WO2013079174A1 - Anti-pd-l1 antibodies and uses thereof - Google Patents

Anti-pd-l1 antibodies and uses thereof Download PDF

Info

Publication number
WO2013079174A1
WO2013079174A1 PCT/EP2012/004822 EP2012004822W WO2013079174A1 WO 2013079174 A1 WO2013079174 A1 WO 2013079174A1 EP 2012004822 W EP2012004822 W EP 2012004822W WO 2013079174 A1 WO2013079174 A1 WO 2013079174A1
Authority
WO
WIPO (PCT)
Prior art keywords
antibody
seq
hvr
sequence
human
Prior art date
Application number
PCT/EP2012/004822
Other languages
French (fr)
Inventor
Horacio G. Nastri
Christel IFFLAND
Olivier Leger
Qi AN
Mark Cartwright
Sean D. Mckenna
Vanita D. SOOD
Gang Hao
Original Assignee
Merck Patent Gmbh
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Family has litigation
First worldwide family litigation filed litigation Critical https://patents.darts-ip.com/?family=47221305&utm_source=google_patent&utm_medium=platform_link&utm_campaign=public_patent_search&patent=WO2013079174(A1) "Global patent litigation dataset” by Darts-ip is licensed under a Creative Commons Attribution 4.0 International License.
Priority to EP20186754.6A priority Critical patent/EP3763741A1/en
Priority to EP12790432.4A priority patent/EP2785375B1/en
Priority to KR1020177021068A priority patent/KR101981873B1/en
Priority to MX2014006316A priority patent/MX349096B/en
Priority to CA2856895A priority patent/CA2856895C/en
Priority to SG11201402603WA priority patent/SG11201402603WA/en
Priority to SI201231849T priority patent/SI2785375T1/en
Priority to AU2012344260A priority patent/AU2012344260B2/en
Priority to LTEP12790432.4T priority patent/LT2785375T/en
Priority to CN201280058422.3A priority patent/CN103987405B/en
Priority to ES12790432T priority patent/ES2808152T3/en
Priority to EA201400625A priority patent/EA036814B9/en
Priority to RS20201263A priority patent/RS61033B1/en
Priority to BR112014012819-7A priority patent/BR112014012819B1/en
Priority to KR1020147017974A priority patent/KR101764096B1/en
Application filed by Merck Patent Gmbh filed Critical Merck Patent Gmbh
Priority to DK12790432.4T priority patent/DK2785375T3/en
Priority to JP2014542728A priority patent/JP6138813B2/en
Priority to US14/360,775 priority patent/US9624298B2/en
Publication of WO2013079174A1 publication Critical patent/WO2013079174A1/en
Priority to IL232778A priority patent/IL232778B/en
Priority to ZA2014/04790A priority patent/ZA201404790B/en
Priority to HK15101432.7A priority patent/HK1200736A1/en
Priority to US15/454,959 priority patent/US10487147B2/en
Priority to US15/454,939 priority patent/US10759856B2/en
Priority to AU2017268603A priority patent/AU2017268603B2/en
Priority to US16/984,365 priority patent/US11884724B2/en
Priority to IL276573A priority patent/IL276573A/en
Priority to HRP20201595TT priority patent/HRP20201595T1/en
Priority to CY20201100946T priority patent/CY1123435T1/en
Priority to NL301081C priority patent/NL301081I2/en
Priority to FR20C1068C priority patent/FR20C1068I2/en
Priority to LTPA2021001C priority patent/LTC2785375I2/en
Priority to NO2021003C priority patent/NO2021003I1/en

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/28Compounds containing heavy metals
    • A61K31/282Platinum compounds
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/495Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with two or more nitrogen atoms as the only ring heteroatoms, e.g. piperazine or tetrazines
    • A61K31/505Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim
    • A61K31/513Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim having oxo groups directly attached to the heterocyclic ring, e.g. cytosine
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/495Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with two or more nitrogen atoms as the only ring heteroatoms, e.g. piperazine or tetrazines
    • A61K31/505Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim
    • A61K31/519Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim ortho- or peri-condensed with heterocyclic rings
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/555Heterocyclic compounds containing heavy metals, e.g. hemin, hematin, melarsoprol
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/66Phosphorus compounds
    • A61K31/675Phosphorus compounds having nitrogen as a ring hetero atom, e.g. pyridoxal phosphate
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/70Carbohydrates; Sugars; Derivatives thereof
    • A61K31/7042Compounds having saccharide radicals and heterocyclic rings
    • A61K31/7052Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides
    • A61K31/706Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom
    • A61K31/7064Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom containing condensed or non-condensed pyrimidines
    • A61K31/7068Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom containing condensed or non-condensed pyrimidines having oxo groups directly attached to the pyrimidine ring, e.g. cytidine, cytidylic acid
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/18Growth factors; Growth regulators
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/19Cytokines; Lymphokines; Interferons
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/0005Vertebrate antigens
    • A61K39/0011Cancer antigens
    • A61K39/001102Receptors, cell surface antigens or cell surface determinants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/3955Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/39558Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against tumor tissues, cells, antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39591Stabilisation, fragmentation
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K45/00Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
    • A61K45/06Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K48/00Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K49/00Preparations for testing in vivo
    • A61K49/06Nuclear magnetic resonance [NMR] contrast preparations; Magnetic resonance imaging [MRI] contrast preparations
    • A61K49/08Nuclear magnetic resonance [NMR] contrast preparations; Magnetic resonance imaging [MRI] contrast preparations characterised by the carrier
    • A61K49/10Organic compounds
    • A61K49/14Peptides, e.g. proteins
    • A61K49/16Antibodies; Immunoglobulins; Fragments thereof
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/02Stomatological preparations, e.g. drugs for caries, aphtae, periodontitis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/04Drugs for disorders of the alimentary tract or the digestive system for ulcers, gastritis or reflux esophagitis, e.g. antacids, inhibitors of acid secretion, mucosal protectants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/16Drugs for disorders of the alimentary tract or the digestive system for liver or gallbladder disorders, e.g. hepatoprotective agents, cholagogues, litholytics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/18Drugs for disorders of the alimentary tract or the digestive system for pancreatic disorders, e.g. pancreatic enzymes
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P11/00Drugs for disorders of the respiratory system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P13/00Drugs for disorders of the urinary system
    • A61P13/10Drugs for disorders of the urinary system of the bladder
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P13/00Drugs for disorders of the urinary system
    • A61P13/12Drugs for disorders of the urinary system of the kidneys
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P15/00Drugs for genital or sexual disorders; Contraceptives
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00Drugs for dermatological disorders
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • A61P37/04Immunostimulants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P5/00Drugs for disorders of the endocrine system
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/475Growth factors; Growth regulators
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/22Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against growth factors ; against growth regulators
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2827Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against B7 molecules, e.g. CD80, CD86
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2300/00Mixtures or combinations of active ingredients, wherein at least one active ingredient is fully defined in groups A61K31/00 - A61K41/00
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/34Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/55Fab or Fab'
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • C07K2317/732Antibody-dependent cellular cytotoxicity [ADCC]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value

Definitions

  • the present application relates to anti-PD-L1 antibodies or antigen binding fragments thereof, nucleic acid encoding the same, therapeutic compositions thereof, and their use to enhance T-cell function to upregulate cell-mediated immune responses and for the treatment of T cell dysfunctional disorders, such as tumor immunity, for the treatment of and cancer.
  • lymphocyte development and activation The two major types of lymphocytes in humans are T (thymus-derived) and B (bone marrow derived. These cells are derived from hematopoietic stem cells in the bone marrow and fetal liver that have committed to the lymphoid development pathway. The progeny of these stem cells follow divergent pathways to mature into either B or T lymphocytes. Human B-lymphocyte development takes place entirely within the bone marrow. T cells, on the other hand, develop from immature precursors that leave the marrow and travel through the bloodstream to the thymus, where they proliferate and differentiate into mature T lymphocytes.
  • Mature lymphocytes that emerge from the thymus or bone marrow are in a
  • quiescent, or "resting” state i.e., they are mitotically inactive.
  • these "naive” or “virgin” lymphocytes travel into various secondary or peripheral lymphoid organs, such as the spleen, lymph nodes or tonsils.
  • Most virgin lymphocytes have an inherently short life span and die without a few days after leaving the marrow or thymus. However, if such a cell receives signals that indicate the presence of an antigen, they may activate and undergo successive rounds of cell division. Some of the resulting progeny cells then revert to the resting state to become memory lymphocytes - B and T cells that are essentially primed for the next encounter with the stimulating allergen.
  • Lymphocyte activation refers to an ordered series of events through which a resting lymphocyte passes as it is stimulated to divide and produce progeny, some of which become effector cells.
  • a full response includes both the induction of cell proliferation (mitogenesis) and the expression of immunologic functions.
  • Lymphocytes become activated when specific ligands bind to receptors on their surfaces. The ligands are different for T cells and B cells, but the resulting intracellular physiological
  • These more common antigens activate B cells when they are co-stimulated with nearby activated helper T- lymphocytes. Such stimulation may occur from lymphokines secreted by the T-cell, but is transmitted most efficiently by direct contact of the B cell with T-cell surface proteins that interact with certain B-cell surface receptors to generate a secondary signal.
  • T lymphocytes do not express immunoglobulins, but, instead detect the presence of foreign substances by way of surface proteins called T-cell receptors (TCR). These receptors recognize antigens by either direct contact or through influencing the activity of other immune cells. Together with macrophages, T cells are the primary cell type involved in the cell-mediated immunity.
  • T-cells can detect foreign substances only in specific contexts.
  • T-lymphocytes will recognize a foreign protein only if it first cleaved into small peptides, which are then displayed on the surface of a second host cell, called an antigen- presenting cell (APC).
  • APC antigen-presenting cell
  • Many types of host cells can present antigens under some conditions but certain types are more specifically adapted for this purpose and are particularly important in controlling T-cell activity, including macrophages and other B-cells.
  • Antigen presentation depends in part on specific proteins, called major histocompatibility complex (MHC) proteins, on the surface of the presenting cells.
  • MHC major histocompatibility complex
  • T c cells cytotoxic T lymphocytes
  • T H helper T cells
  • T c cells are important in viral defense, and can kill viruses directly by recognizing certain cell surface expressed viral peptides.
  • TH cells promote proliferation, maturation and immunologic function of other cell types, e.g. , lymphokine secretion to control activities of B cells,
  • cytotoxic T cells Both virgin and memory T-lymphocytes ordinarily remain in the resting state, and in this state they do not exhibit significant helper or cytotoxic activity. When activated, these cells undergo several rounds of mitotic division to produce daughter cells. Some of these daughter cells return to the resting state as memory cells, but others become effector cells that actively express helper or cytotoxic activity. These daughter cells resemble their parents: CD4+ cells can only product CD4+ progeny, while CD8+ cells yield only CD8+ progeny. Effector T- cells express cell surface markers that are not expressed on resting T-cells, such as CD25, CD28, CD29, CD40L, transferrin receptors and class II MHC proteins.
  • T-lymphocyte responses to most antigens also require two types of simultaneous stimuli.
  • the first is the antigen, which if appropriately displayed by MHC proteins on an antigen-presenting cell, can be recognized and bound by T-cell receptors. While this antigen-MHC complex does send a signal to the cell interior, it is usually insufficient to result in T-cell activation.
  • Full activation such as occurs with helper T-cells, requires costimulation with other specific ligands called costimulators that are expressed on the surface of the antigen-presenting cell.
  • Activation of a cytotoxic T cell generally requires IL -2, a cytokine secreted by activated helper T cells.
  • PD-1 programmed death-1 receptor
  • B7-H1, CD274 PD-L1
  • PD-L2 B7-DC, CD273
  • the negative regulatory role of PD-1 was revealed by PD-1 knock outs (Pdcdl ' ' ' ), which are prone to autoimmunity.
  • PD-1 is related to CD28 and CTLA-4, but lacks the membrane proximal cysteine that allows homodimerization.
  • the cytoplasmic domain of PD-1 contains an immunoreceptor tyorine-based inhibition motif (ITIM, V/lxYxxL/V).
  • ITIM immunoreceptor tyorine-based inhibition motif
  • PD-1 only binds to PD-L1 and PD-L2.
  • PD-1 can be expressed on T cells, B cells, natural killer T cells, activated monocytes and dendritic cells (DCs). PD-1 is expressed by activated, but not by unstimulated human CD4 + and CD8 + T cells, B cells and myeloid cells. This stands in contrast to the more restricted expression of CD28 and CTLA-4. Nishimura et al, Int. Immunol. 8: 773-80 (1996); Boettler et al, J. Virol. 80: 3532-40 (2006).
  • PD-1 PD-1 that have been cloned from activated human T cells, including transcripts lacking (i) exon 2, (ii) exon 3, (iii) exons 2 and 3 or (iv) exons 2 through 4. Nielsen et al, Cell. Immunol. 235: 109-16 (2005). With the exception of PD-IAex3, all variants are expressed at similar levels as full length PD-1 in resting peripheral blood mononuclear cells (PBMCs). Expression of all variants is significantly induced upon activation of human T cells with anti-CD3 and anti-CD28.
  • PBMCs peripheral blood mononuclear cells
  • the PD-1Aex3 variants lacks a transmembrane domain, and resembles soluble CTLA-4, which plays an important role in autoimmunity. Ueda et al, Nature 423: 506-11 (2003). This variant is enriched in the synovial fluid and sera of patients with rheumatoid arthritis. Wan et al, J. Immunol. 177: 8844-50 (2006).
  • the two PD-1 ligands differ in their expression patterns.
  • PD-L1 is constitutively expressed on mouse T and B cells, CDs,
  • PD-L1 is expressed on a wide range of nonhematopoietic cells (e.g., cornea, lung, vascular epithelium, liver nonpar enchymal cells, mesenchymal stem cells, pancreatic islets, placental
  • JAK2 has also been implicated in PD-L1 induction.
  • Loss or inhibition of phosphatase and tensin homolog (PTEN), a cellular phosphatase that modified phosphatidylinosital 3-kinase (PI3K) and Akt signaling increased post- transcriptional PD-L1 expression in cancers.
  • PTEN phosphatase and tensin homolog
  • PI3K a cellular phosphatase that modified phosphatidylinosital 3-kinase
  • Akt signaling increased post- transcriptional PD-L1 expression in cancers.
  • PD-L2 expression is more restricted than PD-L1.
  • PD-L2 is inducibly expressed on DCs, macrophag
  • PD-L2 is also expressed on about half to two-thirds of resting peritoneal Bl cells, but not on conventional B2 B cells. Zhong et al, Eur. J. Immunol. 37: 2405-10 (2007). PD-L2+ Bl cells bind phosphatidylcholine and may be important for innate immune responses against bacterial antigens. Induction of PD-L2 by IFN- ⁇ is partially dependent upon NF -KB. Liang et al, Eur. J. Immunol. 33_: 2706-16 (2003). PD-L2 can also be induced on monocytes and macrophages by GM-CF, IL-4 and and IFN- ⁇ . Yamazaki et al., J. Immunol. 169: 5538-45 (2002); Loke et al, PNAS 100:5336 ⁇ 1 (2003).
  • PD-1 signaling typically has a greater effect on cytokine production than on cellular proliferation, with significant effects on IFN- ⁇ , TNF-a and IL-2 production.
