in treating infectious disease conditions.
- Treatment of a subject will typically be therapeutic in cases of cancer disease conditions, including gastrin dependent tumors or gastrin dependent cancer.
- a primary disease which are at risk of disease progression or at risk of
- the treatment may be any suitable secondary disease condition or side reaction, e.g. which is dependent on the endogenous gastrin production of gastrin effects, the treatment may be
- the treatment may be prophylactic.
- Such treatment may be effected with the vaccine according to the invention as the sole prophylactic or therapeutic agent or else in combination with any suitable means, e.g. including chemotherapy, or the use of antacids.
- allergic rhinoconjunctivitis hay fever
- allergic asthma allergic asthma
- allergic eczema such as atopic eczema or atopic dermatitis.
- Treatment of auto-immune diseases with the vaccine according to the invention may specifically among other examples refer to Diabetes, Guillain Barre syndrome, Systemic Lupus Erythematosis, Multiple sclerosis or thrombocytopenia.
- Prophylaxis or therapy of infectious diseases employing the vaccine according to the present invention specifically refers to pathological conditions, such as microbial infections, i.e. conditions caused by bacterial, viral, fungal, protozoan or helminthic pathogens.
- pathogen is used in a broad sense to refer to a specific causative agent of a disease or condition, and includes any agent that elicits an immune response.
- Pathogens include viruses, bacteria, fungi, protozoa, parasites, and the like.
- the immunogen is derived from one or more peptide, polypeptide, protein or carbohydrate antigens produced by a pathogen. Methods for identifying suitable antigens, obtaining and preparing such molecules, are well known in the art.
- Treatment of infectious diseases caused by pathogens specifically refers to, e.g. hepatitis B, hepatitis C, Cholera, HIV, Pertussis, Influenza or Typhoid.
- Immunotherapeutic methods of treating tumors as described herein specifically refer to methods and vaccines according to the invention for treating cervical, breast, colorectal, prostate, lung cancers, and melanomas.
- additional therapeutic treatments include, for instance, surgical resection, radiation therapy, chemotherapy, hormone therapy, anti-tumor vaccines, antibody based therapies, whole body irradiation, bone marrow
- the immunogenic composition or the vaccine according to the invention may be administered at once, or may be divided into the individual
- the vaccine is typically administered at a concentration of 0.1 to 500 g/mL, e.g. either subcutaneously, intradermal, intramuscularly, intravenous, orally, through inhalation or intranasally, with or without an additional adjuvant such as ALUM. It is understood that the precise dosage and duration of treatment is a function of the disease being treated and may be determined empirically using known testing protocols or by extrapolation from in vivo or in vitro test data.
- the immunogenic composition or the vaccine of the present invention can be administered by any suitable means and respective formulations for including, but not limited to, for example, any of the parenteral (including subcutaneous, intramuscular, intravenous and intradermal) injection, or local injection into the affected site, such as joints or into or around the tumor.
- the vaccine is provided in a formulation for intramuscular, subcutaneous or intradermal injection.
- the invention also provides a delivery device, e.g. a syringe, pre-filled with the vaccine according to the invention.
- a delivery device e.g. a syringe
- one or more booster injections may be performed over a period of time by the same or different administration routes. Where multiple injections are used, subsequent injections may be made, e.g. within 1 to 52 weeks of the previous injection, or even more.
- the vaccine typically may contain diluents, such as water, saline, glycerol, ethanol, etc. Additionally, as auxiliary substances, such as wetting or emulsifying agents, pH buffering substances, and the like, may be present among excipients.
- the vaccine according to the invention is prepared as an injectable, either as liquid solutions or suspensions, or solid forms suitable for solution in, or suspension in, liquid vehicles prior to administration. The preparations also may be emulsified or encapsulated in liposomes.
- An enhanced immune response may include one or more of an enhanced Th1 immune response Th2 immune response Th17 immune response or Treg immune response.
- An enhanced Th1 immune response may include an increase in one or more of the cytokines associated with a Th1 immune response (such as IFNy), and an increase in activated macrophages.
- An enhanced Th1 immune response may include one or more of an increase in antigen specific IgG antibodies, especially lgG1 antibodies.
- the immunogenic composition or the vaccine of the invention may be in association (e.g. chemically or recombinantly linked, bound by affinity binding or a mixture of separate components) with one or more adjuvants and/or
- the vaccine according to the invention may include one or more pharmaceutically acceptable excipients or vehicles, such as water, saline, glycerol, ethanol, etc. Additionally, auxiliary substances, such as wetting or emulsifying agents, pH buffering substances, and the like, may be present in such vehicles. Adjuvants may specifically be used to enhance the effectiveness of the vaccine. Adjuvants may be added directly to the vaccine compositions or can be administered separately, either concurrently with or shortly after, administration of the vaccine.
- Suitable adjuvants include cytokines and similar compounds which help orchestrate an immune response to the immunogen. As used herein, the term
- cytokine is used as a generic name for a diverse group of soluble proteins and peptides which act as humoral regulators at nano-to picomolar concentrations and which, either under normal or pathological conditions, modulate the functional activities of individual cells and tissues. These proteins also mediate interactions between cells directly and regulate processes taking place in the extracellular environment.
- cytokines examples include IL-1 , IL-4, TNFa, IFNa, INFy, GM-CSF, G-CSF CpG oligonucleotides can also be used as an adjuvant in conjunction with presentation of respective epitopes.
- Other adjuvants include alum, (in)complete Freund's adjuvant, B. pertussis or its toxin, IC31 , etc.
- the components of the immunogenic composition i.e. the directed adjuvant component, e.g. the anti-CD32 moiety linked to the TLR9 ligand and the first peptidic alpha-helix, and the immunogen component, e.g. comprising the peptide immunogen linked to the second peptidic alpha-helix that matches the first one, as well as the immunogenic composition or the vaccine, or any of its binding moieties or ligands and the immunogen with our without the coil repeats may be obtained by various methods known in the art, e.g. by purification or isolation from cell culture, recombinant technology or by chemical synthesis.
- the immunogenic composition and/or the directed adjuvant component and/or the immunogen component thereof is produced as a recombinant polypeptide, such as by recombinant DNA technology.
- recombinant refers to a molecule or construct that does not naturally occur in a host cell.
- recombinant nucleic acid molecules contain two or more naturally-occurring sequences that are linked together in a way that does not occur naturally.
- a recombinant protein refers to a protein that is encoded and/or expressed by a recombinant nucleic acid.
- "recombinant cells” express genes that are not found in identical form within the native (i.e., non- recombinant) form of the cell and/or express native genes that are otherwise abnormally over-expressed, under-expressed, and/or not expressed at all due to deliberate human intervention.
- Recombinant cells contain at least one recombinant polynucleotide or polypeptide.
- "Recombination”, "recombining”, and generating a "recombined" nucleic acid generally encompass the assembly of at least two nucleic acid fragments.
- recombinant proteins and recombinant nucleic acids remain functional, i.e., retain their activity or exhibit an enhanced activity in the host cell.
- the invention further refers to the production of the immunogenic composition or the components thereof, and the recombinant means for such production, including a nucleic acid encoding the amino acid sequence, an expression cassette, a vector or plasmid comprising the nucleic acid encoding the amino acid sequence to be expressed, and a host cell comprising any such means.
- Suitable standard recombinant DNA techniques are known in the art and described inter alia in Sambrook et al., "Molecular Cloning: A Laboratory Manual” (1989), 2nd Edition (Cold Spring Harbor Laboratory press).
- sensibilizing vaccine is herein understood in the following way.
- a subject may undergo specific sensibilization to vaccine components apart from the immunogen, so to induce the specific humoral immune response.
- a subject is e.g. sensibilized by treatment with the sensibilizing vaccine according to the invention, which comprises the directed adjuvant and the peptidic alpha-helix, preferably the coiled coil or double-helix to stabilize the molecule.
- the immunogen as used in the immunoregulatory vaccine according to the invention is specifically not employed in such sensibilizing vaccine.
- the subject may develop the immune response against the epitopes of the sensibilizing vaccine.
- the further treatment of the same subject with the immunoregulatory vaccine according to the invention will then induce the specific immune response to the immunogen that is needed for treatment or prevention of the disease. Thanks to the sensibilization the potentially harmful existing immune memory to parts of the immunogen, e.g. in case allergic patients, will not induce unwanted immune reactions against those parts of the vaccine to which the patient is naive before immunization.