  • PD-1 mediated inhibitory signaling also depends on the strength of the TCR signaling, with greater inhibition delivered at low levels of TCR stimulation. This reduction can be overcome by costimulation through CD28 [Freeman et al, J. Exp. Med. 192: 1027-34 (2000)] or the presence of IL-2 [Carter et al, Eur. J. Immunol. 32: 634-43 (2002)]- Evidence is mounting that signaling through PD-L1 and PD-L2 may be bidirectional.
  • signaling may also be delivered back to the cells expressing PD-L1 and PD-L2.
  • a naturally human anti-PD-L2 antibody isolated from a patient with Waldenstrom's macroglobulinemia was not found to upregulate MHC II or B7 costimulatory molecules, such cells did produce greater amount of proinflammatory cytokines, particularly TNF-a and IL-6, and stimulated T cell proliferation.
  • Treatment of mice with this antibody also (1) enhanced resistance to transplated bl6 melanoma and rapidly induced tumor- specific CTL.
  • Radhakrishnan et al J. Immunol. 170: 1830-38 (2003); Radhakrishnan et al, Cancer Res. 64: 4965-72 (2004); Heckman et al, Eur. J. Immunol. 37: 1827-35 (2007); (2) blocked development of airway inflammatory disease in a mouse model of allergic asthma. Radhakrishnan et al, J. Immunol. 173: 1360-65 (2004);
  • B7.1 has already been identified as a binding partner for PD-L1. Butte et al, Immunity 27: 111-22 (2007). Chemical crosslinking studies suggest that PD-L1 and B7.1 can interact through their IgV-like domains. B7.1 :PD-L1 interactions can induce an inhibitory signal into T cells.
  • T cells lacking CD28 and CTLA-4 show decreased proliferation and cytokine production when stimulated by anti-CD3 plus B7.1 coated beads.
  • T cells lacking all the receptors for B7.1 i.e., CD28, CTLA-4 and PD-L1
  • T-cell proliferation and cytokine production were no longer inhibited by anti-CD3 plus B7.1 coated beads. This indicates that B7.1 acts specifically through PD-L1 on the T- cell in the absence of CD28 and CTLA-4.
  • T cells lacking PD-1 showed decreased proliferation and cytokine production when stimulated in the presence of anti-CD3 plus PD-L1 coated beads, demonstrating the inhibitory effect of PD-L1 ligation on B7.1 on T cells.
  • T cells lacking all known receptors for PD-L1 i.e., no PD-1 and B7.1
  • T cell proliferation was no longer impaired by anti-CD3 plus PD- L1 coated beads.
  • PD-L1 can exert an inhibitory effect on T cells either through B7.1 or PD-1.
  • T cell PD-L1 may trap or segregate away APC B7.1 from interaction with CD28.
  • the antagonism of signaling through PD-L1 including blocking PD-L1 from interacting with either PD-1 , B7.1 or both, thereby preventing PD-L1 from sending a negative co- stimulatory signal to T-cells and other antigen presenting cells is likely to enhance immunity in response to infection (e.g., acute and chronic) and tumor immunity.
  • the anti-PD-L1 antibodies of the present invention may be combined with antagonists of other components of PD-1 : PD-L1 signaling, for example, antagonist anti-PD-1 and anti-PD-L2 antibodies.
  • the inhibition of PD-L1 signaling has been proposed as a means to enhance T cell immunity for the treatment of cancer (e.g., tumor immunity) and infection, including both acute and chronic (e.g., persistent) infection.
  • cancer e.g., tumor immunity
  • infection including both acute and chronic (e.g., persistent) infection.
  • Inhibitors blocking the PD-L1 : PD-1 interaction are known from, i.a.,
  • anti-PD-L1 antibodies including nucleic acids encoding and compositions containing such antibodies, and for their use to enhance T-cell function to upregulate cell-mediated immune responses and for the treatment of T cell dysfunctional disorders, such as tumor immunity.
  • ADCC antibody dependent cell-mediated cytotoxicity
  • the anti-PD-L1 antibodies according to the present invention which have antibody dependent cell-mediated cytotoxicity (ADCC) activity, directly act on PD-L1 bearing tumor cells by inducing their lysis without showing any significant toxicity.
  • ADCC antibody dependent cell-mediated cytotoxicity
  • the antibodies do not only block the interaction between human PD-L1 and human PD-1 , but also the interactions between the respective mouse and cynomolgus monkey proteins.
  • the invention provides for an isolated heavy chain variable region polypeptide comprising an HVR-H1 , HVR-H2 and HVR-H3 sequence, wherein:
  • HVR-H1 sequence is X YX 2 MX 3 (SEQ ID NO:1);
  • the HVR-H2 sequence is SIYPSGGX 4 TFYADX 5 VKG (SEQ ID NO:2);
  • the HVR-H3 sequence is IKLGTVTTVX 6 Y (SEQ ID NO:3); further wherein: X ⁇ is K, R, T, Q, G, A, W, M, I or S; X 2 is V, R, K, L, or I; X 3 is H ( T, N, Q, A, V, Y, W, F or M; X4 is F or I; X 5 is S or T; X 6 is E or D.
  • Xi is M, I or S;
  • X 2 is R, K, L, M or I;
  • X 3 is F or M;
  • X4 is F or l;
  • X 5 is S or T;
  • X 6 is E or D.
  • Xi is M, I or S; X 2 is L, M or I; X 3 is F or M; X4 is I; X 5 is S or T; Xe is D.
  • Xi is S; X 2 is I; X3 is M; X4 is I; X5 is T; Xe is D.
  • polypeptide further comprises variable region heavy chain framework sequences juxtaposed between the HVRs according to the formula: (HC- FR1)-(HVR-H1)-(HC-FR2)-(HVR-H2)-(HC-FR3)-(HVR-H3)- (HC-FR4).
  • the framework sequences are derived from human consensus framework sequences or human germline framework sequences.
  • HC-FR1 is EVQLLESGGGLVQPGGSLRLSCAASGFTFS (SEQ ID NO:4);
  • HC-FR2 is WVRQAPGKG LEWVS (SEQ ID NO:5);
  • HC-FR3 is RFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR (SEQ ID NO:6);
  • HC-FR4 is WGQGTLVTVSS (SEQ ID NO:7).
  • the heavy chain polypeptide is further combined with a variable region light chain comprising an an HVR-L1 , HVR-L2 and HVR-L3, wherein: (a) the HVR-L1 sequence is (SEQ ID NO.8);
  • HVR-L2 sequence is XioVXnX 12 RPS (SEQ ID NO:9);
  • X 7 is N or S
  • Xe is T, R or S
  • X 9 is A or G
  • X10 is E or D
  • Xn is I, N or
  • the light chain further comprises variable region light chain framework sequences juxtaposed between the HVRs according to the formula: (LC- FR1 MHVR-L1 )-(LC-FR2)-(HVR-L2)-(LC-FR3)-(HVR-L3)-(LC-FR4).
  • the light chain framework sequences are derived from human consensus framework sequences or human germline framework sequences.
  • the light chain framework sequences are lambda light chain sequences.
  • at least one of the framework sequence is the following:
  • LC-FR1 is QSALTQPASVSGSPGQSITISC (SEQ ID NO:11);
  • LC-FR2 is WYQQHPGKAPKLMIY (SEQ ID NO:12);
  • LC-FR3 is GVSNRFSGSKSGNTASLTISGLQAEDEADYYC (SEQ ID NO:13);
  • LC-FR4 is FGTGTKVTVL (SEQ ID NO: 14).
  • the invention provides an isolated anti-PD-L1 antibody or antigen binding fragment comprising a heavy chain and a light chain variable region sequence, wherein:
  • the heavy chain comprises an HVR-H1 , HVR-H2 and HVR-H3, wherein further: (i) the HVR-H1 sequence is X1YX2MX3 (SEQ ID NO:1); (ii) the HVR-H2 sequence is
  • the light chain comprises an HVR-L1 , HVR-L2 and HVR-L3, wherein further: (iv) the HVR-L1 sequence is (SEQ ID NO:8); (v) the HVR-L2 sequence is X 10 VX 11 X 12 RPS (SEQ ID NO:9); (vi) the HVR-L3 sequence is
  • Xi is K, R, T, Q, G, A, W, M, I or S
  • X 2 is V, R, K, L, M or I
  • X 3 is H, T, N, Q, A, V, Y, W, F or M
  • X4 is F or I
  • X 5 is S or T
  • Xe is E or D
  • X 7 is N or S
  • X 8 is T, R or S
  • X 9 is A or G
  • X 0 is E or D
  • Xn is I, N or S
  • X 1 2 is D, H or N
  • X 1 3 is F or Y
  • X 14 is N or S
  • X 15 is R, T or S
  • X 6 is G or S
  • Xi 7 is I or T.
  • Xi is M, I or S; X 2 is R, K, L, M or I; X 3 is F or M; X4 is F or I; X 5 is S or T; Xe is E or D; X 7 is N or S; X 8 is T, R or S; X 9 is A or G; X i0 is E or D; Xn is N or S; X 12 is N; X13 is F or Y; X 14 is S; X15 is S; X 6 is G or S; X 17 is T.
  • Xi is M, I or S; X 2 is L, M or I; X 3 is F or M; X4 is I; X 5 is S or T; X 6 is D; X 7 is N or S; X 8 is T, R or S; X 9 is A or G; X 10 is E or D; Xn is N or S; X12 is N; X 3 is F or Y; X14 is S; X15 is S; Xi 6 is G or S; X 17 is T.
  • the heavy chain variable region comprises one or more
  • framework sequences juxtaposed between the HVRs as: (HC-FR1)-(HVR-H1)-(HC- FR2)-(HVR-H2)-(HC-FR3)-(HVR- H3)-(HC-FR4), and the light chain variable regions comprises one or more framework sequences juxtaposed between the HVRs as: (LC-FR1 MHVR-L1 )-(LC-FR2)-(HVR-l_2)-(LC-FR3)-(HVR- L3)-(LC-FR4).
  • framework sequences are derived from human
  • one or more of the heavy chain framework sequences is the following:
  • HC-FR1 is EVQLLESGGGLVQPGGSLRLSCAASGFTFS (SEQ ID NO:4);
  • HC-FR2 is WVRQAPGKGLEWVS (SEQ ID NO:5);
  • HC-FR3 is RFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR (SEQ ID NO:6);
  • HC-FR4 is WGQGTLVTVSS (SEQ ID NO:7).
  • the light chain framework sequences are lambda light chain sequences.
  • one or more of the light chain framework sequences is the following:
  • LC-FR1 is QSALTQPASVSGSPGQSITISC (SEQ ID NO:11);
  • LC-FR2 is WYQQHPGKAPKLMIY (SEQ ID NO:12);
  • LC-FR3 is GVSNRFSGSKSGNTASLTISGLQAEDEADYYC; (SEQ ID NO: 13);
  • LC-FR4 is FGTGTKVTVL (SEQ ID NO: 14).
  • the heavy chain variable region polypeptide, antibody or antibody fragment further comprises at least a C H 1 domain. In a more specific aspect, the heavy chain variable region polypeptide, antibody or antibody fragment further comprises a C H 1, a C H 2 and a C H 3 domain.
  • variable region light chain, antibody or antibody fragment further comprises a C L domain.
  • the antibody further comprises a C H 1, a C H 2, a C H 3 and a C L domain. In a still further specific aspect, the antibody further comprises a human or murine constant region.
  • the human constant region is selected from the group consisting of lgG1, lgG2, lgG2, lgG3, lgG4.
  • the human or murine constant region is lgG1.
  • the invention provides for an anti-PD-L1 antibody comprising a heavy chain and a light chain variable region sequence, wherein:
  • the heavy chain comprises an HVR-H1, HVR-H2 and an HVR-H3, having at least 80% overall sequence identity to SYIMM (SEQ ID NO:15), SIYPSGGITFYADTVKG
  • the light chain comprises an HVR-L1 , HVR-L2 and an HVR-L3, having at least 80% overall sequence identity to TGTSSDVGGYNYVS (SEQ ID NO:18), DVSNRPS (SEQ ID NO:19) and SSYTSSSTRV (SEQ ID NO:20), respectively.
  • sequence identity is 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.
  • the invention provides for an anti-PD-L1 antibody comprising a heavy chain and a light chain variable region sequence, wherein:
  • the heavy chain comprises an HVR-H1 , HVR-H2 and an HVR-H3, having at least 80% overall sequence identity to MYMMM (SEQ ID NO:21), SIYPSGGITFYADSVKG (SEQ ID NO:22) and IKLGTVTTVDY (SEQ ID NO: 17), respectively, and
  • the light chain comprises an HVR-L1, HVR-L2 and an HVR-L3, having at least 80% overall sequence identity to TGTSSDVGAYNYVS (SEQ ID NO:23), DVSNRPS (SEQ ID NO: 19) and SSYTSSSTRV (SEQ ID NO.20), respectively.
  • sequence identity is 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.
  • HVR-H1 SEQ ID NO:15
  • HVR-H2 SEQ ID NO:16
  • HVR-H3 SEQ ID NO:17
  • HVR-L1 SEQ ID NO: 18
  • HVR-L2 SEQ ID NO: 19
  • HVR-L3 SEQ ID NO:20
  • the heavy chain variable region comprises one or more framework sequences juxtaposed between the HVRs as: (HC-FR1)- (HVR-H1)-(HC-FR2)-(HVR- H2)-(HC-FR3)-(HVR-H3)-(HC-FR4), and the light chain variable regions comprises one or more framework sequences juxtaposed between the HVRs as: (LC- FR1)- (HVR-L1 )-(LC-FR2)-(HVR-l_2)-(LC-FR3)-(HVR-L3)-(LC-FR4).
  • the framework sequences are derived from human germline sequences.
  • one or more of the heavy chain framework sequences is the following:
  • HC-FR1 is EVQLLESGGGLVQPGGSLRLSCAASGFTFS (SEQ ID NO:4);
  • HC-FR2 is WVRQAPGKG LEWVS (SEQ ID NO:5);
  • HC-FR3 is RFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR (SEQ ID NO:6); HC-FR4 is WGQGTLVTVSS (SEQ ID NO:7).
  • the light chain framework sequences are derived from a lambda light chain sequence.
  • one or more of the light chain framework sequences is the following:
  • LC-FR1 is QSALTQPASVSGSPGQSITISC (SEQ ID NO:11);
  • LC-FR2 is WYQQHPGKAPKLMIY (SEQ ID NO: 12);
  • LC-FR3 is GVSNRFSGSKSGNTASLTISGLQAEDEADYYC (SEQ ID NO:13);
  • LC-FR4 is FGTGTKVTVL (SEQ ID NO:14).
  • the antibody further comprises a human or murine constant region.
  • the human constant region is selected from the group consisting of lgG1, lgG2, lgG2, lgG3, lgG4.
  • the invention provides for an isolated anti-PD-L1 antibody comprising a heavy chain and a light chain variable region sequence, wherein:
  • the heavy chain sequence has at least 85% sequence identity to the heavy chain sequence:
  • the light chain sequence has at least 85% sequence identity to the light chain sequence:
  • sequence identity is 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.
  • the invention provides for an isolated anti-PD-L1 antibody comprising a heavy chain and a light chain variable region sequence, wherein:
  • the heavy chain sequence has at least 85% sequence identity to the heavy chain sequence:
  • the light chain sequence has at least 85% sequence identity to the light chain sequence:
  • sequence identity is 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.
  • the antibody binds to human, mouse or cynomolgus monkey PD-L1.
  • the antibody is capable of blocking the interaction between human, mouse or cynomolgus monkey PD-L1 and the respective human, mouse or cynomolgus monkey PD-1 receptors.
  • the antibody binds to human PD-L1 with a KD of 5x10 "9 M or less, preferably with a KD of 2x10 "9 M or less, and even more preferred with a KD of 1x10 "9 M or less.
  • the invention concerns an isolated anti-PD-L1 antibody or antigen binding fragment thereof which binds to a functional epitope comprising residues Y56 and D61 of human PD-L1 (SEQ ID NO:28).
  • the functional epitope further comprises E58, E60, Q66, R113 and M115 of human PD-L1 (SEQ ID NO:28).
  • the antibody binds to a conformational epitope, comprising residues 54-66 and 1 2-122 of human PD-L1 (SEQ ID NO:28).
  • the invention is related to an anti-PD-L1 antibody, or antigen binding fragment thereof, which cross-competes for binding to PD-L1 with an antibody according to the invention as described herein.
  • the invention provides for compositions comprising any of the above described anti-PD-L1 antibodies in combination with at least one pharmaceutically acceptable carrier.
  • the invention provides for an isolated nucleic acid encoding a polypeptide, or light chain or a heavy chain variable region sequence of an anti-PD-L1 antibody, or antigen binding fragment thereof, as described herein. In a still further embodiment, the invention provides for an isolated nucleic acid encoding a light chain or a heavy chain variable region sequence of an anti-PD-L1 antibody, wherein:
  • the heavy chain comprises an HVR-H1 , HVR-H2 and an HVR-H3 sequence having at least 80% sequence identity to SYIMM (SEQ ID NO: 15),
  • SIYPSGGITFYADTVKG SEQ ID NO: 16
  • IKLGTVTTVDY SEQ ID NO: 17
  • the light chain comprises an HVR-L1 , HVR-L2 and an HVR-L3 sequence having at least 80% sequence identity to TGTSSDVGGYNYVS (SEQ ID NO: 18), DVSNRPS (SEQ ID NO:19) and SSYTSSSTRV (SEQ ID NO:20), respectively.
  • sequence identity is 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.
  • nucleic acid is SEQ ID NO:30 for the heavy chain, and SEQ ID NO:31 for the light chain.
  • the nucleic acid further comprises a vector suitable for expression of the nucleic acid encoding any of the previously described anti-PD-L1 antibodies.
  • the vector further comprises a host cell suitable for expression of the nucleic acid.
  • the host cell is a eukaryotic cell or a prokaryotic cell.
  • the eukaryotic cell is a mammalian cell, such as Chinese Hamster Ovary (CHO).
  • CHO Chinese Hamster Ovary
  • the invention provides for a process of making an anti- PD- L1 antibody or antigen binding fragment thereof, comprising culturing a host cell containing nucleic acid encoding any of the previously described anti-PD-L1 antibodies or antigen-binding fragment in a form suitable for expression, under conditions suitable to produce such antibody or fragment, and recovering the antibody or fragment.
  • the invention provides a kit of parts comprising a container enclosing a therapeutically effective amount of a composition disclosed herein and a package insert indicating use for the treatment of a T-cell dysfunctional disorder.
  • the invention provides for a kit of parts comprising any of the above described anti-PD-L1 compositions in combination with at least one further therapeutic agent or vaccine, such as a chemotherapeutic agent.
  • the at least one chemotherapeutic agent is gemcitabine
  • the vaccine is Stimuvax.
  • the invention provides for a method of enhancing T-cell function comprising administering an effective amount of any of the above described anti-PD-L1 antibodies or compositions.
  • the anti-PD-L1 antibody or composition renders dysfunctional T-cells non-dysfunctional.
  • the antibody or composition treats of prevents a symptom of persistent infection, such as viral infection, e.g. by human immunodeficiency virus (HIV), herpes virus, Eppstein-Barr virus or human papilloma virus.
  • HIV human immunodeficiency virus
  • the invention provides for a method of treating a T-cell dysfunctional disorder comprising administering a therapeutically effective amount of any of the above described anti-PD-L1 antibodies or compositions.
  • the T-cell dysfunctional disorder is tumor immunity.
  • the method further comprises treatment with a vaccine.
  • the PD-L1 antibody or composition is combined with a treatment regimen further comprising a traditional therapy selected from the group consisting of: surgery, radiation therapy, chemotherapy, targeted therapy,
  • the tumor immunity results from a cancer selected from the group consisting of: breast, lung, colon, ovarian, melanoma, bladder, kidney, liver, salivary, stomach, gliomas, thyroid, thymic, epithelial, head and neck cancers, gastric, and pancreatic cancer.
  • Another aspect of the invention relates to the use of antibody dependent cell- mediated cytotoxicity (ADCC) of an anti-PD-L1 antibody disclosed herein or composition in the treatment of cancer.
  • ADCC antibody dependent cell- mediated cytotoxicity
  • the invention pertains to method of treating cancer comprising
  • an anti-PD-L1 antibody which induces antibody dependent cell-mediated cytotoxicity (ADCC).
  • ADCC antibody dependent cell-mediated cytotoxicity
  • the constant region of the anti-PD-L1 antibody is lgG1.
  • the cancer is selected from the group consisting of: breast, lung, colon, ovarian, melanoma, bladder, kidney, liver, salivary, stomach, gliomas, thyroid, thymic, epithelial, head and neck cancers, gastric and pancreatic cancer.
  • the invention relates likewise to the use of an anti-PD-L1 antibody or composition as described above and below for the manufacture of a medicament for ehancing T-cell function, treating a T-cell dysfunctional disorder or treating cancer;
  • the invention is directed to engineered antibodies, or engineered antibody fragments, which are fused directly or via a linker molecule to therapeutic agents, such as cytokines (e.g. IL-2, IL-12, TNFa, IFNa, IFNb), or growth factors; which engineered antibodies or engineered antibody fragments may also be used in tumor therapy and immune system related diseases.
  • cytokines e.g. IL-2, IL-12, TNFa, IFNa, IFNb
  • growth factors e.g. IL-2, IL-12, TNFa, IFNa, IFNb
  • Antibody fusion proteins, especially immunocytokines are well known in the art.
  • the fusion partner can be bound to the N-terminus of the antibody or antibody fragment or, preferably, to its C-terminus.
  • Disfunction in the context of immune dysfunction, refers to a state of immune reduced responsiveness to antigenic stimulation.
  • the term includes the common elements of both exhaustion and/or anergy in which antigen recognition may occur, but the ensuing immune response is ineffective to control infection or tumor growth.
  • Enhancing T-cell function means to induce, cause or stimulate a T-cell to have a sustained or amplified biological function, or renew or reactivate exhausted or inactive T-cells.
  • enhancing T-cell function include: increased secretion of ⁇ -interferon from CD8 + T- cells, increased proliferation, increased antigen responsiveness (e.g., viral or pathogen clearance) relative to such levels before the intervention.
  • the level of enhancement is as least 50%, alternatively 60%, 70%, 80%, 90%, 100%, 120%, 150%, 200%. The manner of measuring this enhancement is known to one of ordinary skill in the art.
  • T cell dysfunctional disorder is a disorder or condition of T-cells characterized by decreased responsiveness to antigenic stimulation.
  • a T- cell dysfunctional disorder is a disorder that is specifically associated with
  • T -cell dysfunctional disorder is one in which T-cells are anergic or have decreased ability to secrete cytokines, proliferate, or execute cytolytic activity.
  • the decreased responsiveness results in ineffective control of a pathogen or tumor expressing an immunogen.
  • T cell dysfunctional disorders characterized by T-cell dysfunction include unresolved acute infection, chronic infection and tumor immunity.
  • 'Tumor immunity refers to the process in which tumors evade immune recognition and clearance.
  • tumor immunity is "treated” when such evasion is attenuated, and the tumors are recognized and attacked by the immune system.
  • tumor recognition include tumor binding, tumor shrinkage and tumor clearance.
  • vaccine includes any nonpathogenic immunogen that, when inoculated into a host, induces protective immunity against a specific pathogen.
  • Vaccines can take many forms. Vaccines can be whole organisms that share important antigens with the pathogem, but are not pathogenic themselves (e.g., cowpox). Vaccines can also be prepared from killed (e.g., Salk polio vaccine) or attenuated (lost ability to produce disease - e.g., Sabin polio vaccine). Vaccines can also be prepared from purified macromolecules isolated from the pathogenic organism. For example, toxoid vaccines (e.g.
  • Subunit vaccines e.g., Hepatitis B
  • Hapten conjugate vaccines attaches certain carbohydrate or polypeptide epitopes isolated from the pathogen of interest to immunogenic carriers, such as tetanus toxoid. These strategies essentially use the epitopes as haptens to induce antibody production, which then recognize the same epitope in the native pathogen.
  • DNA vaccines exploit the ability of host cells to take up and express DNA encoding pathogenic proteins that is injected intramuscularly. Host responses to immunogens can be enhanced if administered as a mixture with adjuvants.
  • Immune adjuvants function in one or more of the following ways: (1) prolonging retention of the immunogen, (2) increased effective size of the immunogen (and hence promoting phagocytosis and presentation to macrophages), (3) stimulating the influx of macrophage or other immune cells to the injection site, or (4) promoting local cytokine production and other immunologic activities.
  • Example adjuvants include: complete Freund's adjuvant (CFA), aluminum salts, and mycobacterial derived proteins such as muramyl di- or tri-peptides.
  • antibody includes monoclonal antibodies (including full length antibodies which have an immunoglobulin Fc region), antibody compositions with polyepitopic specificity, multispecific antibodies ⁇ e.g., bispecific antibodies, diabodies, and single- chain molecules, as well as antibody fragments (e.g., Fab, F(ab')2, and Fv).
  • immunoglobulin Ig
  • the basic 4- chain antibody unit is a heterotetrameric glycoprotein composed of two identical light (L) chains and two identical heavy (H) chains.
  • IgM antibody consists of 5 of the basic heterotetramer units along with an additional polypeptide called a J chain, and contains 10 antigen binding sites, while IgA antibodies comprise from 2-5 of the basic 4-chain units which can polymerize to form polyvalent assemblages in combination with the J chain.
  • the 4-chain unit is generally about 150,000 daltons.
  • Each L chain is linked to an H chain by one covalent disulfide bond, while the two H chains are linked to each other by one or more disulfide bonds depending on the H chain isotype.
  • Each H and L chain also has regularly spaced intrachain disulfide bridges.
  • Each H chain has at the N-terminus, a variable domain (V H ) followed by three constant domains (C H ) for each of the a and ⁇ chains and four C H domains for ⁇ and ⁇ isotypes.
  • Each L chain has at the N-terminus, a variable domain (V L ) followed by a constant domain at its other end.
  • the V L is aligned with the V H and the C L is aligned with the first constant domain of the heavy chain (C H 1).
  • Particular amino acid residues are believed to form an interface between the light chain and heavy chain variable domains.
  • the pairing of a V H and V L together forms a single antigen-binding site.
  • L chain from any vertebrate species can be assigned to one of two clearly distinct types, called kappa and lambda, based on the amino acid sequences of their constant domains.
  • immunoglobulins can be assigned to different classes or isotypes.
  • immunoglobulins There are five classes of immunoglobulins: IgA, IgD, IgE, IgG and IgM, having heavy chains designated ⁇ , ⁇ , ⁇ , ⁇ and ⁇ , respectively.
  • the Y and a classes are further divided into subclasses on the basis of relatively minor differences in the CH sequence and function, e.g., humans express the following subclasses: lgG1, lgG2A, lgG2B, lgG3, lgG4, lgA1 and lgK1.
  • An “isolated” antibody is one that has been identified, separated and/or recovered from a component of its production environment (E.g., natural or recombinant).
  • the isolated polypeptide is free of association with all other components from its production environment.
  • Contaminant components of its production environment such as that resulting from recombinant transfected cells, are materials that would typically interfere with research, diagnostic or therapeutic uses for the antibody, and may include enzymes, hormones, and other proteinaceous or non- proteinaceous solutes.
  • the polypeptide will be purified: (1) to greater than 95% by weight of antibody as determined by, for example, the Lowry method, and in some embodiments, to greater than 99% by weight; (1) to a degree sufficient to obtain at least 15 residues of N-terminal or internal amino acid sequence by use of a spinning cup sequenator, or (3) to homogeneity by SDS-PAGE under non-reducing or reducing conditions using Coomassie blue or, preferably, silver stain.
  • Isolated antibody includes the antibody in situ within recombinant cells since at least one component of the antibody's natural environment will not be present.
  • variable region or “variable domain” of an antibody refers to the amino-terminal domains of the heavy or light chain of the antibody.
  • the variable domains of the heavy chain and light chain may be referred to as "VH” and “VL”, respectively. These domains are generally the most variable parts of the antibody (relative to other antibodies of the same class) and contain the antigen binding sites.
  • variable refers to the fact that certain segments of the variable domains differ extensively in sequence among antibodies.
  • the V domain mediates antigen binding and defines the specificity of a particular antibody for its particular antigen.
  • variability is not evenly distributed across the entire span of the variable domains. Instead, it is concentrated in three segments called hypervariable regions (HVRs) both in the light-chain and the heavy chain variable domains.
  • HVRs hypervariable regions
  • the more highly conserved portions of variable domains are called the framework regions (FR).
  • the variable domains of native heavy and light chains each comprise four FR regions, largely adopting a beta-sheet configuration, connected by three HVRs, which form loops connecting, and in some cases forming part of, the beta-sheet structure.
  • the HVRs in each chain are held together in close proximity by the FR regions and, with the HVRs from the other chain, contribute to the formation of the antigen binding site of antibodies (see Kabat et al, Sequences of Immunological Interest, Fifth Edition, National Institute of Health, Bethesda, MD (1991)).
  • the constant domains are not involved directly in the binding of antibody to an antigen, but exhibit various effector functions, such as participation of the antibody in antibody-dependent cellular toxicity.
  • monoclonal antibody refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical except for possible naturally occurring mutations and/or post-translation modifications (e.g., isomerizations, amidations) that may be present in minor amounts. Monoclonal antibodies are highly specific, being directed against a single antigenic site. In contrast to polyclonal antibody
  • each monoclonal antibody is directed against a single determinant on the antigen.
  • the monoclonal antibodies are advantageous in that they are synthesized by the hybridoma culture, uncontaminated by other immunoglobulins.
  • the modifier "monoclonal” indicates the character of the antibody as being obtained from a substantially homogeneous population of antibodies, and is not to be construed as requiring production of the antibody by any particular method.
  • the monoclonal antibodies to be used in accordance with the present invention may be made by a variety of techniques, including, for example, the hybridoma method (e.g., Kohler and Milstein., Nature, 256:495-97 (1975); Hongo et al, Hybridoma, 14 (3): 253-260 (1995), Harlow et al, Antibodies: A Laboratory Manual, (Cold Spring Harbor Laboratory Press, 2 nd ed. 1988); Hammerling et al, in: Monoclonal Antibodies and T-Cell Hybridomas 563- 681 (Elsevier, N. Y., 1981)), recombinant DNA methods (see, e.g., U.S. Patent No.