- subject is understood to comprise human or mammalian subjects, including livestock animals, companion animals, and laboratory animals, in particular human beings, which are either patients suffering from a specific disease condition or healthy subjects.
- the invention further provides a kit of components for preparing the
- kits can be used in the above- described methods.
- the kit further comprises instructions for using the components of the immunogenic composition or the prepared
- the vaccine components i.e. the directed adjuvant component and the immunogen component, as well as the vaccine, or any of its binding moieties or ligands and the immunogen with our without the coil repeats may be obtained by various methods known in the art, e.g. by purification or isolation from cell culture, recombinant technology or by chemical synthesis.
- the present invention provides for a unique vaccine and respective applications.
- the vaccine according to the invention comprises a recombinant polypeptide of
- N-terminal underlined sequence of ScFV specifically binding to CD32a
- Linker any alternative linker commonly used in scFv preparations may be used.
- Bold StrepTag II for purification, any alternative tag may be used, e.g. flag tag or HIS tag.
- pepE heptad repeat alpha helix
- pepK immunogen
- Similar polypeptides may comprise a leader sequence, the amino acid
- a specific anti-CD32 moiety which is e.g. a recombinant scFv, a linker, a tag for purification purposes and the sequence of the peptidic alpha-helix pepE.
- This construct with or without the TLR9 ligand is also called "warhead", which may then be used to construct a vaccine by combination with an immunogen linked to the counter alpha helix pepK.
- the anti-CD32 moiety is an anti-CD32a peptide with the sequence of SEQ ID 20: ADGAWAWVWLTETAVGAA used as an alternative to the ScFv.
- an immunogen containing coil comprising allergen, such as Der P1 and Der P2 T cell epitopes, is prepared.
- the peptidic alpha- helix is suitably linked to the immunogen by a linker to allow flexibility.
- a stable coiled coil is established between the warhead scFv and the immunogen.
- the immunogen containing coil is prepared which comprises about 29 different T cell epitopes of an allergen.
- T cells were effectively stimulated when the immunogen with the coil (the pepK coil) interacted with the warhead containing the counterpart coil (the pepE coil).
- a stable coiled coil is established between the warhead scFv and the immunogen.
- T cells were effectively stimulated when the immunogen with the coil (the pepK coil) interacted with the warhead containing the counterpart coil (the pepE coil).
- pancreatic cancer in a mouse model and in a rhesus monkey model is described, using a warhead employing either the anti-CD32 scFv or the anti-CD32a peptide linked by the coiled coil to the G13 peptide
- the present invention provides for a unique immunogenic
- composition and vaccine and respective applications.
- the foregoing description will be more fully understood with reference to the following examples. Such examples are, however, merely representative of methods of practicing one or more embodiments of the present invention and should not be read as limiting the scope of invention.
- IAA140-154 Linker may be changed to any linker used in ScFV preparation
- StrepTag II for purification may be exchanged to any type of tag e.g. flag tag or HIS tag.
- AA282-316 heptad repeat alpha helix (pepE) to form the coiled coil with the counter heptad repeat alpha helix in the immunogen (pepK).
- pepE heptad repeat alpha helix
- pepK immunogen
- a TRL9 agonist such as CpG may be coupled to the warhead using a chemical coupling e.g. using the Solulink antibody-oligo coupling KIT.
- a peptidic TRL9 agonist may be coupled using standard peptide chemistry.
- Example 2 Peptide Warhead containing coiled coii
- Amino acid sequence 2 (SEQ ID 22):
- Linkers may be changed to any linker also longer linkers to allow flexibility between the two connected sequences.
- StrepTag II for purification may be exchanged to any type of tag e.g. flag tag or HIS tag.
- AA34-68 heptad repeat alpha helix (pepE) to form the coiled coil with the counter heptad repeat alpha helix in the immunogen (pepK).
- pepE heptad repeat alpha helix
- pepK immunogen
- a TRL9 agonist such as CpG may be coupled to the warhead using chemical coupling e.g. using the Solulink antibody-oligo coupling KIT.
- a peptidic TRL9 agonist may be coupled using standard peptide chemistry.
- Example 3 Immunogen 3 containing coii (Der P1 and Der P2 T cell epitopes based on human Class II expression)
- Amino acid sequence 3 (SEQ ID 23):
- ALKE AA1 -6 His tag for purification may be exchanged to any type of tag e.g. flag tag or StrepTag II.
- Tag may also be positioned between linker and alpha helix see example 4). The C terminus is not preferred, since this may interfere with the functionality of the coiled coils.
- AA208-219 linker between allergen peptides and linker (may be exchanged for any other linker to allow flexibility between the two connected sequences.
- the underlined cysteine may be removed from the sequence.
- AA220-254 heptad repeat alpha helix (pepK) to form the coiled coil with the counter heptad repeat alpha helix in the warhead (pepE).
- pepK heptad repeat alpha helix
- pepE counter heptad repeat alpha helix in the warhead
- the minimal functional number of repeats for the coils used is 3 and 5 52-54 .
- AA6-54 T cell epitopes from Der p1 (AA181 -220 of native protein):
- AA55-88 T cell epitopes from Der p1 (95-128):
- AA89- 08 T cell epitopes from Der p2: (AA85-104 of native protein):
- AA 09-134 T cell epitopes from Der p2: (AA105-130 of native protein):
- AA135-183 T cell epitopes from Der p1 (AA228-276 of native protein):
- AA184-208 T cell epitopes from DerP2: (AA1 1 -45 of native protein):
- Example 4 Formation of a stable coiled coil between warhead ScFV and immunogen 3.
- Immunogen 3 was immobilized to a BIACore CM5 on flow cell 1 , 2, 3 chip using standard procedures resulting in -700 response units, subsequently warhead (10 g/ml in PBS) was injected into flow cell 1 and a time dependent mass increase was measured (on rate), after -160 seconds the buffer was changed to PBS only. The off rate indicates the stability of the binding between warhead and immunogen cell was injected with PBS only.
- warhead was preincubated with the pepK coil and subsequently injected into flow cell 2, no binding of warhead to the chip was seen.
- pep E flow cell 3
- Example 5 Immunogen 5-12 containing coil (-29 T eel! epitopes of Der p1, Der p2, Der p3, Der p4, Der p7, Der p9, Der p10, Der p11, Der p14, Der p15, based on human Class II expression) Amino acid sequence 3 (SEQ ID 30):
- His tag for purification may be exchanged to any type of tag e.g. flag tag or StrepTag II.
- Tag may also be positioned between linker and alpha helix see example 4). The C terminus is not preferred, since this may interfere with the functionality of the coiled coils.
- AA365-368 and 375-381 linkers between allergen peptides HIS tag and pepK.
- the linkers may be exchanged for any other linker to allow flexibility between the two connected sequences.
- the underlined cysteine (Cys379) is preferably removed from the sequence.
- AA382-416 heptad repeat alpha helix (pepK) to form the coiled coil with the counter heptad repeat alpha helix in the warhead (pepE).
- pepK heptad repeat alpha helix
- pepE counter heptad repeat alpha helix in the warhead
- the minimal functional number of repeats for the coils used is 3 and 5 55-57 .
- Warhead (based on ScFVcoiM IV.3 + ODNM362) is mixed with Immunogen 5- 12 in a ratio which indicates that 10% to 100% of warhead is bound to the immunogen by the coiled-coil structure, preferably wherein no free or less than 50% free immunogen, and formulated on Alum.
- the invention provides for a vaccine wherein the
- immunoregulatory vaccine of the invention comprises
- an immunogen that comprises or consists of the immunogen of SEQ ID 30 linked to the second alpha-helix, preferably SEQ ID 75, or a functionally active variant thereof, preferably a variant, wherein Cys379 is removed, or wherein the order of the allergen- derived peptides is changed,
- directed adjuvant and the immunogen are bound to each other by the coiled-coil structure formed by the first and second alpha-helices.
- T cell epitopes (there are 15 allergen derived peptides in immo5-12: 1 -2-3-4-5- 6-7-8-9-10-11 -12-13-14-15)
- the order of peptides derived from HDM allergens was optimized for solubility but any other order will be possible as well.
- E AH EQQ/K/ TTKL EAEAR (SEQ ID 34) Bold and italic are predicted T cell epitopes presented by HLA Class
- PBMC peripheral blood mononuclear cells
- Der p1 sensitized rhesus monkeys were cultured in triplicate with medium, 3 Der p1 or 3 and 5 g/ml immunogen 3 at 37 C / 5% C0 2 . in the presence of 20 U/ml IL-2.