  • phage-display technologies see, e.g., Clackson et al, Nature, 352: 624- 628 (1991); Marks et al, J. Mol Biol. 222: 581-597 (1992); Sidhu et al, J. Mol Biol. 338(2): 299-310 (2004); Lee et al, J. Mol Biol. 340(5): 1073-1093 (2004); Fellouse, Proc. Natl. Acad. ScL USA 101(34): 12467-12472 (2004); and Lee et al, J. Immunol. Methods 284(1-2): 119-132 (2004), and technologies for producing human or humanlike antibodies in animals that have parts or all of the human immunoglobulin loci or genes encoding human immunoglobulin sequences (see, e.g., WO
  • antibody fragment comprises a portion of an intact antibody, preferably the antigen binding and/or the variable region of the intact antibody.
  • antibody fragments include Fab, Fab * , F(ab') 2 and Fv fragments; diabodies; linear antibodies (see U.S. Patent 5,641,870, Example 2; Zapata et al, Protein Eng. 8HO): 1057-1062 [1995]); single-chain antibody molecules and multispecific antibodies formed from antibody fragments. Papain digestion of antibodies produced two identical antigen-binding fragments, called “Fab” fragments, and a residual "Fc” fragment, a designation reflecting the ability to crystallize readily.
  • the Fab fragment consists of an entire L chain along with the variable region domain of the H chain (V H ), and the first constant domain of one heavy chain (CH1).
  • V H variable region domain
  • CH1 first constant domain of one heavy chain
  • Each Fab fragment is monovalent with respect to antigen binding, i.e., it has a single antigen-binding site.
  • Pepsin treatment of an antibody yields a single large F(ab')2 fragment which roughly corresponds to two disulfide linked Fab fragments having different antigen-binding activity and is still capable of cross-linking antigen.
  • Fab' fragments differ from Fab fragments by having a few additional residues at the carboxy terminus of the CH1 domain including one or more cysteines from the antibody hinge region.
  • Fab '-SH is the designation herein for Fab' in which the cysteine residue(s) of the constant domains bear a free thiol group.
  • F(ab')2 antibody fragments originally were produced as pairs of Fab' fragments which have hinge cysteines between them. Other chemical couplings of antibody fragments are also known.
  • the Fc fragment comprises the carboxy-terminal portions of both H chains held together by disulfides.
  • the effector functions of antibodies are determined by sequences in the Fc region, the region which is also recognized by Fc receptors (FcR) found on certain types of cells.
  • Fv is the minimum antibody fragment which contains a complete antigen- recognition and -binding site. This fragment consists of a dimer of one heavy- and one light-chain variable region domain in tight, non-covalent association. From the folding of these two domains emanate six hypervariable loops (3 bops each from the H and L chain) that contribute the amino acid residues for antigen binding and confer antigen binding specificity to the antibody. However, even a single variable domain (or half of an Fv comprising only three HVRs specific for an antigen) has the ability to recognize and bind antigen, although at a lower affinity than the entire binding site.
  • Single-chain Fv also abbreviated as “sFv” or “scFv” are antibody fragments that comprise the VH and V
  • the sFv polypeptide further comprises a polypeptide linker between the VH and V u domains which enables the sFv to form the desired structure for antigen binding.
  • sFv Single-chain Fv
  • “Functional fragments” of the antibodies of the invention comprise a portion of an intact antibody, generally including the antigen binding or variable region of the intact antibody or the Fc region of an antibody which retains or has modified FcR binding capability.
  • antibody fragments include linear antibody, single-chain antibody molecules and multispecific antibodies formed from antibody fragments.
  • diabodies refers to small antibody fragments prepared by constructing sFv fragments (see preceding paragraph) with short linkers (about 5-10) residues) between the VH and VL domains such that inter-chain but not intra-chain pairing of the V domains is achieved, thereby resulting in a bivalent fragment, i.e., a fragment having two antigen-binding sites.
  • Bispecific diabodies are heterodimers of two "crossover" sFv fragments in which the VH and VL domains of the two antibodies are present on different polypeptide chains.
  • Diabodies are described in greater detail in, for example, EP 404,097; WO 93/11161 ; Hollinger et al, Proc. Natl. Acad. ScL USA 90: 6444-6448 (1993).
  • the term "nanobodies” refers to single-domain antibodies which are antibody fragments consisting of a single monomeric variable antibody domain. Like a whole antibody, they are able to bind selectively to a specific antigen. With a molecular weight of only 12-15 kDa, single-domain antibodies are much smaller than common antibodies (150-160 kDa). The first single-domain antibodies were engineered from heavy-chain antibodies found in camelids. Gibbs, W. Wayt (August 2005).
  • the monoclonal antibodies herein specifically include “chimeric” antibodies
  • immunoglobulins in which a portion of the heavy and/or light chain is identical with or homologous to corresponding sequences in antibodies derived from a particular species or belonging to a particular antibody class or subclass, while the remainder of the chain(s) is(are) identical with or homologous to corresponding sequences in antibodies derived from another species or belonging to another antibody class or subclass, as well as fragments of such antibodies, so long as they exhibit the desired biological activity (U.S. Patent No. 4,816,567; Morrison et al, Proc. Natl. Acad. ScL USA, 81 :6851-6855 (1984)).
  • humanized antibody is used a subset of “chimeric antibodies.”
  • “Humanized” forms of non-human (e.g., murine) antibodies are chimeric antibodies that contain minimal sequence derived from non-human immunoglobulin.
  • a humanized antibody is a human immunoglobulin (recipient antibody) in which residues from an HVR (hereinafter defined) of the recipient are replaced by residues from an HVR of a non-human species (donor antibody) such as mouse, rat, rabbit or non-human primate having the desired specificity, affinity, and/or capacity.
  • donor antibody such as mouse, rat, rabbit or non-human primate having the desired specificity, affinity, and/or capacity.
  • framework (“FR") residues of the human immunoglobulin are replaced by corresponding non-human residues.
  • humanized antibodies may comprise residues that are not found in the recipient antibody or in the donor antibody. These modifications may be made to further refine antibody performance, such as binding affinity.
  • a humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the hypervariable loops correspond to those of a non-human immunoglobulin sequence, and all or substantially all of the FR regions are those of a human immunoglobulin sequence, although the FR regions may include one or more individual FR residue substitutions that improve antibody performance, such as binding affinity, isomerization, immunogenicity, etc.
  • the number of these amino acid substitutions in the FR are typically no more than 6 in the H chain, and in the L chain, no more than 3.
  • the humanized antibody optionally will also comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin.
  • Fc immunoglobulin constant region
  • human antibody is an antibody that possesses an amino-acid sequence corresponding to that of an antibody produced by a human and/or has been made using any of the techniques for making human antibodies as disclosed herein. This definition of a human antibody specifically excludes a humanized antibody
  • Human antibodies can be produced using various techniques known in the art, including phage-display libraries.
  • Human antibodies can be prepared by administering the antigen to a transgenic animal that has been modified to produce such antibodies in response to antigenic challenge, but whose endogenous loci have been disabled, e.g., immunized xenomice (see, e.g., U.S. Pat. Nos. 6,075,181 and 6,150,584 regarding XENOMOUSETM
  • hypervariable region when used herein refers to the regions of an antibody variable domain which are hypervariable in sequence and/or form structurally defined loops.
  • antibodies comprise six HVRs; three in the VH (H1, H2, H3), and three in the VL (L1, 12, L3).
  • H3 and L3 display the most diversity of the six HVRs, and H3 in particular is believed to play a unique role in conferring fine specificity to antibodies. See, e.g., Xu et al, Immunity 13:37-45 (2000); Johnson and Wu, in Methods in Molecular Biology 248:1-25 (Lo, ed., Human Press, Totowa, NJ, 2003).
  • camelid antibodies consisting of a heavy chain only are functional and stable in the absence of light chain. See, e.g., Hamers-Casterman et al., Nature 363:446-448 (1993); Sheriff et al, Nature Struct. Biol. 3:733-736 (1996).
  • CDRs Kabat Complementarity Determining Regions
  • HVRs may comprise "extended HVRs" as follows: 24-36 or 24-34 (L1), 46-56 or 50- 56 (L2) and 89-97 or 89-96 (L3) in the VL and 26-35 (H1), 50-65 or 49-65 (H2) and 93-102, 94-102, or 95-102 (H3) in the VH.
  • the variable domain residues are numbered according to Kabat et al., supra, for each of these definitions.
  • variable-domain residue -numbering as in Kabat or “amino-acid- position numbering as in Kabat,” and variations thereof, refers to the numbering system used for heavy-chain variable domains or light-chain variable domains of the compilation of antibodies in Kabat et al., supra. Using this numbering system, the actual linear amino acid sequence may contain fewer or additional amino acids corresponding to a shortening of, or insertion into, a FR or HVR of the variable domain.
  • a heavy-chain variable domain may include a single amino acid insert (residue 52a according to Kabat) after residue 52 of H2 and inserted residues (e.g. residues 82a, 82b, and 82c, etc.
  • a "human consensus framework” or “acceptor human framework” is a framework that represents the most commonly occurring amino acid residues in a selection of human immunoglobulin VL or VH framework sequences. Generally, the selection of human immunoglobulin VL or VH sequences is from a subgroup of variable domain sequences.
  • the subgroup of sequences is a subgroup as in Kabat et al., Sequences of Proteins of Immunological Interest, 5 th Ed. Public Health Service, National Institutes of Health, Bethesda, D (1991). Examples include for the VL, the subgroup may be subgroup kappa I, kappa II, kappa III or kappa IV as in Kabat et al, supra. Additionally, for the VH, the subgroup may be subgroup I, subgroup II, or subgroup III as in Kabat et al., supra.
  • a human consensus framework can be derived from the above in which particular residues, such as when a human framework residue is selected based on its homology to the donor framework by aligning the donor framework sequence with a collection of various human framework sequences.
  • An acceptor human framework "derived from" a human immunoglobulin framework or a human consensus framework may comprise the same amino acid sequence thereof, or it may contain preexisting amino acid sequence changes. In some embodiments, the number of pre-existing amino acid changes are 10 or less, 9 or less, 8 or less, 7 or less, 6 or less, 5 or less, 4 or less, 3 or less, or 2 or less.
  • amino-acid modification at a specified position, e.g. of the Fc region, refers to the substitution or deletion of the specified residue, or the insertion of at least one amino acid residue adjacent the specified residue. Insertion "adjacent" to a specified residue means insertion within one to two residues thereof. The insertion may be N- terminal or C-terminal to the specified residue.
  • the preferred amino acid modification herein is a substitution.
  • an “affinity-matured” antibody is one with one or more alterations in one or more HVRs thereof that result in an improvement in the affinity of the antibody for antigen, compared to a parent antibody that does not possess those alteration(s).
  • an affinity-matured antibody has nanomolar or even picomolar affinities for the target antigen.
  • Affinity-matured antibodies are produced by procedures known in the art. For example, Marks et al, Bio/Technology 10:779-783 (1992) describes affinity maturation by VH- and VL-domain shuffling. Random mutagenesis of HVR and/or framework residues is described by, for example: Barbas et al. Proc Nat. Acad. ScL USA 91 :3809-3813 (1994); Schier et al. Gene 169:147-155 (1995);
  • the term “specifically binds to” or is "specific for” refers to measurable and reproducible interactions such as binding between a target and an antibody, which is determinative of the presence of the target in the presence of a
  • an antibody that specifically binds to a target is an antibody that binds this target with greater affinity, avidity, more readily, and/or with greater duration than it binds to other targets.
  • the extent of binding of an antibody to an unrelated target is less than about 10% of the binding of the antibody to the target as measured, e.g., by a radioimmunoassay (RIA).
  • RIA radioimmunoassay
  • an antibody specifically binds to an epitope on a protein that is conserved among the protein from different species.
  • specific binding can include, but does not require exclusive binding.
  • ADCC antibody-dependent cell-mediated cytotoxicity
  • FcRs Fc receptors
  • cytotoxic cells e.g., natural killer (NK) cells, neutrophils and macrophages
  • NK cells natural killer cells
  • monocytes express FcyRI, FcyRII and FcyRIII.
  • Fc expression on hematopoietic cells is summarized in Table 3 on page 464 of Ravetch and Kinet, Annu. Rev. Immunol. 9: 457-92 (1991).
  • an in vitro ADCC assay such as that described in U.S. Patent No. 5,500,362 or 5,821,337 may be performed.
  • Useful effector cells for such assays include peripheral blood
  • PBMC mononuclear cells
  • NK natural killer cells
  • ADCC activity of the molecule of interest may be assessed in vivo, e.g., in an animal model such as that disclosed in Clynes et al, PNAS USA 95:652-656 (1998).
  • the numbering of the residues in an immunoglobulin heavy chain is that of the EU index as in Kabat et al, supra.
  • the "EU index as in Kabat” refers to the residue numbering of the human tgG1 EU antibody. In many cancers the tumor cells express high levels of PD-L1 on their surface.
  • anti-PD-L1 antibodies with ADCC potential can trigger ADCC which may lead to the death of these tumor cells.
  • Fc region herein is used to define a C-terminal region of an
  • immunoglobulin heavy chain including native-sequence Fc regions and variant Fc regions.
  • the boundaries of the Fc region of an immunoglobulin heavy chain might vary, the human IgG heavy- chain Fc region is usually defined to stretch from an amino acid residue at position Cys226, or from Pro230, to the carboxyl-terminus thereof.
  • the C-terminal lysine (residue 447 according to the EU numbering system) of the Fc region may be removed, for example, during production or purification of the antibody, or by recombinantly engineering the nucleic acid encoding a heavy chain of the antibody.
  • a composition of intact antibodies may comprise antibody populations with all K447 residues removed, antibody populations with no K447 residues removed, and antibody populations having a mixture of antibodies with and without the K447 residue.
  • Suitable native-sequence Fc regions for use in the antibodies of the invention include human lgG1, lgG2 (lgG2A, JgG2B), lgG3 and lgG4.
  • "Fc receptor” or "FcR” describes a receptor that binds to the Fc region of an antibody.
  • the preferred FcR is a native sequence human FcR.
  • a preferred FcR is one which binds an IgG antibody (a gamma receptor) and includes receptors of the FcyRI, FcyRII, and FcyRIII subclasses, including allelic variants and
  • FcyRII receptors include FcyRIIA (an “activating receptor”) and FcyRI IB (an “inhibiting receptor”), which have similar amino acid sequences that differ primarily in the cytoplasmic domains thereof.
  • Activating receptor FcyRIIA contains an immunoreceptor tyrosine -based activation motif (ITAM) in its cytoplasmic domain.
  • Inhibiting receptor FcyRIIB contains an immunoreceptor tyrosine -based activation motif
  • ITIM immunoreceptor tyrosine -based inhibition motif
  • Fc receptor or “FcR” also includes the neonatal receptor, FcRn, which is responsible for the transfer of maternal IgGs to the fetus.
  • FcRn the neonatal receptor
  • Methods of measuring binding to FcRn are known (see, e.g., Ghetie and Ward, Immunol. Today 18: (12): 592-8 (1997); Ghetie et al, Nature Biotechnology 15 (7): 637-40 (1997); Hinton et al, J. Biol. Chem.
  • Binding to FcRn in vivo and serum half-life of human FcRn high- affinity binding polypeptides can be assayed, e.g., in transgenic mice or transfected human cell lines expressing human FcRn, or in primates to which the polypeptides having a variant Fc region are administered.
  • WO 2004/42072 (Presta) describes antibody variants which improved or diminished binding to FcRs. See also, e.g., Shields et al, J. Biol. Chem. 9(2):
  • “Effector cells” are leukocytes which express one or more FcRs and perform effector functions.
  • the effector cells express at least FcyRIII and perform ADCC effector function.
  • human leukocytes which mediate ADCC include peripheral blood mononuclear cells (PBMC), natural killer (NK) cells, monocytes, cytotoxic T cells and neutrophils.
  • PBMC peripheral blood mononuclear cells
  • NK natural killer cells
  • monocytes cytotoxic T cells
  • neutrophils neutrophils.
  • the effector cells may be isolated from a native source, e.g., blood. Effector cells generally are lymphocytes associated with the effector phase, and function to produce cytokines (helper T cells), killing cells in infected with pathogens (cytotoxic T cells) or secreting antibodies (differentiated B cells).
  • Binding affinity generally refers to the strength of the sum total of non-covalent interactions between a single binding site of a molecule (e.g., of an antibody) and its binding partner (e.g., an antigen). Unless indicated otherwise, as used herein, "binding affinity”, “bind to”, “binds to” or “binding to” refers to intrinsic binding affinity that reflects a 1 : 1 interaction between members of a binding pair (e.g. , antibody Fab fragment and antigen).
  • the affinity of a molecule X for its partner Y can generally be represented by the dissociation constant (K D ). Affinity can be measured by common methods known in the art, including those described herein.
  • binding affinity generally bind antigen slowly and tend to dissociate readily, whereas high- affinity antibodies generally bind antigen faster and tend to remain bound longer.
  • a variety of methods of measuring binding affinity are known in the art, any of which can be used for purposes of the present invention. Specific illustrative and exemplary embodiments for measuring binding affinity, i.e. binding strength are described in the following.
  • the "KD" or "KD value” according to this invention is in one embodiment measured by a radiolabeled antigen binding assay (RIA) performed with the Fab version of the antibody and antigen molecule as described by the following assay that measures solution binding affinity of Fabs for antigen by equilibrating Fab with a minimal concentration of ( 125 l)-labeled antigen in the presence of a titration series of unlabeled antigen, then capturing bound antigen with an anti- Fab antibody-coated plate (Chen, et al, (1999) J. ol Biol 293:865-881).
  • RIA radiolabeled antigen binding assay
  • microtiter plates (Dynex) are coated overnight with 5 ug/ml of a capturing anti- Fab antibody (Cappel Labs) in 50 mM sodium carbonate (pH 9.6), and subsequently blocked with 2% (w v) bovine serum albumin in PBS for two to five hours at room temperature (approximately 23°C).
  • a non-adsorbant plate (Nunc #269620) 100 pM or 26 pM [ 125 l]-antigen are mixed with serial dilutions of a Fab of interest
  • the K D is measured by using surface-plasmon resonance assays using a BIACORE ® -2000 or a
  • CM5 chips immobilized antigen CM5 chips at -10 response units (RU).
  • carboxymethylated dextran biosensor chips CM5, BIAcore Inc.
  • EDC N- ethyl-N'- (3-dimethylaminopropyl)-carbodiimide hydrochloride
  • NHS N- hydroxysuccinimide
  • Antigen is diluted with 10 mM sodium acetate, pH 4.8, to 5 pg/ml (-0.2 ⁇ ) before injection at a flow rate of 5 ptJminute to achieve approximately 10 response units (RU) of coupled protein.
  • 1 M ethanolamine is injected to block unreacted groups.
  • K D equilibrium dissociation constant
  • a spectrometer such as a stop-flow- equipped spectrophotometer (Aviv Instruments) or a 8000-series SLM-AMINCOTM spectrophotometer (ThermoSpectronic) with a stirred cuvette.
  • a spectrometer such as a stop-flow- equipped spectrophotometer (Aviv Instruments) or a 8000-series SLM-AMINCOTM spectrophotometer (ThermoSpectronic) with a stirred cuvette.
  • CM5 carboxymethylated dextran biosensor ships
  • ECD N-ethyl-N'-(3- dimethylamino propyl )-carbodiimide hydrochloride
  • NHS N-hydroxysuccinimide
  • Antigen is diluted with 10 mM sodium acetate, ph 4.8, into 5 mg/ml ( ⁇ 0.2 mM) before injection at a flow rate of 5 ml/min. to achieve approximately 10 response units (RU) of coupled protein.
  • IM ethanolamine is added to block unreacted groups.
  • two-fold serial dilutions of Fab (0.78 nM to 500 nM) are injected in PBS with 0.05% Tween 20 (PBST) at 25°C at a flow rate of approximately 25ul/min.
  • association rates (k on ) and dissociation rates (k 0 ff) are calculated using a simple one-to-one Langmuir binding model (BIAcore Evaluation Software version 3.2) by simultaneous fitting the association and dissociation sensorgram.
  • the equilibrium dissociation constant (KD) was calculated as the ratio k 0f i/k on . See, e.g., Chen, Y., et al, (1999) J. ol Biol 293:865-881.
  • the term "functional epitope” as used herein refers to amino acid residues of an antigen that contribute energetically to the binding of an antibody, i.e. forming an "energetic epitope”. Mutation of any one of the energetically contributing residues of the antigen to alanine will disrupt the binding of the antibody such that the relative KD ratio (KD mutant PD-L1 / KD wild type PD-L1) of the antibody will be greater than 4 (see Example 3.x(b)).
  • conformation epitope refers to amino acid residues of the PD-L1 antigen that come together on the surface when the polypeptide chain folds to form the native protein, and show a significantly reduced rate of HD exchange due to Fab binding, as described in the experimental section.
  • the conformation epitope contains, but is not limited to, the functional epitope.
  • the difference between the two values is, for example, greater than about 10%, greater than about 20%, greater than about 30%, greater than about 40%, and/or greater than about 50% as a function of the value for the reference/comparator molecule.
  • substantially similar denotes a sufficiently high degree of similarity between two numeric values (for example, one associated with an antibody of the invention and the other associated with a reference/comparator antibody), such that one of skill in the art would consider the difference between the two values to be of little or no biological and/or statistical significance within the context of the biological characteristic measured by said values ⁇ e.g., KD values).
  • the difference between said two values is, for example, less than about 50%, less than about 40%, less than about 30%, less than about 20%, and/or less than about 10% as a function of the reference/comparator value.
  • Percent (%) amino acid sequence identity and “homology” with respect to a peptide, polypeptide or antibody sequence are defined as the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in the specific peptide or polypeptide sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2 or ALIGN software. Those skilled in the art can determine appropriate parameters for measuring alignment, including any algorithms needed to achieve maximal alignment over the full length of the sequences being compared.
  • blocking antibody or an “antagonist” antibody is one that inhibits or reduces a biological activity of the antigen it binds to.
  • blocking antibodies or antagonist antibodies substantially or completely inhibit the biological activity of the antigen.
  • the anti-PD-L1 antibodies of the invention block the
  • agonist or activating antibody is one that enhances or initiates signaling by the antigen to which it binds.
  • agonist antibodies cause or activate signaling without the presence of the natural ligand.
  • cross-compete means the ability of an antibody or fragment thereof to interfere with the binding directly or indirectly through allosteric modulation of the anti-PD-L1 antibodies of the invention to the target human PD-L1.
  • the extent to which an an antibody or fragment thereof is able to interfere with the binding of another to the target, and therefore whether it can be said to cross-block or cross-compete according to the invention, can be determined using competition binding assays.
  • One particularly suitable quantitative cross-competition assay uses a FACS- or an AlphaScreen-based approach to measure competition between the labelled (e.g.
  • a suitable assay for determining whether a binding molecule cross-competes or is capable of cross-competing with an antibody or fragment thereof.
  • a cross-competing antibody or fragment thereof is for example one which will bind to the target in the cross-competition assay such that, during the assay and in the presence of a second antibody or fragment thereof, the recorded displacement of the immunoglobulin single variable domain or polypeptide according to the invention is up to 100% (e.g. in FACS based
  • cross-competing antibodies or fragments thereof have a recorded displacement that is between 10% and 100%, more preferred between 50% to 100%.
  • an "isolated" nucleic acid molecule encoding the antibodies herein is a nucleic acid molecule that is identified and separated from at least one contaminant nucleic acid molecule with which it is ordinarily associated in the environment in which it was produced. Preferably, the isolated nucleic acid is free of association with all components associated with the production environment.
  • the isolated nucleic acid molecules encoding the polypeptides and antibodies herein is in a form other than in the form or setting in which it is found in nature. Isolated nucleic acid molecules therefore are distinguished from nucleic acid encoding the polypeptides and antibodies herein existing naturally in cells.
  • control sequences refers to DNA sequences necessary for the expression of an operably linked coding sequence in a particular host organism.
  • control sequences that are suitable for prokaryotes include a promoter, optionally an operator sequence, and a ribosome binding site.
  • Eukaryotic cells are known to utilize promoters, polyadenylation signals, and enhancers.
  • Nucleic acid is "operably linked" when it is placed into a functional relationship with another nucleic acid sequence.
  • DNA for a presequence or secretory leader is operably linked to DNA for a polypeptide if it is expressed as a preprotein that participates in the secretion of the polypeptide; a promoter or enhancer is operably linked to a coding sequence if it affects the transcription of the sequence; or a ribosome binding site is operably linked to a coding sequence if it is positioned so as to facilitate translation.
  • "operably linked" means that the DNA sequences being linked are contiguous, and, in the case of a secretory leader, contiguous and in reading phase. However, enhancers do not have to be contiguous. Linking is accomplished by ligation at convenient restriction sites.
  • a “stable" formulation is one in which the protein therein essentially retains its physical and chemical stability and integrity upon storage.
  • Various analytical techniques for measuring protein stability are available in the art and are reviewed in Peptide and Protein Drug Delivery, 247-301 , Vincent Lee Ed., Marcel Dekker, Inc., New York, New York, Pubs. (1991) and Jones, A. Adv. Drug Delivery Rev. 10: 29-90 (1993). Stability can be measured at a selected temperature for a selected time period. For rapid screening, the formulation may be kept at 40°C for 2 weeks to 1 month, at which time stability is measured.
  • the formulation should be stable at 30°C or 40°C for at least 1 month and/or stable at 2-8°C for at least 2 years.
  • the formulation should be stable for at least 2 years at 30°C and/or stable at 40°C for at least 6 months.
  • the extent of aggregation during storage can be used as an indicator of protein stability.
  • a "stable" formulation may be one wherein less than about 10% and preferably less than about 5% of the protein are present as an aggregate in the formulation. In other embodiments, any increase in aggregate formation during storage of the formulation can be determined.
  • a "reconstituted" formulation is one which has been prepared by dissolving a lyophilized protein or antibody formulation in a diluent such that the protein is dispersed throughout.
  • the reconstituted formulation is suitable for administration (e.g. subscutaneous administration) to a patient to be treated with the protein of interest and, in certain embodiments of the invention, may be one which is suitable for parenteral or intravenous administration.
  • An "isotonic" formulation is one which has essentially the same osmotic pressure as human blood. Isotonic formulations will generally have an osmotic pressure from about 250 to 350 mOsm.
  • the term “hypotonic” describes a formulation with an osmotic pressure below that of human blood.
  • the term “hypertonic” is used to describe a formulation with an osmotic pressure above that of human blood. Isotonicity can be measured using a vapor pressure or ice-freezing type osmometer, for example.
  • the formulations of the present invention are hypertonic as a result of the addition of salt and/or buffer.
  • Carriers as used herein include pharmaceutically acceptable carriers, excipients, or stabilizers that are nontoxic to the cell or mammal being exposed thereto at the dosages and concentrations employed. Often the physiologically acceptable carrier is an aqueous pH buffered solution.
  • physiologically acceptable carriers include buffers such as phosphate, citrate, and other organic acids; antioxidants including ascorbic acid; low molecular weight (less than about 10 residues) polypeptide; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as
  • polyvinylpyrrolidone amino acids such as glycine, glutamine, asparagine, arginine or lysine; monosaccharides, disaccharides, and other carbohydrates including glucose, mannose, or dextrins; chelating agents such as EDTA; sugar alcohols such as mannitol or sorbitol; salt- forming counterions such as sodium; and/or nonionic surfactants such as TWEENTM, polyethylene glycol (PEG), and PLURONICSTM.
  • amino acids such as glycine, glutamine, asparagine, arginine or lysine
  • monosaccharides, disaccharides, and other carbohydrates including glucose, mannose, or dextrins chelating agents such as EDTA
  • sugar alcohols such as mannitol or sorbitol
  • salt- forming counterions such as sodium
  • nonionic surfactants such as TWEENTM, polyethylene glycol (PEG), and PLURONICSTM
  • a “pharmaceutically acceptable acid” includes inorganic and organic acids which are non toxic at the concentration and manner in which they are formulated.
  • suitable inorganic acids include hydrochloric, perchloric, hydrobromic, hydroiodic, nitric, sulfuric, sulfonic, sulfuric, sulfanilic, phosphoric, carbonic, etc.
  • Suitable organic acids include straight and branched-chain alkyl, aromatic, cyclic, cycloaliphatic, arylaliphatic, heterocyclic, saturated, unsaturated, mono, di- and tricarboxylic, including for example, formic, acetic, 2-hydroxyacetic, trifluoroacetic, phenylacetic, trimethylacetic, t-butyl acetic, anthranilic, propanoic, 2- hydroxypropanoic, 2-oxopropanoic, propandioic, cyclopentanepropionic,
  • camphorsulphonic 4-methylbicyclo[2.2.2]-oct-2-ene-l-carboxylic, glucoheptonic, 4,4'- methylenebis-3-(hydroxy-2-ene-l-carboxylic acid), hydroxynapthoic.
  • “Pharmaceutically-acceptable bases” include inorganic and organic bases which are non-toxic at the concentration and manner in which they are formulated.
  • suitable bases include those formed from inorganic base forming metals such as lithium, sodium, potassium, magnesium, calcium, ammonium, iron, zinc, copper, manganese, aluminum, N- methylglucamine, morpholine, piperidine and organic nontoxic bases including, primary, secondary and tertiary amines, substituted amines, cyclic amines and basic ion exchange resins, [e.g., N(R') 4 + (where R' is independently H or C1-4 alkyl, e.g., ammonium, Tris)], for example, isopropylamine, trimethylamine, diethylamine, triethylamine, tripropylamine, ethanolamine, 2- diethylaminoethanol, trimethamine, dicyclohexylamine, lysine, arginine, histidine, caffeine, pro
  • organic non-toxic bases are isopropylamine, diethylamine, ethanolamine, trimethamine, dicyclohexylamine, choline, and caffeine.
  • Additional pharmaceutically acceptable acids and bases useable with the present invention include those which are derived from the amino acids, for example, histidine, glycine, phenylalanine, aspartic acid, glutamic acid, lysine and asparagine.
  • "Pharmaceutically acceptable" buffers and salts include those derived from both acid and base addition salts of the above indicated acids and bases. Specific buffers and/ or salts include histidine, succinate and acetate.
  • a "pharmaceutically acceptable sugar” is a molecule which, when combined with a protein of interest, significantly prevents or reduces chemical and/or physical instability of the protein upon storage.