- Proliferation was assayed by the incorporation of [ ⁇ HJ-thymidine (0.5 Ci/well) during the final 18 hrs of a 2 -day culture. Cells were harvested for ⁇ -scintillation counting (Topcount NXT, Packard, Ramsey, MN, USA). Results are shown as counts per minute.
- supernatants were assayed in duplicate for IL-10 and GM-CSF levels using a commercially-available ELISA kit (U-Cytech, Utrecht, The
- Example 7 WH mediated enhanced antigen presentation
- PBMC peripheral blood mononuclear cells
- Der p1 sensitized rhesus monkeys monkeys
- PBS preincubated 3 times with PBS or preincubated with PBS only and washed three times.
- these cells incubated (30 min on ice) with different concentrations of Immunogen 3 or Der p1 at 3 g/ml and washed 3 times with PBS after which the cells were culture at 37 ° C / 5% C0 2 in the presence of 20 U/ml IL-2 for 48 hours.
- As a positive control PBMCs (without warhead preincubation) were incubated with 3 g/ml Der P1 without washing and cultured at 37 ° C / 5% C0 2 in the presence of 20 U/ml IL-2.
- Proliferation was assayed by the incorporation of [3
- Cells were harvested for ⁇ -scintillation counting (Topcount NXT, Packard, Ramsey, MN, USA). Results are shown as counts per minute. See Figure 3.
- antigen needs to be internalized and processed by antigen presenting cells. This can be achieved by culturing the T cells and APC in the presence of antigen or by targeting the antigen to a cell surface receptor able to internalize and relocate into lysosomes 58"62 .
- Example 8 CpG mediated activation of autoimmune reactive T cells
- PBMC peripheral blood mononuclear cells
- rhesus monkeys monkeys
- normal human donors were incubated in triplicate with 50 ⁇ CpG or CpG-biot.
- PBMCs were preincubated (30 min on ice) 1 g/ml biotinylated warhead ScFV washed 3x and subsequently incubated with 50 ⁇ CpG.
- Supernatants were assayed in duplicate for IL-4 and IFN gamma levels using a commercially-available ELISA kit in accordance with the manufacturer's instructions. See Figure 4.
- CpG did not induce a specific T cell response in monkey or human cells (left bars) nor did it enhance or induce a T cell response against the biotinylated protein that was co administered (right bars). Only when CpG and biotin were physically linked (green bars) a specific response against biotin was induced. Since biotin (also called vitamin b7, vitamin H or vitamin B8) is a self molecule, no immune response should occur. However when biotin is presented by TLR9 activated APC T cell tolerance is broken indicating that physically linking a TLR9 agonist to as self protein is will lead to an immune response that in the case the self protein is a tumor associated antigen (TAA) can be used to treat cancer.
- TAA tumor associated antigen
- Physically linked means either directly coupled to the TAA or indirectly using the warhead and a TAA coupled with (or containing) a coil that interacts with the coil of the warhead. The latter is preferred. Any other form of complex between TRL9 agonist and TAA can be used as well, as long as it is assured that TLR9 agonist and TAA are taken up by the same APC.
- the warhead that is used for treatment of cancer should bind predominantly to CD32a and not to CD32b.
- the warhead from example 1 and 2 are preferred for use in cancer treatment.
- Example 10 Stimulation of Human PBMC with Immunogen 5-12 PBMC (100.000/well) of Der p1 sensitized normal donors were cultured in triplicate with medium, 3 g/ml Der p1 or 5, 1 or 0.5 pg/ml immunogen 5-12 (lmmo5-12) at 37 C / 5% C0 2 for 24h. Supernatants were assayed in duplicate for IL-10 and IFNg levels using a commercially-available ELISA kits (eBioscience) in accordance with the manufacturer's instructions. See Figure 5.
- Example 11 Treatment of auto-immune diseases
- a vaccine comprising a warhead that recognizes CD32a and CD32b a coiled coil and a TLR9 antagonist or an agonist that induces inhibitory TLR9 signalling
- CD32 binding region herein also called anti-CD32 moiety or CD32 binder CD32a binders:
- Anti-CD32a Peptide Berntzen et al. (J. Biol. Chem. (2009) 284: 1 126-1135):
- Antibody specifically binding to CD32a and CD32b mAb AT-10 (AbD Serotec) ScFV derived from mAb AT-10 (VH-linker-VL): (SEQ ID 46)
- hinge region may be omitted
- TLR9 binding region or moiety herein also called TLR9 binder or TLR9 liqand
- immunostimulatory peptides may be preferably used as a CpG mimic.
- functionally active variants thereof may be used, which are fragments, mutants, or hybrids, including combinations thereof.
- Functionally active variants are specifically characterized in that they stimulate pDCs, thereby inducing an increased level of IL-6 and/or TNFalpha and/or IFNalpha, as compared to a negative control.
- a) have at least 60% homology or sequence identity to any of the peptides of SEQ ID 73-91 , preferably at least 70%, at least 80% or at least 90%;
- b) are mutants of any of the peptides of SEQ ID 50-68, obtainable by modifying the parent amino acid sequence by insertion, deletion or substitution of one or more amino acids within the sequence or at either or both of the distal ends of the sequence, preferably less than 5, 4, 3, 2 or 1 point mutations; or c) are fragments of any of the peptides of SEQ ID 50-68 comprising at least 50% of the parent sequence, or at least 60%, at least 70%, at least 80%, or at least 90%; or at least 5 amino acids, preferably at least 6, at least 7, at least 8, at least 9, at least 10 or at least 11 amino acids.
- ODNM362 (SEQ ID 69)
- pepE coil plus C StrepTag II sequence and "GP" linker may be any flexible linker (StrepTag II may be removed or replaced by HIS Tag or any other tag)
- pepE coil plus at C StrepTag II sequence and "GP" Sinker may be any flexible linker (StrepTag II may be removed or replaced by HIS Tag or any other tag)
- pepE coil plus "GP" linker may be any flexible linker lgG1 Fc fragment-coil: (SEQ ID 73)
- PNSCDKTHTCPPCP PELLGGPSVFLFPPKPKDTLMISRTPEVTCVWDVSHEDPE VKFNWYVDGVEVHNAKTKPREEQYNSTYRWSVLTVLHQDWLNGKEYKCKVSNK ALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWE SNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNH YTQKS LS LS PGKGPEVSALEKEVSALEKEVSALEKEVSALEKEVSALEK
- hinge region may be omitted
- pepE coil plus "GP" linker may be any flexible linker
- ODN2216_SH (SEQ ID 48)
- ODNM362_SH (SEQ ID 69)
- Exemplary warhead i.e. a structure comprising a CD32 binder and a TLR9 binder
- Lysines in coil structure (Italic) are preferred.
- Lysines in coil structure are preferred 12.6.
- Exemplary immunogen herein also called antigen
- Immunogen 3 containing coil (Der P1 and Der P2 T cell epitopes based on human Class II expression)
- HIS tag (may be removed)
- a linker (can be any linker)
- Immunogen 5-12 containing coil (-29 T cell epitopes of Der p1 , Der p2, Der p3, Der p4, Der p7, Der p9, Der p10, Der p1 1 , Der p14, Der p15, based on human Class II expression)
- HIS tag (may be removed)
- a linker (can be any linker)
- the exemplary molecule complex is formed by chemical linkeage, fusion and/or affinity binding, in particular by a coiled-coil structure.
- Warhead (based on ScFVcoiM IV.3 + ODNM362) is mixed with Immunogen 5-12 in a ratio which indicates 90% of warhead is complexed with immunogen, no free immunogen (molar ratio of ⁇ 1 : 1 .5) and formulated on Alum.
- HDM healthy house dust mite
- Serum samples were tested in standard ELISA for IgG antibodies against warhead, immo 5-12 (lmmo5), Der p1 , Der p2, Der p5 and Der p7.
- the antigens were coated to maxisorb plates (1 g/ml I PBS) overnight at 4°C, washed twice, blocked with PBS 1 % BSA, washed twice incubated with the sera in a 1 :1000 dilution for 1 h at 4 °C, washed twice and subsequently detected with anti-human-lgG-PO (cross reactive with rhesus monkey IgG).