  • “pharmaceutically acceptable sugars” may also be known as a "lyoprotectant”.
  • “Exemplary sugars and their corresponding sugar alcohols include: an amino acid such as monosodium glutamate or histidine; a methylamine such as betaine; a lyotropic salt such as magnesium sulfate; a polyol such as trihydric or higher molecular weight sugar alcohols, e.g. glycerin, dextran, erythritol, glycerol, arabitol, xylitol, sorbitol, and mannitol; propylene glycol;
  • polyethylene glycol polyethylene glycol; PLURONICS ® ; and combinations thereof.
  • Additional exemplary lyoprotectants include glycerin and gelatin, and the sugars mellibiose, melezitose, raffmose, mannotriose and stachyose.
  • reducing sugars include glucose, maltose, lactose, maltulose, iso-maltulose and lactulose.
  • non-reducing sugars include non-reducing glycosides of polyhydroxy compounds selected from sugar alcohols and other straight chain polyalcohols.
  • Preferred sugar alcohols are monoglycosides, especially those compounds obtained by reduction of disaccharides such as lactose, maltose, lactulose and maltulose.
  • the glycosidic side group can be either glucosidic or galactosidic. Additional examples of sugar alcohols are glucitol, maltitol, lactitol and iso-maltulose.
  • the preferred pharmaceutically-acceptable sugars are the non-reducing sugars trehalose or sucrose.
  • Pharmaceutically acceptable sugars are added to the formulation in a "protecting amount" (e.g. pre-lyophilization) which means that the protein essentially retains its physical and chemical stability and integrity during storage (e.g., after reconstitution and storage).
  • the "diluent" of interest herein is one which is pharmaceutically acceptable (safe and non-toxic for administration to a human) and is useful for the preparation of a liquid formulation, such as a formulation reconstituted after lyophilization.
  • exemplary diluents include sterile water, bacteriostatic water for injection (BWFI), a pH buffered solution (e.g. phosphate-buffered saline), sterile saline solution, Ringer's solution or dextrose solution.
  • BWFI bacteriostatic water for injection
  • a pH buffered solution e.g. phosphate-buffered saline
  • sterile saline solution e.g. phosphate-buffered saline
  • Ringer's solution or dextrose solution e.g. phosphate-buffered saline
  • diluents can include aqueous solutions of salts and/or buffers.
  • a "preservative” is a compound which can be added to the formulations herein to reduce bacterial activity.
  • the addition of a preservative may, for example, facilitate the production of a multi-use (multiple-dose) formulation.
  • potential preservatives include octadecyldimethylbenzyl ammonium chloride, hexamethonium chloride, benzalkonium chloride (a mixture of alkylbenzyldimethylammonium chlorides in which the alkyl groups are long-chain compounds), and benzethonium chloride.
  • preservatives include aromatic alcohols such as phenol, butyl and benzyl alcohol, alkyl parabens such as methyl or propyl paraben, catechol, resorcinol, cyclohexanol, 3-pentanol, and w-cresol.
  • aromatic alcohols such as phenol, butyl and benzyl alcohol
  • alkyl parabens such as methyl or propyl paraben
  • catechol resorcinol
  • cyclohexanol 3-pentanol
  • w-cresol w-cresol
  • the most preferred preservative herein is benzyl alcohol.
  • 'Treatment' refers to clinical intervention designed to alter the natural course of the individual or cell being treated, and can be performed either for prophylaxis or during the course of clinical pathology.
  • Desirable effects of treatment include preventing occurrence or recurrence of disease, preventing metastasis, decreasing the rate of disease progression, ameliorating or palliating the disease state, and remission or improved prognosis.
  • antibodies of the invention are used to delay development of a disease or disorder.
  • a subject is successfully "treated", for example, using the apoptotic anti-PD-L1 antibodies of the invention if one or more symptoms associated with a T-cell dysfunctional disorder is mitigated.
  • an “effective amount' refers to at least an amount effective, at dosages and for periods of time necessary, to achieve the desired or indicated effect, including a therapeutic or prophylactic result.
  • an effective amount of the anti-PD-L1 antibodies of the present invention is at least the minimum concentration that results in inhibition of signaling from PD-L1, either through PD-1 on T-cells or B7.1 on other APCs or both.
  • a “therapeutically effective amount' is at least the minimum concentration required to effect a measurable improvement or prevention of a particular disorder.
  • therapeutically effective amount herein may vary according to factors such as the disease state, age, sex, and weight of the patient, and the ability of the antibody to elicit a desired response in the individual.
  • a therapeutically effective amount is also one in which any toxic or detrimental effects of the antibody are outweighed by the therapeutically beneficial effects.
  • a therapeutically effective amount of the anti-PD-L1 antibodies of the present invention is at least the minimum
  • prophylactically effective amount refers to an amount effective, at the dosages and for periods of time necessary, to achieve the desired prophylactic result.
  • a prophylactically effective amount of the anti-PD-L1 antibodies of the present invention is at least the minimum concentration that prevents or attenuates the development of at least one symptom of a T cell dysfunctional disorder.
  • “Mammal” for purposes of treatment refers to any animal classified as a mammal, including humans, domestic and farm animals, and zoo, sports, or pet animals, such as dogs, horses, rabbits, cattle, pigs, hamsters, gerbils, mice, ferrets, rats, cats, etc.
  • the mammal is human.
  • 'pharmaceutical formulation refers to a preparation that is in such form as to permit the biological activity of the active ingredient to be effective, and that contains no additional components that are unacceptably toxic to a subject to which the formulation would be administered. Such formulations are sterile.
  • a "sterile" formulation is aseptic or free from all living microorganisms and their spores.
  • autoimmune disorder is a disease or disorder arising from and directed against an individual's own tissues or organs or a co-segregation or manifestation thereof or resulting condition therefrom.
  • Autoimmune diseases can be an organ-specific disease (i.e., the immune response is specifically directed against an organ system such as the endocrine system, the hematopoietic system, the skin, the cardiopulmonary system, the gastrointestinal and liver systems, the renal system, the thyroid, the ears, the neuromuscular system, the central nervous system, etc.) or a systemic disease that can affect multiple organ systems (for example, systemic lupus erythematosus (SLE), rheumatoid arthritis (RA), polymyositis, etc.).
  • SLE systemic lupus erythematosus
  • RA rheumatoid arthritis
  • Preferred such diseases include autoimmune rheumatologic disorders (such as, for example, RA, Sjogren's syndrome, scleroderma, lupus such as SLE and lupus nephritis,
  • polymyositis-dermatomyositis, cryoglobulinemia, anti-phospholipid antibody syndrome, and psoriatic arthritis autoimmune gastrointestinal and liver disorders (such as, for example, inflammatory bowel diseases ⁇ e.g., ulcerative colitis and Crohn's disease), autoimmune gastritis and pernicious anemia, autoimmune hepatitis, primary biliary cirrhosis, primary sclerosing cholangitis, and celiac disease), vasculitis (such as, for example, ANCA-negative vasculitis and ANCA-associated vasculitis, including Churg-Strauss vasculitis, Wegener's granulomatosis, and microscopic polyangiitis), autoimmune neurological disorders (such as, for example, multiple sclerosis, opsoclonus myoclonus syndrome, myasthenia gravis,
  • neuromyelitis optica Parkinson's disease, Alzheimer's disease, and autoimmune polyneuropathies
  • renal disorders such as, for example, glomerulonephritis
  • autoimmune dermatologic disorders such as, for example, psoriasis, urticaria, hives, pemphigus vulgaris, bullous pemphigoid, and cutaneous lupus erythematosus
  • hematologic disorders such as, for example, thrombocytopenic purpura, thrombotic thrombocytopenic purpura, post-transfusion purpura, and autoimmune hemolytic anemia
  • Atherosclerosis uveitis
  • autoimmune hearing diseases such as, for example, inner ear disease and hearing loss
  • Behcet's disease Raynaud's syndrome
  • organ transplant organ transplant
  • autoimmune endocrine disorders such as, for example, diabetic- related autoimmune diseases such as insulin-dependent diabetes mellitus (IDDM), Addison's disease, and autoimmune thyroid disease (e.g., Graves' disease and thyroiditis)
  • IDDM insulin-dependent diabetes mellitus
  • Addison's disease e.g., Graves' disease and thyroiditis
  • More preferred such diseases include, for example, RA, ulcerative colitis, ANCA-associated vasculitis, lupus, multiple sclerosis, Sjogren's syndrome, Graves' disease, IDDM, pernicious anemia, thyroiditis, and glomerulonephritis.
  • cytotoxic agent refers to a substance that inhibits or prevents the function of cells and/or causes destruction of cells.
  • the term includes radioactive isotopes (e.g. At 211 , 1 131 , 1 125 , Y 90 , Re 186 , Re 188 , Sm 153 , Bi 212 , P 32 and radioactive isotopes of Lu), and toxins such as small-molecule toxins or enzymatically active toxins of bacterial, fungal, plant or animal origin, or fragments thereof.
  • a "chemotherapeutic agent” is a chemical compound useful in the treatment of cancer.
  • chemotherapeutic agents include alkylating agents such as thiotepa and cyclophosphamide; alkyl sulfonates such as busulfan, improsulfan, and piposulfan; aziridines such as benzodopa, carboquone, meturedopa, and uredopa; ethylenimines and methylamelamines including altretamine, triethylenemelamine, trietylenephosphoramide, triethiylenethiophosphoramide and trimethylolomelamine; acetogenins (especially bullatacin and butlatacinone); delta-9-tetrahydrocannabinol (dronabinol); beta-lapachone; lapachol; colchicines; betulinic acid; a camptothecin (including the synthetic analogue topotecan (CPT-11 (irinotecan),
  • pemetrexed including its adozelesin, carzelesin and bizelesin synthetic analogues); podophyllotoxin; podophyllinic acid; teniposide; cryptophycins (particularly cryptophycin 1 and cryptophycin 8); dolastatin; duocarmycin (including the synthetic analogues, KW-2189 and CB1-TM1); eleutherobin; pancratistatin; TLK- 286; CDP323, an oral alpha-4 integrin inhibitor; a sarcodictyin; spongistatin; nitrogen mustards such as chlorambucil, chlornaphazine, cholophosphamide, estramustine, ifosfamide, mechlorethamine, mechlorethamine oxide hydrochloride, melphalan, novembichin, phenestenne, prednimustine, trofosfamide, uracil mustard
  • antibiotics such as the enediyne antibiotics (e. g., calicheamicin, especially calicheamicin gammall and calicheamicin omegall (see, e.g., Nicolaou et ah, Angew. Chem Intl. Ed.
  • dynemicin including dynemicin A; an esperamicin; as well as neocarzinostatin chromophore and related chromoprotein enediyne antibiotic chromophores), aclacinomysins, actinomycin, authramycin, azaserine, bleomycins, cactinomycin, carabicin, carminomycin, carzinophilin, chromomycinis, dactinomycin, daunorubicin, detorubicin, 6-diazo-5- oxo-L-norleucine, doxorubicin (including morpholino-doxorubicin, cyanomorpholino- doxorubicin, 2-pyrrolino- doxorubicin, doxorubicin HCI liposome injection and deoxydoxorubicin), epirubicin, esorubicin
  • amsacrine bestrabucil
  • bisantrene edatraxate
  • defofamine demecolcine
  • diaziquone diaziquone; elfornithine; elliptinium acetate; etoglucid; gallium nitrate; hydroxyurea; lentinan; lonidainine; maytansinoids such as maytansine and ansamitocins;
  • mitoguazone mitoxantrone; mopidanmol; nitraerine; pentostatin; phenamet;
  • trichothecenes especially T-2 toxin, verracurin A, roridin A and anguidine
  • urethan vindesine; dacarbazine; mannomustine; mitobronitol; mitolactol; pipobroman;
  • gacytosine arabinoside ("Ara-C”); thiotepa; taxoids, e.g., paclitaxel, albumin- engineered nanoparticle formulation of paclitaxel, and doxetaxel; chloranbucil; 6- thioguanine; mercaptopurine; methotrexate; platinum analogs such as cisplatin and carboplatin; vinblastine; platinum; etoposide (VP-16); ifosfamide; mitoxantrone;
  • retinoids such as retinoic acid
  • pharmaceutically acceptable salts, acids or derivatives of any of the above as well as combinations of two or more of the above such as CHOP, an abbreviation for a combined therapy of cyclophosphamide, doxorubicin, vincristine, and prednisolone, and FOLFOX, an abbreviation for a treatment regimen with oxaliplatin combined with 5-FU and leucovovin.
  • anti-PD-L1 antibodies of the invention are bisphosphonates such as clodronate, NE-58095, zoledronic acid/zoledronate, alendronate, pamidronate, tiludronate, or risedronate; as well as troxacitabine (a 1 ,3-dioxolane nucleoside cytosine analog); anti-sense oligonucleotides, particularly those that inhibit expression of genes in signaling pathways implicated in abherant cell proliferation, such as, for example, PKC-alpha, Raf, H-Ras, and epidermal growth factor receptor (EGF-R); vaccines such as
  • Stimuvax vaccine for example, Allovectin vaccine, Leuvectin vaccine, and Vaxid vaccine; topoisomerase 1 inhibitor; an anti-estrogen such as fulvestrant; a Kit inhibitor such as imatinib or EXEL-0862 (a tyrosine kinase inhibitor); EGFR inhibitor such as erlotinib or cetuximab; an anti- VEGF inhibitor such as bevacizumab; arinotecan; rmRH; lapatinib and lapatinib ditosylate (an ErbB-2 and EGFR dual tyrosine kinase small-molecule inhibitor also known as GW572016); 17AAG (geldanamycin derivative that is a heat shock protein (Hsp) 90 poison), and pharmaceutically acceptable salts, acids or derivatives of any of the above.
  • Hsp heat shock protein
  • Stimuvax is a BLP25 liposome cancer vaccine designed to induce an immune response to cancer cells that express MUC1 , a protein antigen widely expressed on common cancers. MUC1 is over expressed on many cancers such as lung cancer, breast cancer, prostate cancer and colorectal cancer. Stimuvax is thought to work by stimulating the body's immune system to identify and destroy cancer cells expressing MUC1.
  • Figure 1 shows that A09-246-2 efficiently blocks 125 I-PD-L1 binding to immobilized PD-1-Fc .
  • Inactive mutant Mutant VL-A31G,D52E,R99Y of A09-188-1.
  • Figure 2 shows sequence of the extracellular domain (fused to a 6 amino acid His tag, SEQ ID NO:29) of PD-L1. Peptides that could be identified by MS are indicated by grey bars. Those that showed protection from HD exchange in the presence of Fab are represented by black bars. Peptides that could not be analyzed are highlighted by underlining and italicizing in the sequence.
  • Figure 3 shows the epitope of A09-246-2 on PD-L1. The backbone of PD-L1 is shown in a ribbon representation. Amino acids which, when mutated to alanine, destabilize the A09-246-2 - PD-L1 binding by more than 0.7 kcal/mol are shown as sticks.
  • Figure 4 shows that A09-246-2 efficiently enhances T cell activities represented by IL-2 production as shown by SEA human PBMC assay.
  • FIGS. 5-16 show that A09-246-2 increases ADCC in different tumor lines
  • Antibodies were selected from phage Fab display libraries. The selection included two different arms one utilizing biotinylated human PD-L1 on the different selection rounds and other alternating human and mouse PD-L1 as target on different rounds. 3840 clones were screened by ELISA to identify 170 individual PD-L1 binders. Based on the inhibition of PD-1 ligand binding, 48 hits were selected and were expressed in medium scale for further characterization.
  • Hit optimization candidates were selected based on the potency to block binding of PD-1 to PD-L1 and the ability of binding to both human and mouse versions of PD-L1. Binding to PD-L1 was originally determined by ELISA and later quantified by Biacore and binding to PD-L1 expressing cells by FACS. Four candidates fitted the predefined profile, including A09-188-1 which contained a lambda light chain.
  • A09-188-1 was chosen for affinity maturation and sequence optimization.
  • the goals of the affinity maturation were increased affinity to the human target, cross-reactivity to the murine target, and improvement of manufacturabiiity.
  • Heavy chain mutations in the HVR's were introduced by codon based randomization. This heavy chain diversity was combined with light chain diversity introduced by light chain shuffling to generate the affinity maturation library. Further heavy and light chain FR and HVR residues were mutated to increase stability of the antibody and introduce amino acids found in the germline, such as the heavy chain FR mutation 193V.
  • HVR-H1 sequence is X1YX2MX3 (SEQ ID NO:1);
  • HVR-H2 sequence is SIYPSGGX4TFYADX5VKG (SEQ ID NO:2);
  • HVR-H3 sequence is IKLGTVTTVX 6 Y (SEQ ID NO:3);
  • X ! is K, R, T, Q, G, A, W, M, I or S
  • X 2 is V, R, K, L, M or I
  • X 3 is H, T, N, Q, A, V, Y, W, F or M
  • X4 is F or I
  • X5 is S or T
  • Xe is E or D
  • HVR-L1 sequence is TGTXyXeDVGXgYNYVS (SEQ ID NO:8);
  • HVR-L2 sequence is X 10 VXnXi 2 RPS (SEQ ID NO:9);
  • HVR-L3 sequence is SSX 13 TX 14 Xi5Xi6Xi7RV (SEQ ID NO: 10);
  • X 7 is N or S
  • X 8 is T, R or S
  • X 9 is A or G
  • X 10 is E or D
  • Xn is I, N or S
  • Xi 2 is D, H or N
  • X13 is F or Y
  • X i4 is N or S
  • X15 is R, T or S
  • X i6 is G or S
  • X17 is I or T.
  • Cell cultures were conducted in batch mode in a 250L Single-use-Bioreactor (SUB) (Table 2-2). Cells were grown in ProCH05 growth media supplemented with 4 m L- Glutamine + 25 pg/mL puromycin at 37 °C. The cultures were fed with 15% Efficient Feed B and 1.0 mM valproic acid 3 days after inoculation.
  • Millistak+ Pod D0HC (Millipore MD0HC10FS1) and 0.11 m2 Millistak+ Pod A1HC (Millipore MA1HC01FS1) filters, followed by terminal filtration with a Sartopore 2 filter (Sartorius 5445307H8-SS).
  • Pod D0HC (Millipore MD0HC10FS1)
  • 0.11 m2 Millistak+ Pod A1HC (Millipore MA1HC01FS1) filters
  • terminal filtration with a Sartopore 2 filter (Sartorius 5445307H8-SS).
  • the purification process consisted of two chromatography steps; (a) MabSelect Protein A to capture the antibody from the clarified harvest, and (b) Hydroxyapatite Type II polish step to remove remaining aggregated product, host cell proteins and DNA, and product related impurities.
  • An intermediate Q-filtration step was inserted between the 2 chromatography steps to further reduce DNA.
  • SDS-PAGE and size exclusion chromatography SE-HPLC were used to analyze in-process samples during purification. Protein content of the Mabselect in-process samples was performed using the Protein A HPLC method while UVA is spectroscopy was used for all other process steps.
  • Post Mabselect eluates were subjected to 30 min of low pH viral inactivation (pH 3.7) and subsequently neutralized to pH 7.0 prior to the next purification step.
  • the final polishing step was the hydroxyapatite Type II chromatography.
  • the conductivity of the Sartobind Q filtrate was adjusted to ⁇ 3 mS/cm with water, and pH reduced to 6.5 with acetic acid before sample loading.
  • Bound anti-PD-L1 product was eluted with a NaCI step gradient. Aggregated product-related impurities was eluted with the Strip Buffer.
  • Purified anti-PDL1 from the hydroxyapatite polishing step were concentrated and then diafiltered into their respective buffers according to the Table below.
  • the bulk products were then sterile-filtered through 0.2 filter units and further diluted with formulation buffer to their final concentrations.
  • Formulated bulk substance were further tested for endotoxin and checked by SE-HPLC.
  • the formulation contains antioxidative excipients and was shown to be sufficiently stable at the following stress conditions:
  • Binding affinity and selectivity was determined by Biacore assays.
  • the affinity of the lead antibody candidate for human and non human orthologues is summarized in the table below.
  • the binding affinity of anti PD-L1 antibody A09-246-2 according to this invention for human, mouse and cynomolgus monkey proteins was statistically similar but highly reduced for dog, rat and rabbit proteins that displayed a very fast dissociation profile.
  • ka d/M sl kd d/sl * KD(M> KD(nM) : .+/- STD
  • VL-A31G VH-
  • VL-A31G VH-
  • VL-A31G VH-
  • VL-A31G VH-
  • VL-A31G VH-
  • VL-A31G VH-
  • VL-A31G VH-
  • VL-A31G VH-
  • VL-A31G VH-
  • Selectivity was determined by evaluating the binding to members of the B7 family including hu-PD- L1-huFc, hu-PDL-2-huFc, hu-B7.1-huFc, hu-B7.2-huFc, huB7-H2- huFc and huB7-H3-huFc by Biacore.
  • Binding Buffer 50 mM Hepes, pH 7.5, 130 mM NaCI, 5.1 mM KCI, 1.3 mM MgS0 4 Assay buffer: binding buffer + 0.5% BSA
  • A09-246-2 The ability of A09-246-2 to block soluble B7.1 binding to PD-L1 on cell surface was measured by FACS. Results indicated A09-246-2 efficiently blocks the interaction of B7.1 and PD-L1 with an IC50 of 0.2 ⁇ 0.004nM (0.03 ⁇ 0.0006 ⁇ g/ml).
  • the extracellular domain of PD-L1 antigen (SEQ ID NO:29) was incubated in heavy water (D 2 0) solution to allow amide protons on the protein backbone to exchange with deuterons from the solvent, in either the presence or absence of excess anti- PD-L1 Fab or a non-specific Fab.
  • the samples were digested with protease and analysed by liquid chromatography-mass spectrometry (LC-MS) to determine the level of deuteration in each peptide.
  • the Fab corresponding to A09-246-2 was used instead of the full IgG in order to simplify the mass spectrometry analysis by decreasing the number of peptides generated by protease digestion.
  • HD exchange identified two peptides
  • the antigens were injected at concentrations of 100 nM, 50 nM, 25 nM, 12.5 nM and 6.25 nM (except for Y56 and D61 mutants, which were injected at 1 uM, 500 nM, 250 nM, 125 nM and 62.5 nM). Between each cycle, the chip was regenerated with low pH buffer and fresh A09-246-2 was captured prior to injecting the next concentration of antigen. The rate constants were determined by iterative fitting of the data to a 1 :1 binding model by an algorithm that minimizes Chi- squared.
  • K D The equilibrium dissociation constant
  • Mutants of Y56 and D61 displayed minimal destabilization of the antigen indicated by a small decrease in the T V2 of fluorescence monitored unfolding (table above). This confirms that Y56 and D61 are true binding hotspots for A09-246-2. The structural integrity of most of the other mutant proteins was also confirmed by this method (table above). The observation that most mutant proteins behaved similarly to wild type on analytical size exclusion chromatography (last column in the above table) provides further support for native structure of mutant antigen proteins. 3.6 Binding to Tumor Cells and Primary Cells
  • A09-246-2 demonstrated reactivity to human PD-L1 on all seven tested human tumor lines (A431 , epithelial carcinoma cell line; A549, lung adenocarcinoma epithelial cells; BxPC3, pancreatic cancer cells; HCT116, colorectal carcinoma; M24, melanoma cell lines; PC3mm2, prostate cancer cell line; U-87 MG, glioblastoma- astrocytoma) of which PD-L1 was up-regulated by interferon treatment to enable detection.
  • human tumor lines A431 , epithelial carcinoma cell line; A549, lung adenocarcinoma epithelial cells; BxPC3, pancreatic cancer cells; HCT116, colorectal carcinoma; M24, melanoma cell lines; PC3mm2, prostate cancer cell line; U-87 MG, glioblastoma- astrocytoma
  • A09-246-2 efficiently binds to human PD-L1 expressed on the HEK cell surface with an EC50 of 0.3 ⁇ 0.02nM (0.04 ⁇ 0.003 Mg/ml); to cynomolgus monkey expressed on the HEK cell surface with an EC50 of 0.94 ⁇ 0.015nM (0.14 ⁇ 0.002 ⁇ g/ml); to mouse PD-L1 expressed on the HEK293 cell surface with an EC50 of 0.34 ⁇ 0.08 nM (0.05 ⁇ 0.012 ⁇ g/ml) and mouse PD-L1 expressed on the EL4 cell surface with an EC50 of 0.91 ⁇ 0.21 nM (0.13 ⁇ 0.03 ⁇ g/ml).
  • the assays qualitatively described the dose dependent binding characteristics of anti-PD-L1.
  • Antigen-specific CD8 T cells were generated by stimulating splenocytes from OT-1 transgenic mice with Ova peptide SIINFEKL and cyropreserved. mPD-L1 over- expressing EL4 cells were used as antigen presenting cells. Serial dilutions of tested compounds were incubated with thawed OT-1 T cells and SIINFEKL-loaded APC for 48 hours. IFN- ⁇ in the supernatant was measured using mlFN ⁇ y ELISA. Anti-PD-L1 (A09-246-2) efficiently enhanced T cell activities represented by IFN- ⁇ production with an EC50 of 0.28 ⁇ 0.1 nM (0.04 ⁇ 0.015 ⁇ g/ml) b) SEA Assay
  • ADCC Antibody dependent cell-mediated Cytotoxicity
  • ADCC was measured utilizing two different human tumor lines A431 and A549 as target cells and human PBMC as effector cells. In some cases, tests were performed using target cells following stimulation with Interferon-gamma to increase the expression of PD-L1.
  • the anti-EGFR antibody, cetuximab was used as an ADCC positive control. Given the fact that the Fcyllla receptor 158V allotype displays a higher affinity for human lgG1 and increases ADCC, the observed results were correlated with the donor's allotype.
  • ADCC activity of A09-246-2 was comparable to that mediated with the anti-EGFR antibody cetuximab, inducing approximately 50% of maximum lysis in both cell lines.
  • INF- ⁇ treatment did not alter the response of A431 cells for all the different allotypes tested (VA , V/F and F/F).
  • a significant difference (almost twice) between stimulated and not stimulated cells was observed when A549 cells were employed for PBMC from V V and V/F donors. No ADCC was observed when PBMC from F/F donors were analyzed with A549 cells.
  • the selected antibody has demonstrated significant activity as a monotherapy and in various combination therapy settings.
  • the antitumor activity of the anti-PD-L1 antibody demonstrated a dose-dependent trend when given as a monotherapy against MC38 tumors.
  • the anti-PD-L1 antibody In combination with fractionated radiotherapy against MC38 tumors, the anti-PD-L1 antibody showed strong synergistic activity, with curative potential. Combination with a single low-dose of cyclophosphamide resulted in enhanced anti-tumor effects in the MC-38 model that were associated with an increased frequency of tumor-antigen specific CD8 + T cells. Anti-PD-L1 therapy significantly extended survival time when combined with Gemcitabine in the PANC02 orthotopic tumor model of pancreatic cancer. When anti-PD-L1 was combined with cyclophosphamide pre-treatment followed by vaccination with Stimuvax, a significant increase in tumor growth inhibition was achieved in both the MC38/MUC1 and PANC02/MUC1 tumor models.
  • mice were inoculated subcutaneously in the right flank with 1x10 6 MC38 colon carcinoma cells.
  • N 14
  • Groups were administered A09-246-2 intravenously at dose levels of 100, 200, 400, or 800 pg on days 0, 3, and 6.
  • a control group was treated with 200 pg of an inactive isotype antibody. Tumors were measured twice weekly for the study duration. All treatment groups demonstrated significant efficacy (P ⁇ 0.050) when compared to the isotype control group.
  • the 800 pg dose group did not show enhanced efficacy over the 400 pg group, a significant trend toward a dose-dependent effect was observed.
  • the primary endpoint of this study was survival based on the onset of clinical signs, indicative of metastatic dissemination, which warranted euthanasia.
  • At the end of the study (day 76), 20% of mice (1/5) were still alive in the isotype antibody treated group, and 80% (4/5) survivors remained in the A09-246-2 treated group.
  • GEM was dosed at 150 mg/kg in all studies and A09-246-2 was dosed at 400 pg per mouse.
  • a 28 day cycle of GEM was modeled (administration on days 5, 19, 26), with a 14 day holiday period during which A09-246-2 was given on days 8, 11, 14.
  • a 21 day cycle of GEM was modeled (administration on days 5, 12, 26, 33), with a 14 day holiday period during which A09-246-2 was given on days 13, 16, 19.
  • Monotherapy with GEM or anti-PD-L1 failed to extend survival time in this model.
  • the combination of GEM and A09-246-2 significantly extended mean survival time (P ⁇ 0.02).
  • Immunophenotyping revealed several effects in groups receiving A09-246-2, both as a monotherapy and in combination with GEM, that were consistent with the proposed MOA of anti-PD-L1 including increased percentages of CD8 + T EM in spleens, an increased ratio of splenic CD8 + T E M to T REG cells, and increased percentages of splenic PD-1 + CD8 + T cells. Furthermore, immunophenotyping of tumor infiltrating lymphocytes (TIL) showed significantly increased percentages of CD8 + TIL in the combination group.
  • TIL tumor infiltrating lymphocytes
  • Low-dose CPA is known to enhance anti-tumor immune responses through the inhibition of immunosuppressive regulatory T cells.
  • the potential for low-dose CPA pre-treatment was investigated to enhance the efficacy of the anti-PD-L1 Ab (A09- 246-2) in the MC38 subcutaneous tumor model. Mice were inoculated
  • a control treatment group received 100 pg of an inactive isotype antibody in combination with CPA pretreatment.
  • the combination treatment group demonstrated a statistically significant enhancement (p ⁇ 0.050) of anti-tumor activity when compared against the isotype and monotherapy control groups.
  • ELISPOT assay the effects of treatment on the magnitude of CD8 + T cell responses directed against the well-characterized p15E tumor antigen were measured.
  • Both CPA and A09-246-2 showed substantially increased levels of p15E- reactive CD8 + T cells ( ⁇ 100 spots in both groups) when compared to the isotype control (-25 spots), with the combination group showing a further enhancement (-250 spots).
  • the anti-tumor efficacy of the CPA plus A09-246-2 combination was associated with increased frequencies of tumor-antigen reactive CTL.
  • Stimuvax is a vaccine against the human MUC1 antigen, which is commonly overexpressed by solid tumors.