- PBMC peripheral blood mononuclear cells
- PBMC peripheral blood mononuclear cells
- Immunogen 2 g/ml
- Der p1 2 g/ml
- Der p2 2 g/ml
- Der p5 2 pg/ml
- Der p7 2 g/ml
- Proliferation was measured by [ 3 H]-thymidine (0.5 Ci/well) during the final 18 hrs of a 4 day culture.
- Cells were harvested for ⁇ -scintillation counting (Topcount NXT, Packerd, Ramsey, MN, USA). Net counts per minutes were calculated by subtracting the counts of the medium control from the counts induced by the different antigens.
- Immunization with SG100 induces a Th1 type memory response against the vaccine as indicated by the presence of IgG antibodies as well the induction of T cells which produce IFNy but not IL-4 when stimulated by warhead or lmmo5.
- IgG B cell memory
- Der p1 , Der p2, Der p5 or Der p7 was induced because the vaccine does not contain B ell epitopes from these allergens.
- Th1 type memory was induced against the T cell epitopes of the house dust mite allergens which are present in the vaccine Der p1 , Der p2, Der p7.
- Th1 type memory is induced against Der p5, which is not included in the vaccine.
- ScFV-coi! 1 (IV.3): (SEQ ID 70) EVQLQQSGPELKKPGETVKISCKASGYTFTNYGMNWVKQAPGKGLKWMGWLNT YTGESIYPDDFKGRFAFSSETSASTAYLQINNLKNEDMATYFCARGDYGYDDPLDY WGQGTSVTVSSGGGGSGGGGSGGGGSDIVMTQAAPSVPVTPGESVSISCRSSK SLLHTNGNTYLHWFLQRPGQSPQLLIYRMSVLASGVPDRFSGSGSGTAFTLSISR
- pepE coil plus C StrepTag II sequence and "GP" linker may be any flexible linker (StrepTag II may be removed or replaced by HIS Tag or any other tag)
- ODNM362_SH (SEQ ID 69)
- ODN-M362 may be coupled to any of the available lysines in ScFV-1 -coil Warhead (SG100):
- ScFV-1 -coil chemically linked with ODN-M362-SH.
- the preparation is a mix of ScFV-1 -coil linked with 1 to 18 molecules ODN-M362 preferred is a mix with 1 -6 molecules ODN-M362 coupled to ScFV-1 -coil. All these mixes may be named warhead or ScFv-1 -coil-M362.
- tumour associated antigens TAA
- a vaccine formulation that enables the immune system to generate a specific antibody and/or cellular immune response against an autoantigen is potentially suited for use as anti-tumour vaccination.
- the warhead of SG100 enables an autoimmune response:
- mice 24 mice (6/group) were immunized s.c. 2x with 35vg in 150 ⁇ ScFV-1 -coil or with warhead (ScFV-1 -coil-M362) either formulated on Alum or diluted in PBS.
- a TAA through high affinity interaction with pepE of the warhead, the warhead will be able to induce the necessary autoimmune response against the TAA.
- the complex of the warhead (ScFV-1 -coil-M362) with the TAA forms a potent vaccine for the treatment of cancer with over expression of the TAA in the vaccine.
- Such a vaccine may be formulated with any adjuvants, e.g. on Alum.
- Example 13 Using the technology platform in oncology, immunogen G17.
- G17RM_1 -coil SEQ ID 101 : pEGPWMEEEEAAY GGGSGGKVSALKEKVSALKEKVSALKEKVSALKEKVSALKEKVSALKE G17H_1 -coil, SEQ ID 102
- Warhead as described above is mixed with G17RM_1 -coil or G17H_1 -coil in a ratio which indicates 100 % of warhead is complexed with G17RM_1 -coil or G17H_1 -coil, without G17 free immunogen being present (molar ratio of ⁇ 1 : 1 ) and formulated on Alum. Thereby TYG100_1 RM and TYG100_1 H are produced.
- Example 14 TYG100 1 R for treatment of gastrin dependent cancer e.g. pancreatic cancer: 6 Balb/c Mice were immunized 3 times on day 0, day 14 and day 35 with
- mice responded with IgG against the 2 components of the vaccine (warhead and G17RM). Importantly all mice produced IgG that cross reacted with human G17 and to a lesser extend with mouse G17 (G17M). The latter is remarkable because the first 13 immuno acids of mouse G17 (pERPRMEEEE EAYG, SEQ ID 86) are different in 3 AA from G17RM (differences indicated as bold and underlined) and G17M is an autoantigen for the mouse. The antibodies recognizing G17M are therefore autoantibodies, indicating that TYG100_1 RM has been able to break the natural tolerance against the auto-antigen G17M. There was no response against G17 when the G17-peptide was immunized without the warhead.
- tumour associated antigens are auto- antigens which are over expressed, e.g. overexpressed on tumour cells.
- TAA tumour associated antigens
- a vaccine composed of the warhead of TYG100_1 RM combined with human G17 as immunogen can be used as vaccine for the treatment of gastrin dependent tumours such as pancreatic cancer.
- Example 15 Exemplary products including a dimer of the peptide immache
- a dimer of G17RM (1 st 13 AA of little gastrin) was chemically synthesized using special flexible linker connecting the 2 peptides to one pepK coil
- G17RM 2-coil (SEQ ID 103: Part of an immunogenic composition of the invention, comprising two rhesus monkey gastrin peptides of SEQ ID 99, a branched linker sequence and a peptide alpha-helix (TYG100_2R ). This part may be linked to the suitable directed adjuvant by a coiled-coil linkage) pEGPWMEEEEAAYG
- pEGPWMEEEEAAYG in bold a special flexible linker (can be any linker that connects three peptides) In italics the pepK coil for interaction with warhead
- G17H 2-coil (SEQ ID 88: Part of an immunogenic composition of the invention, comprising two human gastrin peptides of SEQ ID 86, a branched linker sequence and a peptide alpha-helix (TYG100_2H). This part may be linked to the suitable directed adjuvant by a coiled-coil linkage) pEGPWLEEEEEAYG GG
- pEGPWLEEEEEAYG GG in bold a special flexible linker (can be any linker that connects three peptides) In italics the pepK coil for interaction with warhead Final product TYG100 2RM and TYG100 2H
- Warhead as described above (based on ScFV-coiM ; IV.3) is mixed with G17RM 2- coil or G17H_2-coil in a ratio which indicates 100 % of warhead is complexed with G17RM_2-coil or G17H_2-coil immunogen, without G17 free immunogen being present (molar ratio of - 1 : 1 ) and formulated on Alum. Thereby TYG100_2RM and TYG100_2H are produced.
- Example 16 TYG100 2RM for treatment of gastrin dependent cancer e.g. pancreatic cancer:
- mice responded with IgG against the 2 components of the vaccine (warhead and G17RM). Importantly all mice produced IgG that cross reacted with human G17 and to a lesser extend with mouse G17 (G17M). The latter is remarkable because the first 13 immuno acids of mouse G17 (pERPRMEEEE EAYG, SEQ ID 86) is different in 3 AA from G17RM (differences indicated as bold and underlined) and G17M is an auto antigen for the mouse.
- the antibodies recognizing G17M are therefore autoantibodies, indicating that TYG100_2RM has been able to break the natural tolerance against the auto-antigen G17M. There was no response against G17when the G17 peptide was immunized without the warhead.
- tumour associated antigens are auto- antigens which are over expressed on tumour cells.
- TAA tumour associated antigens
- a vaccine composed of the warhead of TYG100_2RM combined with human G17 as immunogen can be used as vaccine for the treatment of gastrin dependent tumours such as pancreatic cancer.
- the responses against all 3 types of G17 induced by TYG100_2R were stronger than those induced by TYG100_1 RM (table 2), indicating that the dimer is preferred in the vaccine.
- Example 17 TYG100 2RM for treatment of gastrin dependent cancer e.g. pancreatic cancer:
- G17RM little gastrin from humans (G17H), an irrelevant control peptide of similar MW as gastrin (control peptide) or against warhead (ScFV-coiM ) using the multiplex ELISA system of Meso Scale Discovery (MSD) according to the MSD manual.
- MSD Meso Scale Discovery
- tumour associated antigens are auto-antigens which are over-expressed, e.g. overexpressed on tumour cells but also present at lower expression levels on normal healthy cells.
- a vaccine such as TYG100_2RM or TYG100_2H can be used for the treatment of gastrin dependent tumours such as pancreatic cancer.
- Example 14 The animals from Example 14 were monitored for their appetite and body weight was measured on dO, d14, d28, d42, and d56. After two injections with
- TYG100_2RM reduces craving for snacks (in between food) without influencing basic food intake needed for a healthy life.
- the animals were normally active and happy. Therefore, TYG100_2RM may be used for treatment of obesity.
- pancreatic cancer Trends in pharmacological sciences 32:201 -205.
- Toll-like receptor 9 can be expressed at the cell surface of distinct populations of tonsils and human peripheral blood mononuclear cells. Infect. Immun. 72:7202-721 1 . 13. Saikh,K.U., T.L.Kissner, A.Sultana, G.Ruthel, and R.G.Ulrich. 2004. Human monocytes infected with Yersinia pestis express cell surface TLR9 and differentiate into dendritic cells. J. Immunol. 173:7426-7434.
- oligonucleotides that combine B cell activation with high IFN-a induction in piasmacytoid dendritic cells. Eur. J. Immunol. 33:1633-1641 .
- oligonucleotides that combine B cell activation with high IFN-a induction in piasmacytoid dendritic cells. Eur. J. Immunol. 33:1633-1641 .
- Deoxycytidyl-deoxyguanosine oligonucleotide classes A, B, and C induce distinct cytokine gene expression patterns in rhesus monkey peripheral blood mononuclear cells and distinct alpha interferon responses in TLR9-expressing rhesus monkey piasmacytoid dendritic cells. Clin Diagn. Lab Immunol 12:606-621 .
- TLR9 and TLR7 agonists mediate distinct type I IFN responses in humans and nonhuman primates in vitro and in vivo. J Leukoc. Biol. 91 :147-158.
- oligonucleotides that combine B cell activation with high IFN-a induction in piasmacytoid dendritic cells. Eur. J. Immunol. 33:1633-1641 .
- oligonucleotides that combine B cell activation with high IFN-a induction in piasmacytoid dendritic cells. Eur. J. Immunol. 33:1633-1641 .
- TLR9 and TLR7 agonists mediate distinct type I IFN responses in humans and nonhuman primates in vitro and in vivo. J Leukoc. Biol. 91 :147-158.
- TLR9 and TLR7 agonists mediate distinct type I IFN responses in humans and nonhuman primates in vitro and in vivo. J Leukoc. Biol. 91 :147-158.
- TLR9 and TLR7 agonists mediate distinct type I IFN responses in humans and nonhuman primates in vitro and in vivo. J Leukoc. Biol. 91 :147-158.
- Deoxycytidyl-deoxyguanosine oligonucleotide classes A, B, and C induce distinct cytokine gene expression patterns in rhesus monkey peripheral blood mononuclear cells and distinct alpha interferon responses in TLR9-expressing rhesus monkey plasmacytoid dendritic cells.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Immunology (AREA)
- Epidemiology (AREA)
- Mycology (AREA)
- Microbiology (AREA)
- Oncology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Organic Chemistry (AREA)
- Developmental Biology & Embryology (AREA)
- Cell Biology (AREA)
- Dermatology (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Reproductive Health (AREA)
- Pregnancy & Childbirth (AREA)
- Gynecology & Obstetrics (AREA)
- Communicable Diseases (AREA)
- Transplantation (AREA)
- Rheumatology (AREA)
- Molecular Biology (AREA)
- Virology (AREA)
- Pulmonology (AREA)
- Urology & Nephrology (AREA)
- Obesity (AREA)
- Hematology (AREA)
- Diabetes (AREA)
- Child & Adolescent Psychology (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Peptides Or Proteins (AREA)
Priority Applications (9)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CA2878771A CA2878771C (en) | 2012-07-13 | 2013-07-02 | Immunoregulatory vaccine |
| RU2014152908A RU2650709C2 (ru) | 2012-07-13 | 2013-07-02 | Иммунорегуляторная вакцина |
| US14/414,337 US10434170B2 (en) | 2012-07-13 | 2013-07-02 | Immunoregulatory vaccine |
| JP2015520903A JP6466327B2 (ja) | 2012-07-13 | 2013-07-02 | 免疫調節ワクチン |
| EP13732967.8A EP2872169B1 (en) | 2012-07-13 | 2013-07-02 | Immunoregulatory vaccine |
| CN201380037510.XA CN104487083B (zh) | 2012-07-13 | 2013-07-02 | 免疫调节疫苗 |
| AU2013289372A AU2013289372B2 (en) | 2012-07-13 | 2013-07-02 | Immunoregulatory vaccine |
| ES13732967T ES2897793T3 (es) | 2012-07-13 | 2013-07-02 | Vacuna inmunorreguladora |
| BR112015000483-0A BR112015000483B1 (pt) | 2012-07-13 | 2013-07-02 | Vacina imunorreguladora ou sensibilizante, kit para preparar a vacina e metodo usado para preparar a vacina para desencadear uma resposta imune do igg |
Applications Claiming Priority (6)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP12176348 | 2012-07-13 | ||
| EP12176348.6 | 2012-07-13 | ||
| EP13158410 | 2013-03-08 | ||
| EP13158410.4 | 2013-03-08 | ||
| EP13168578 | 2013-05-21 | ||
| EP13168578.6 | 2013-05-21 |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2014009209A2 true WO2014009209A2 (en) | 2014-01-16 |
| WO2014009209A3 WO2014009209A3 (en) | 2014-04-17 |
Family
ID=48741164
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/EP2013/063959 Ceased WO2014009209A2 (en) | 2012-07-13 | 2013-07-02 | Immunoregulatory vaccine |
Country Status (9)
| Country | Link |
|---|---|
| US (1) | US10434170B2 (cg-RX-API-DMAC7.html) |
| EP (1) | EP2872169B1 (cg-RX-API-DMAC7.html) |
| JP (1) | JP6466327B2 (cg-RX-API-DMAC7.html) |
| CN (3) | CN109806388B (cg-RX-API-DMAC7.html) |
| AU (1) | AU2013289372B2 (cg-RX-API-DMAC7.html) |
| BR (1) | BR112015000483B1 (cg-RX-API-DMAC7.html) |
| ES (1) | ES2897793T3 (cg-RX-API-DMAC7.html) |
| RU (1) | RU2650709C2 (cg-RX-API-DMAC7.html) |
| WO (1) | WO2014009209A2 (cg-RX-API-DMAC7.html) |
Cited By (11)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2014187743A1 (en) * | 2013-05-21 | 2014-11-27 | Tyg Oncology Ltd. | Gastrin peptide immunogenic composition |
| WO2016184862A1 (en) | 2015-05-18 | 2016-11-24 | Oncoqr Ml Gmbh | Her2/neu immunogenic composition |
| WO2017037158A1 (en) * | 2015-09-01 | 2017-03-09 | Oncoqr Ml Gmbh | Coiled-coil connector |
| WO2017181128A1 (en) * | 2016-04-15 | 2017-10-19 | Dynavax Technologies Corporation | Intratumoral administration of particles containing a toll-like receptor 9 agonist and a tumor antigen for treating cancer |
| WO2019086694A1 (en) | 2017-11-06 | 2019-05-09 | Geert Mudde | Il31 antigen and vaccine |
| WO2022067394A1 (en) * | 2020-09-30 | 2022-04-07 | Newsouth Innovations Pty Limited | Antigen-binding fragments and uses thereof |
| US11338027B2 (en) | 2016-09-21 | 2022-05-24 | Amal Therapeutics Sa | Fusion comprising a cell penetrating peptide, a multi epitope and a TLR peptide agonist for treatment of cancer |
| WO2023052447A3 (en) * | 2021-09-29 | 2023-06-08 | Alligator Bioscience Ab | Methods and compositions |
| WO2024238558A1 (en) * | 2023-05-15 | 2024-11-21 | Tallac Therapeutics, Inc. | Use of immunomodulating targeted polynucleotide conjugates for use with immune honing agent |
| US12178788B2 (en) | 2015-03-16 | 2024-12-31 | Amal Therapeutics Sa | Complex comprising a cell penetrating peptide, a cargo and a TLR peptide agonist |
| US12214048B2 (en) | 2016-03-16 | 2025-02-04 | Amal Therapeutics Sa | Combination of an immune checkpoint modulator and a complex comprising a cell penetrating peptide, a cargo and a TLR peptide agonist for use in medicine |
Families Citing this family (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11826422B2 (en) | 2016-11-09 | 2023-11-28 | Board Of Regents, The University Of Texas System | Methods and compositions for adaptive immune modulation |
| CN112480272A (zh) * | 2020-12-29 | 2021-03-12 | 上海纳米技术及应用国家工程研究中心有限公司 | 一种新型重组免疫细胞因子及其制备方法和应用 |
Citations (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP0178085A1 (en) | 1984-09-17 | 1986-04-16 | International Institute Of Cellular And Molecular Pathology (Icp) | Treatment of allergy |
| EP0287361A2 (en) | 1987-04-16 | 1988-10-19 | International Institute Of Cellular And Molecular Pathology (Icp) | Treatment of allergy and composition therefor |
| US5023077A (en) | 1989-01-24 | 1991-06-11 | Aphton Corporation | Immunogenic compositions and methods for the treatment and prevention of gastric and duodenal ulcer disease |
| WO1997007218A1 (en) | 1995-08-16 | 1997-02-27 | Novartis Ag | Allergen-xcd32 fusion proteins |
| US5609870A (en) | 1989-01-24 | 1997-03-11 | Aphton Corporation | Methods for the preparation of immunogens against gastrin |
| WO2007098934A1 (en) | 2006-03-03 | 2007-09-07 | F-Star Biotechnologische Forschungs- Und Entwicklungsges.M.B.H. | Bispecific molecule binding tlr9 and cd32 and comprising a t cell epitope for treatment of allergies |
Family Cites Families (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2010092963A1 (ja) * | 2009-02-10 | 2010-08-19 | 国立大学法人 琉球大学 | 薬物運搬体並びにこれを利用したアジュバントおよびワクチン |
-
2013
- 2013-07-02 RU RU2014152908A patent/RU2650709C2/ru active
- 2013-07-02 WO PCT/EP2013/063959 patent/WO2014009209A2/en not_active Ceased
- 2013-07-02 CN CN201811267771.1A patent/CN109806388B/zh active Active
- 2013-07-02 US US14/414,337 patent/US10434170B2/en active Active
- 2013-07-02 AU AU2013289372A patent/AU2013289372B2/en active Active
- 2013-07-02 CN CN201380037510.XA patent/CN104487083B/zh active Active
- 2013-07-02 EP EP13732967.8A patent/EP2872169B1/en active Active
- 2013-07-02 CN CN201811267750.XA patent/CN109806387B/zh active Active
- 2013-07-02 JP JP2015520903A patent/JP6466327B2/ja active Active
- 2013-07-02 BR BR112015000483-0A patent/BR112015000483B1/pt active IP Right Grant
- 2013-07-02 ES ES13732967T patent/ES2897793T3/es active Active
Patent Citations (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP0178085A1 (en) | 1984-09-17 | 1986-04-16 | International Institute Of Cellular And Molecular Pathology (Icp) | Treatment of allergy |
| EP0287361A2 (en) | 1987-04-16 | 1988-10-19 | International Institute Of Cellular And Molecular Pathology (Icp) | Treatment of allergy and composition therefor |
| US5023077A (en) | 1989-01-24 | 1991-06-11 | Aphton Corporation | Immunogenic compositions and methods for the treatment and prevention of gastric and duodenal ulcer disease |
| US5609870A (en) | 1989-01-24 | 1997-03-11 | Aphton Corporation | Methods for the preparation of immunogens against gastrin |
| WO1997007218A1 (en) | 1995-08-16 | 1997-02-27 | Novartis Ag | Allergen-xcd32 fusion proteins |
| WO2007098934A1 (en) | 2006-03-03 | 2007-09-07 | F-Star Biotechnologische Forschungs- Und Entwicklungsges.M.B.H. | Bispecific molecule binding tlr9 and cd32 and comprising a t cell epitope for treatment of allergies |
Non-Patent Citations (48)
| Title |
|---|
| ABE,K.; Y.WANG; L.FRITTS; E.SANCHEZ; E.CHUNG; P.FITZGERALD-BOCARSLY; A.M.KRIEG; C.J.MILLER: "Deoxycytidyl-deoxyguanosine oligonucleotide classes A, B, and C induce distinct cytokine gene expression patterns in rhesus monkey peripheral blood mononuclear cells and distinct alpha interferon responses in TLR9-expressing rhesus monkey plasmacytoid dendritic cells", CLIN DIAGN. LAB IMMUNOL, vol. 12, 2005, pages 606 - 621 |
| ARNDT,K.M.; K.M.MULLER; A.PLUCKTHUN: "Helix-stabilized Fv (hsFv) antibody fragments: substituting the constant domains of a Fab fragment for a heterodimeric coiled-coil domain", J MOL. BIOL., vol. 312, 2001, pages 221 - 228 |
| ASHMAN,R.F.; J.A.GOEKEN; E.LATZ; P.LENERT.: "Optimal oligonucleotide sequences for TLR9 inhibitory activity in human cells: lack of correlation with TLR9 binding", INT. IMMUNOL., vol. 23, 2011, pages 203 - 214 |
| BERNTZEN ET AL., J. BIOL. CHEM., vol. 284, 2009, pages 1126 - 1135 |
| BERNTZEN,G.; J.T.ANDERSEN; K.USTGARD; T.E.MICHAELSEN; S.A.MOUSAVI; J.D.QIAN; P.E.KRISTIANSEN; V.LAUVRAK; I.SANDLIE: "Identification of a high affinity Fcgamma RI IA binding peptide that distinguishes Fcgamma RIlA from Fcgamma RIIB and exploits Fcgamma RIIA mediated phagocytosis and degradation", J. BIOL. CHEM., vol. 284, 2009, pages 1126 - 1135 |
| BRETT,B.T.; S.C.SMITH; C.V.BOUVIER; D.MICHAELI; D.HOCHHAUSER; B.R.DAVIDSON; T.R.KURZAWINSKI; A.F.WATKINSON; S.N.VAN; R.E.POUNDER: "Phase II study of anti-gastrin-17 antibodies, raised to G17DT, in advanced pancreatic cancer", J CLIN ONCOL, vol. 20, 2002, pages 4225 - 4231 |
| CHAO,H.; D.L.BAUTISTA; J.LITOWSKI; R.T.IRVIN; R.S.HODGES: "Use of a heterodimeric coiled-coil system for biosensor application and affinity purification", J. CHROMATOGR. B BIOMED. SCI. APPL, vol. 715, 1998, pages 307 - 329 |
| CHAO,H.; D.L.BAUTISTA; J.LITOWSKI; R.T.IRVIN; R.S.HODGES: "Use of a heterodimeric coiled-coil system for biosensor application and affinity purification", J. CHROMATOGR. B BIOMED. SCI. APPL., vol. 715, 1998, pages 307 - 329 |
| CHEEVER,M.A.; C.S.HIGANO: "PROVENGE (Sipuleucel-T) in prostate cancer: the first FDA-approved therapeutic cancer vaccine", CLIN. CANCER RES., vol. 17, 2011, pages 3520 - 3526 |
| CICCOTOSTO,G.D.; J.K.DAWBORN; K.J.HARDY; A.SHULKES: "Gastrin processing and secretion in patients with end-stage renal failure", J CLIN ENDOCRINOL. METAB, vol. 81, 1996, pages 3231 - 3238 |
| EATON-BASSIRI,A.; S.B.DILLON; M.CUNNINGHAM; M.A.RYCYZYN; J.MILLS; R.T.SARISKY; M.L.MBOW: "Toll-like receptor 9 can be expressed at the cell surface of distinct populations of tonsils and human peripheral blood mononuclear cells", INFECT. IMMUN., vol. 72, 2004, pages 7202 - 7211 |
| GREENMAN,J.; A.L.TUTT; A.J.GEORGE; K.A.PULFORD; G.T.STEVENSON; M.J.GLENNIE: "Characterization of a new monoclonal anti-Fc gamma RII antibody, AT10, and its incorporation into a bispecific F(ab')2 derivative for recruitment of cytotoxic effectors", MOL. IMMUNOL, vol. 28, 1991, pages 1243 - 1254 |
| HARTMANN,G.; J.BATTIANY; H.POECK; M.WAGNER; M.KERKMANN; N.LUBENOW; S.ROTHENFUSSER; S.ENDRES: "Rational design of new CpG oligonucleotides that combine B cell activation with high IFN-a induction in plasmacytoid dendritic cells", EUR. J. IMMUNOL., vol. 33, 2003, pages 1633 - 1641 |
| HARTMANN,G.; J.BATTIANY; H.POECK; M.WAGNER; M.KERKMANN; N.LUBENOW; S.ROTHENFUSSER; S.ENDRES: "Rational design of new CpG oligonucleotides that combine B cell activation with high IFN-a induction in plasmacytoid dendritic cells", EUR. J. LMMUNOL., vol. 33, 2003, pages 1633 - 1641 |
| HARTMANN,G.; J.BATTIANY; H.POECK; M.WAGNER; M.KERKMANN; N.LUBENOW; S.ROTHENFUSSER; S.ENDRES: "Rational design of new CpG oligonucleotides that combine B cell activation with high IFN-alpha induction in plasmacytoid dendritic cells", EUR J IMMUNOL., vol. 33, 2003, pages 1633 - 1641 |
| KRIEG,A.M.; A.K.YI; S.MATSON; T.J.WALDSCHMIDT; G.A.BISHOP; R.TEASDA; G.A.KORETZKY; D.M.KLINMAN: "CpG motifs in bacterial DNA trigger direct B-cell activation", NATURE, vol. 374, 1995, pages 546 - 549 |
| KRUG,A.; S.ROTHENFUSSER; V.HORNUNG; B.JAHRSDORFER; S.BLACKWELL; Z.K.BALLAS; S.ENDRES; A.M.KRIEG; G.HARTMANN: "Identification of CpG oligonucleotide sequences with high induction of IFN-alpha/beta in plasmacytoid dendritic cells", EUR J IMMUNOL., vol. 31, 2001, pages 2154 - 2163 |
| LINLEY,A.J.; M.AHMAD; R.C.REES: "Tumour-associated antigens: considerations for their use in tumour immunotherapy", INT. J. HEMATOL., vol. 93, 2011, pages 263 - 273 |
| LITOWSKI,J.R.; R.S.HODGES.: "Designing heterodimeric two-stranded alpha-helical coiled-coils. Effects of hydrophobicity and alpha-helical propensity on protein folding, stability, and specificity", J. BIOL. CHEM., vol. 277, 2002, pages 37272 - 37279 |
| LITOWSKI,J.R.; R.S.HODGES: "Designing heterodimeric two-stranded alpha-helical coiled-coils. Effects of hydrophobicity and alpha-helical propensity on protein folding, stability, and specificity", J. BIOL. CHEM., vol. 277, 2002, pages 37272 - 37279 |
| LITOWSKI,J.R.; R.S.HODGES: "Designing heterodimeric two-stranded alpha-helical coiled-coils: the effect of chain length on protein folding, stability and specificity", J. PEPT. RES., vol. 58, 2001, pages 477 - 492 |
| LOONEY,R.J.; G.N.ABRAHAM; C.L.ANDERSON: "Human monocytes and U937 cells bear two distinct Fc receptors for IgG", J IMMUNOL., vol. 136, 1986, pages 1641 - 1647 |
| LUND,J.; A.SATO; S.AKIRA; R.MEDZHITOV; A.IWASAKI: "Toll-like receptor 9- mediated recognition of herpes simplex virus-2 by plasmacytoid dendritic cells", J. EXP. MED., vol. 198, 2003, pages 513 - 520 |
| MACINTYRE,E.A.; P.J.ROBERTS; R.BDUL-GAFFAR; K.O'FLYNN; G.R.PILKINGTON; F.FARACE; J.MORGAN; D.C.LINCH: "Mechanism of human monocyte activation via the 40-kDa Fc receptor for IgG", J IMMUNOL., vol. 141, 1988, pages 4333 - 4343 |
| MATHIS,D.; C.BENOIST.: "Back to central tolerance", IMMUNITY, vol. 20, 2004, pages 509 - 516 |
| MAURER,D.; C.EBNER; B.REININGER; E.FIEBIGER; D.KRAFT; J.-P.KINET; G.STINGL.: "The high affinity IgE receptor (Fc?RI) mediates IgE-dependent allergen presentation", J. IMMUNOL., vol. 154, 1995, pages 6285 - 6290 |
| MILLER,J.F.A.P.; G.MORAHAN.: "Peripheral T cell tolerance", ANNU. REV. IMMUNOL., vol. 10, 1992, pages 51 - 69 |
| MORTON,M.; G.C.PRENDERGAST; T.D.BARRETT: "Targeting gastrin for the treatment of gastric acid related disorders and pancreatic cancer", TRENDS IN PHARMACOLOGICAL SCIENCES, vol. 32, 2011, pages 201 - 205 |
| MUDDE,G.C.; F.C.VAN REIJSEN; G.J.BOLAND; G.C.DE GAST; P.L.B.BRUIJNZEEL; C.A.F.M.BRUIJNZEE-KOOMEN: "Allergen presentation by epidermal Langerhans' cells from patients with atopic dermatitis is mediated by IgE", IMMUNOLOGY, vol. 69, 1990, pages 335 - 341 |
| MUDDE,G.C.; I.G.REISCHL; N.CORVAÏA; A.HREN; E.-M.PÖLLABAUER: "Antigen presentation in allergic sensitization", IMMUNOL. CELL BIOL., vol. 74, 1996, pages 167 - 173 |
| PLITAS,G.; B.M.BURT; H.M.NGUYEN; Z.M.BAMBOAT; R.P.DEMATTEO: "Toll- like receptor 9 inhibition reduces mortality in polymicrobial sepsis", J. EXP. MED., vol. 205, 2008, pages 1277 - 1283 |
| PUIG,M.; K.W.TOSH; L.M.SCHRAMM; L.T.GRAJKOWSKA; K.D.KIRSCHMAN; C.TAMI; J.BEREN; R.L.RABIN; D.VERTHELYI: "TLR9 and TLR7 agonists mediate distinct type I IFN responses in humans and nonhuman primates in vitro and in vivo", J LEUKOC. BIOL., vol. 91, 2012, pages 147 - 158 |
| PUIG,M.; K.W.TOSH; L.M.SCHRAMM; L.T.GRAJKOWSKA; K.D.KIRSCHMAN; C.TAMI; J.BEREN; R.L.RABIN; D.VERTHELYI: "TLR9 and TLR7 agonists mediate distinct type I IFN responses in humans and nonhuman primates in vitro and in vivo.", J LEUKOC. BIOL., vol. 91, 2012, pages 147 - 158 |
| RENGIFO-CAM,W.; P.SINGH: "Role of progastrins and gastrins and their receptors in GI and pancreatic cancers: targets for treatment", CURR. PHARM. DES, vol. 10, 2004, pages 2345 - 2358 |
| SAIKH,K.U.; T.L.KISSNER; A.SULTANA; G.RUTHEL; R.G.ULRICH: "Human monocytes infected with Yersinia pestis express cell surface TLR9 and differentiate into dendritic cells", J. IMMUNOL., vol. 173, 2004, pages 7426 - 7434 |
| SALLUSTO,F.; A.LANZAVECCHIA: "Efficient presentation of soluble antigen by cultured human dendritic cells is maintained by granulocyte/macrophage colony- stimulating factor plus interleukin 4 and downregulated by tumor necrosis factor a", J. EXP. MED., vol. 179, 1994, pages 1109 - 1118 |
| SAMBROOK ET AL.: "Molecular Cloning: A Laboratory Manual", 1989, COLD SPRING HARBOR LABORATORY PRESS |
| SANTAMARIA,L.F.; R.BHEEKHA; F.C.VAN REIJSEN; M.T.PEREZ SOLER; M.SUTER; C.A.F.M.BRUIJNZEE-KOOMEN; G.C.MUDDE: "Antigen focusing by specific monomeric immunoglobulin E bound to CD23 on Epstein-Barr virus- transformed B cells", HUM. IMMUNO/., vol. 37, 1993, pages 23 - 30 |
| See also references of EP2872169A2 |
| STUART ET AL., J. EXP. MED., vol. 166, 1987, pages 1668 |
| TAFURI,A.; J.ALFERINK; P.MÖLLER; G.J.HÄMMERLING; B.ARNOLD.: "T cell awareness of paternal alloantigens during pregnancy", SCIENCE, vol. 270, 1995, pages 630 - 633 |
| TANAKA,J.; K.SUGIMOTO; K.SHIRAKI; M.TAMEDA; S.KUSAGAWA; K.NOJIRI; T.BEPPU; K.YONEDA; N.YAMAMOTO; K.UCHIDA: "Functional cell surface expression of toll-like receptor 9 promotes cell proliferation and survival in human hepatocellular carcinomas", INT. J ONCOL., vol. 37, 2010, pages 805 - 814 |
| TEL,J.; N.BEENHAKKER; G.KOOPMAN; B.HART; G.C.MUDDE; V.DE: "Targeted delivery of CpG ODN to CD32 on human and monkey plasmacytoid dendritic cells augments IFNalpha secretion", IMMUNOBIOLOGY, vol. 217, 2012, pages 1017 - 1024 |
| TEL,J.; N.BEENHAKKER; G.KOOPMAN; B.HART; G.C.MUDDE; V.DE: "Targeted delivery of CpG ODN to CD32 on human and monkey plasmacytoid dendritic cells augments IFNalpha secretion", LMMUNOBIOLOGY, vol. 217, 2012, pages 1017 - 1024 |
| TVERSKY,J.R.; A.P.BIENEMAN; K.L.CHICHESTER; R.G.HAMILTON; J.T.SCHROEDER: "Subcutaneous allergen immunotherapy restores human dendritic cell innate immune function", CLIN. EXP. ALLERGY, vol. 40, 2010, pages 94 - 102 |
| VAN REIJSEN,F.C.; C.A.F.M.BRUIJNZEEL-KOOMEN; F.S.KALTHOFF; E.MAGGI; S.ROMAGNANI; J.K.T.WESTLAND; G.C.MUDDE: "Skin-derived aeroallergen-specific T-cell clones of Th2 phenotype in patients with atopic dermatitis", J. ALLERGY CLIN. LMMUNOL., vol. 90, 1992, pages 184 - 193 |
| WATSON,S.A.; D.MICHAELI; T.M.MORRIS; P.CLARKE; A.VARRO; N.GRIFFIN; A.SMITH; T.JUSTIN; J.D.HARDCASTLE: "Antibodies raised by gastrimmune inhibit the spontaneous metastasis of a human colorectal tumour, APSLV", EUR J CANCER, vol. 35, 1999, pages 1286 - 1291 |
| WATSON,S.A.; T.M.MORRIS; D.F.MCWILLIAMS; J.HARRIS; S.EVANS; A.SMITH; P.A.CLARKE: "Potential role of endocrine gastrin in the colonic adenoma carcinoma sequence", BR. J CANCER, vol. 87, 2002, pages 567 - 573 |
Cited By (19)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| JP2016523837A (ja) * | 2013-05-21 | 2016-08-12 | ティーワイジー・オンコロジー・リミテッド | ガストリンペプチド免疫原組成物 |
| WO2014187743A1 (en) * | 2013-05-21 | 2014-11-27 | Tyg Oncology Ltd. | Gastrin peptide immunogenic composition |
| US10328134B2 (en) | 2013-05-21 | 2019-06-25 | Tyg Oncology Ltd. | Gastrin peptide immunogenic composition |
| US12178788B2 (en) | 2015-03-16 | 2024-12-31 | Amal Therapeutics Sa | Complex comprising a cell penetrating peptide, a cargo and a TLR peptide agonist |
| US12453762B2 (en) | 2015-03-16 | 2025-10-28 | Amal Therapeutics Sa | Complex comprising a cell penetrating peptide, a cargo and a TLR peptide agonist for treatment of glioblastoma |
| US12220450B2 (en) | 2015-03-16 | 2025-02-11 | Amal Therapeutics Sa | Complex comprising a cell penetrating peptide, a cargo and a TLR peptide agonist for treatment of colorectal cancer |
| WO2016184862A1 (en) | 2015-05-18 | 2016-11-24 | Oncoqr Ml Gmbh | Her2/neu immunogenic composition |
| US11154599B2 (en) | 2015-05-18 | 2021-10-26 | Oncoqr Ml Gmbh | Her2/neu immunogenic composition |
| WO2017037158A1 (en) * | 2015-09-01 | 2017-03-09 | Oncoqr Ml Gmbh | Coiled-coil connector |
| JP2018528214A (ja) * | 2015-09-01 | 2018-09-27 | オンコクール・エムエル・ゲーエムベーハー | コイルドコイルコネクタ |
| US11090381B2 (en) | 2015-09-01 | 2021-08-17 | Oncoqr Ml Gmbh | Coiled-coil connector |
| US12214048B2 (en) | 2016-03-16 | 2025-02-04 | Amal Therapeutics Sa | Combination of an immune checkpoint modulator and a complex comprising a cell penetrating peptide, a cargo and a TLR peptide agonist for use in medicine |
| WO2017181128A1 (en) * | 2016-04-15 | 2017-10-19 | Dynavax Technologies Corporation | Intratumoral administration of particles containing a toll-like receptor 9 agonist and a tumor antigen for treating cancer |
| US11338027B2 (en) | 2016-09-21 | 2022-05-24 | Amal Therapeutics Sa | Fusion comprising a cell penetrating peptide, a multi epitope and a TLR peptide agonist for treatment of cancer |
| US12220387B2 (en) | 2016-09-21 | 2025-02-11 | Amal Therapeutics Sa | Fusion comprising a cell penetrating peptide, a multi epitope and a TLR peptide agonist for treatment of cancer |
| WO2019086694A1 (en) | 2017-11-06 | 2019-05-09 | Geert Mudde | Il31 antigen and vaccine |
| WO2022067394A1 (en) * | 2020-09-30 | 2022-04-07 | Newsouth Innovations Pty Limited | Antigen-binding fragments and uses thereof |
| WO2023052447A3 (en) * | 2021-09-29 | 2023-06-08 | Alligator Bioscience Ab | Methods and compositions |
| WO2024238558A1 (en) * | 2023-05-15 | 2024-11-21 | Tallac Therapeutics, Inc. | Use of immunomodulating targeted polynucleotide conjugates for use with immune honing agent |
Also Published As
| Publication number | Publication date |
|---|---|
| CN104487083B (zh) | 2018-11-20 |
| RU2014152908A (ru) | 2016-08-27 |
| CN109806388B (zh) | 2022-03-08 |
| CA2878771A1 (en) | 2014-01-16 |
| CN109806388A (zh) | 2019-05-28 |
| WO2014009209A3 (en) | 2014-04-17 |
| JP2015527313A (ja) | 2015-09-17 |
| CN109806387A (zh) | 2019-05-28 |
| BR112015000483B1 (pt) | 2022-05-17 |
| CN109806387B (zh) | 2022-03-04 |
| EP2872169B1 (en) | 2021-09-01 |
| CN104487083A (zh) | 2015-04-01 |
| EP2872169A2 (en) | 2015-05-20 |
| JP6466327B2 (ja) | 2019-02-06 |
| US20150196636A1 (en) | 2015-07-16 |
| AU2013289372B2 (en) | 2017-11-02 |
| BR112015000483A2 (cg-RX-API-DMAC7.html) | 2017-09-05 |
| RU2650709C2 (ru) | 2018-04-17 |
| AU2013289372A1 (en) | 2015-01-15 |
| ES2897793T3 (es) | 2022-03-02 |
| US10434170B2 (en) | 2019-10-08 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| AU2013289372B2 (en) | Immunoregulatory vaccine | |
| AU2014270595B2 (en) | Gastrin peptide immunogenic composition | |
| US11154599B2 (en) | Her2/neu immunogenic composition | |
| CA2878771C (en) | Immunoregulatory vaccine | |
| CN111565801B (zh) | 用于IgE介导过敏性疾病治疗的靶向膜结合型IgE的肽免疫原及其剂型 | |
| HK40002834A (zh) | 免疫调节疫苗 | |
| HK40002834B (zh) | 免疫调节疫苗 | |
| HK40002744B (zh) | 免疫调节疫苗 | |
| HK40002744A (en) | Immunoregulatory vaccine |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 13732967 Country of ref document: EP Kind code of ref document: A2 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2013732967 Country of ref document: EP |
|
| ENP | Entry into the national phase |
Ref document number: 2878771 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 14414337 Country of ref document: US |
|
| ENP | Entry into the national phase |
Ref document number: 2015520903 Country of ref document: JP Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2013289372 Country of ref document: AU Date of ref document: 20130702 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2014152908 Country of ref document: RU Kind code of ref document: A |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112015000483 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 112015000483 Country of ref document: BR Kind code of ref document: A2 Effective date: 20150109 |