  • Mice transgenic for the human MUC1 protein (MUCl .tg mice) are immunologically tolerant of the antigen, and, when inoculated with murine tumors that also express human MUC1, provide a relevant model of the clinical vaccination setting.
  • cyclophosphamide (CPA) pre-treatment is used in combination with Stimuvax as a strategy for transiently depleting immunosuppressive T reg cells that can inhibit the vaccine response.
  • mice were inoculated subcutaneously in the right rear flank with 1x10 6 MC38/ UC1 colon carcinoma cells.
  • Five days after tumor cell inoculation, mice were randomized into treatment groups (N 10) on day -3.
  • Vaccination was initiated on day 0 and was repeated weekly.
  • Anti-PD-L1 Ab (A09-246-2) was dosed by i.p. injection on days 0, 3, and 6. Tumors were measured twice weekly.
  • the combination of CPA/Stimuvax and A09-246-2 demonstrated significantly enhanced (p ⁇ 0.050) tumor growth inhibition when compared against treatment with CPA/Stimuvax.
  • Radiotherapy has been demonstrated to enhance the immunogenicity of tumor cells, through increased expression of MHC class I and diversification of the intracellular peptide pool.
  • MC38 colon carcinoma cells (1x10 5 ) were inoculated intramuscularly into the right quadriceps of C57BL/6 female mice.
  • the tumor-bearing legs were isolated and treated with 360 cGy of gamma irradiation from a cesium-137 source on days 0, 1, 2, 3, and 4 (total dose of 1800 cGy).
  • Anti-PD-L1 Ab (A09-246-2) was dosed i.v. at 400 pg on days 3, 6, and 9.
  • the A09-246-2 and radiotherapy combination resulted in a high rate of tumor regressions, ultimately leading to 6/10 complete responses (CR).
  • Mice with CR were re-challenged by inoculation of MC38 tumor cells, and 3/6 mice remained tumor-free seventy-four days after the re-challenge, indicating that effective immune memory was generated by the combination therapy.
  • a control group treated with an isotype control antibody in combination with radiation showed significant tumor growth inhibition, but did not induce regressions.
  • CD8 + T cells completely abrogated the synergy of the combination, confirming that the mechanism involves the stimulation of anti-tumor CD8 + T cell responses. This observation was further supported by increased frequencies of CD8 + T cells reactive to the p15E tumor antigen. Immunophenotyping by FACS revealed increased percentages of CD8 + T cell proliferation in spleens, and increased splenic percentages of CD8 + T E M and CD8+ T CM -
  • FOLFOX is a combination chemotherapy regimen, consisting of folinic acid, 5- fluorouracil (5-FU), and oxaliplatin (OX), used in the treatment of stage III colorectal cancer.
  • 5- fluorouracil 5-FU
  • OX oxaliplatin
  • FOLFOX 5-fluorouracil and oxaliplatin
  • mice were inoculated in the right subcutaneous flank with 1x10 6 MC38 colon carcinoma cells.
  • 5-FU 60 mg/kg i.v.
  • OX 5 mg/kg i.p.
  • 5-FU 60 mg/kg i.v.
  • OX 5 mg/kg i.p.
  • Anti-PD-L1 Ab (A09-246-2) (400 pg i.v.) was given on days 3, 6, and 9.
  • the combination treatment was observed to have significantly greater efficacy (p ⁇ 0.050) when compared to A09-246-2 given alone, or 5-FU and OX given in combination with an isotype antibody.
  • a repeat of the anti-PD-L1 Ab and FOLFOX combination study was performed and, again, the combination demonstrated significantly greater (p ⁇ 0.050) anti-tumor activity than either of the monotherapy regimens.
  • FACS-based immunophenotyping conducted in these studies revealed increases in several immunological markers consistent with a CD8 + T cell driven MOA, including increased splenic levels of p15E tumor antigen specific CD8 + T cells, an increase in the splenic ratio of TEM to regulatory T cells (T re g), and increased splenic percentages of CD8 + PD-1 + T cells. Furthermore, the percentage of tumor infiltrating natural killer (NK) cells and CD8 + T cells was observed to increase significantly in the combination group.
  • NK tumor infiltrating natural killer
  • the TK evaluation indicates that all animals were exposed to the test material throughout the study.
  • the exposure levels increased roughly proportionally to dose increasing at both 1 st and 4 th dose, without any relevant accumulation or gender- dependency at any dose.
  • Anti drug antibody were detected in 2/4 and 1/4 monkeys at 20 and 140 mg/kg levels respectively. There was no premature animal death in the study. No treatment related changes were noted in the 20 and 60 mg/kg dosing groups for all parameters evaluated in the study.
  • treatment related findings include slight decrease of lymphocytes in haematology testing, slight decrease in lymphocyte count together with a decrease in NK cell count on study day 30. There were no significant histological changes in major organs/tissues except moderate perivascular hemorrhage and inflammation/vessel necrosis observed at local injection site at the 140 mg/kg. There was no clear trend or change observed in multicytokine analysis at this dose level. Based on the results from this study the No Observable Adverse Effect Level (NOAEL) was identified as 140 mg/kg.
  • NOAEL No Observable Adverse Effect Level

Abstract

The present application relates to anti-PD-L1 antibodies or antigen binding fragments thereof, nucleic acid encoding the same, therapeutic compositions thereof, and their use to enhance T-cell function to upregulate cell-mediated immune responses and for the treatment of T cell dysfunctional disorders, such as tumor immunity, for the treatment of and cancer.

Description

Anti-PD-L1 Antibodies And Uses Thereof Field of the invention The present application relates to anti-PD-L1 antibodies or antigen binding fragments thereof, nucleic acid encoding the same, therapeutic compositions thereof, and their use to enhance T-cell function to upregulate cell-mediated immune responses and for the treatment of T cell dysfunctional disorders, such as tumor immunity, for the treatment of and cancer.
Background of the Invention
Lymphocyte development and activation The two major types of lymphocytes in humans are T (thymus-derived) and B (bone marrow derived. These cells are derived from hematopoietic stem cells in the bone marrow and fetal liver that have committed to the lymphoid development pathway. The progeny of these stem cells follow divergent pathways to mature into either B or T lymphocytes. Human B-lymphocyte development takes place entirely within the bone marrow. T cells, on the other hand, develop from immature precursors that leave the marrow and travel through the bloodstream to the thymus, where they proliferate and differentiate into mature T lymphocytes.
Mature lymphocytes that emerge from the thymus or bone marrow are in a
quiescent, or "resting" state, i.e., they are mitotically inactive. When dispersed into the bloodstream, these "naive" or "virgin" lymphocytes, travel into various secondary or peripheral lymphoid organs, such as the spleen, lymph nodes or tonsils. Most virgin lymphocytes have an inherently short life span and die without a few days after leaving the marrow or thymus. However, if such a cell receives signals that indicate the presence of an antigen, they may activate and undergo successive rounds of cell division. Some of the resulting progeny cells then revert to the resting state to become memory lymphocytes - B and T cells that are essentially primed for the next encounter with the stimulating allergen. The other progeny of activated virgin lymphocytes are effector cells, which survive for only a few days, but carry out specific defensive activities. Lymphocyte activation refers to an ordered series of events through which a resting lymphocyte passes as it is stimulated to divide and produce progeny, some of which become effector cells. A full response includes both the induction of cell proliferation (mitogenesis) and the expression of immunologic functions. Lymphocytes become activated when specific ligands bind to receptors on their surfaces. The ligands are different for T cells and B cells, but the resulting intracellular physiological
mechanisms are similar.
Some foreign antigens themselves can induce lymphocyte activation, especially large polymeric antigens that cross-link surface immunoglobulins on B-cells, or other glycoproteins on T-cells. However, most antigens are not polymeric and even direct binding to B-cells in large numbers fail to result in activation. These more common antigens activate B cells when they are co-stimulated with nearby activated helper T- lymphocytes. Such stimulation may occur from lymphokines secreted by the T-cell, but is transmitted most efficiently by direct contact of the B cell with T-cell surface proteins that interact with certain B-cell surface receptors to generate a secondary signal.
T-cells T lymphocytes do not express immunoglobulins, but, instead detect the presence of foreign substances by way of surface proteins called T-cell receptors (TCR). These receptors recognize antigens by either direct contact or through influencing the activity of other immune cells. Together with macrophages, T cells are the primary cell type involved in the cell-mediated immunity.
Unlike B-cells, T-cells can detect foreign substances only in specific contexts. In particular, T-lymphocytes will recognize a foreign protein only if it first cleaved into small peptides, which are then displayed on the surface of a second host cell, called an antigen- presenting cell (APC). Many types of host cells can present antigens under some conditions but certain types are more specifically adapted for this purpose and are particularly important in controlling T-cell activity, including macrophages and other B-cells. Antigen presentation depends in part on specific proteins, called major histocompatibility complex (MHC) proteins, on the surface of the presenting cells. Thus, to stimulate cell-mediated immunity, foreign peptides must be presented to T-cells in combination with MHC peptides, and this combination must be recognized by a T-cell receptor.
There are two significant T-cell subsets: cytotoxic T lymphocytes (Tc cells or CTLs) and helper T cells (TH) cells, which can roughly be identified on the basis of cell surface expression of the marker CD8 and CD4. Tc cells are important in viral defense, and can kill viruses directly by recognizing certain cell surface expressed viral peptides. TH cells promote proliferation, maturation and immunologic function of other cell types, e.g. , lymphokine secretion to control activities of B cells,
macrophages and cytotoxic T cells. Both virgin and memory T-lymphocytes ordinarily remain in the resting state, and in this state they do not exhibit significant helper or cytotoxic activity. When activated, these cells undergo several rounds of mitotic division to produce daughter cells. Some of these daughter cells return to the resting state as memory cells, but others become effector cells that actively express helper or cytotoxic activity. These daughter cells resemble their parents: CD4+ cells can only product CD4+ progeny, while CD8+ cells yield only CD8+ progeny. Effector T- cells express cell surface markers that are not expressed on resting T-cells, such as CD25, CD28, CD29, CD40L, transferrin receptors and class II MHC proteins. When the activating stimuli is withdrawn, cytotoxic or helper activity gradually subsides over a period of several days as the effector cells either die or revert to the resting state. Similar to B-cell activation, T-lymphocyte responses to most antigens also require two types of simultaneous stimuli. The first is the antigen, which if appropriately displayed by MHC proteins on an antigen-presenting cell, can be recognized and bound by T-cell receptors. While this antigen-MHC complex does send a signal to the cell interior, it is usually insufficient to result in T-cell activation. Full activation, such as occurs with helper T-cells, requires costimulation with other specific ligands called costimulators that are expressed on the surface of the antigen-presenting cell. Activation of a cytotoxic T cell, on the other hand, generally requires IL -2, a cytokine secreted by activated helper T cells. PD-1 pathway
An important negative co-stimulatory signal regulating T cell activation is provided by programmed death-1 receptor (PD-1 )(CD279), and its ligand binding partners PD-L1 (B7-H1, CD274) and PD-L2 (B7-DC, CD273). The negative regulatory role of PD-1 was revealed by PD-1 knock outs (Pdcdl '''), which are prone to autoimmunity.
Nishimura et al, Immunity JJ. : 141-51 (1999); Nishimura et al, Science 291: 319-22 (2001). PD-1 is related to CD28 and CTLA-4, but lacks the membrane proximal cysteine that allows homodimerization. The cytoplasmic domain of PD-1 contains an immunoreceptor tyorine-based inhibition motif (ITIM, V/lxYxxL/V). PD-1 only binds to PD-L1 and PD-L2. Freeman et al, J. Exp. Med. 192: 1-9 (2000); Dong et al, Nature Med. 5: 1365-1369 (1999); Latchman et al, Nature Immunol 2: 261-268 (2001);
Tseng et al, J. Exp. Med. 193: 839-846 (2001).
PD-1 can be expressed on T cells, B cells, natural killer T cells, activated monocytes and dendritic cells (DCs). PD-1 is expressed by activated, but not by unstimulated human CD4+ and CD8+ T cells, B cells and myeloid cells. This stands in contrast to the more restricted expression of CD28 and CTLA-4. Nishimura et al, Int. Immunol. 8: 773-80 (1996); Boettler et al, J. Virol. 80: 3532-40 (2006). There are at least 4 variants of PD-1 that have been cloned from activated human T cells, including transcripts lacking (i) exon 2, (ii) exon 3, (iii) exons 2 and 3 or (iv) exons 2 through 4. Nielsen et al, Cell. Immunol. 235: 109-16 (2005). With the exception of PD-IAex3, all variants are expressed at similar levels as full length PD-1 in resting peripheral blood mononuclear cells (PBMCs). Expression of all variants is significantly induced upon activation of human T cells with anti-CD3 and anti-CD28. The PD-1Aex3 variants lacks a transmembrane domain, and resembles soluble CTLA-4, which plays an important role in autoimmunity. Ueda et al, Nature 423: 506-11 (2003). This variant is enriched in the synovial fluid and sera of patients with rheumatoid arthritis. Wan et al, J. Immunol. 177: 8844-50 (2006). The two PD-1 ligands differ in their expression patterns. PD-L1 is constitutively expressed on mouse T and B cells, CDs,
macrophages, mesenchymal stem cells and bone marrow-derived mast cells.
Yamazaki et al, J. Immunol. 169: 5538-45 (2002). PD-L1 is expressed on a wide range of nonhematopoietic cells (e.g., cornea, lung, vascular epithelium, liver nonpar enchymal cells, mesenchymal stem cells, pancreatic islets, placental
synctiotrophoblasts, keratinocytes, etc.) [Keir et al, Annu. Rev. Immunol. 26: 677-704 (2008)], and is upregulated on a number of cell types after activation. Both type I and type II interferons IFN's) upregulate PD-L1. Eppihimer et al, Microcirculation 9: 133- 45 (2002); Schreiner et al, J. Neuroimmunol 155: 172-82 (2004). PD-L1 expression in cell lines is decreased when MyD88, TRAF6 and MEK are inhibited. Liu et al, Blood HO: 296-304 (2007). JAK2 has also been implicated in PD-L1 induction. Lee et al, FEBS Lett. 580: 755-62 (2006); Liu et al, Blood HO: 296-304 (2007). Loss or inhibition of phosphatase and tensin homolog (PTEN), a cellular phosphatase that modified phosphatidylinosital 3-kinase (PI3K) and Akt signaling, increased post- transcriptional PD-L1 expression in cancers. Parsa et al, Nat. Med. 13: 84-88 (2007). PD-L2 expression is more restricted than PD-L1. PD-L2 is inducibly expressed on DCs, macrophages, and bone marrow-derived mast cells. PD-L2 is also expressed on about half to two-thirds of resting peritoneal Bl cells, but not on conventional B2 B cells. Zhong et al, Eur. J. Immunol. 37: 2405-10 (2007). PD-L2+ Bl cells bind phosphatidylcholine and may be important for innate immune responses against bacterial antigens. Induction of PD-L2 by IFN-γ is partially dependent upon NF -KB. Liang et al, Eur. J. Immunol. 33_: 2706-16 (2003). PD-L2 can also be induced on monocytes and macrophages by GM-CF, IL-4 and and IFN-γ. Yamazaki et al., J. Immunol. 169: 5538-45 (2002); Loke et al, PNAS 100:5336^1 (2003).
PD-1 signaling typically has a greater effect on cytokine production than on cellular proliferation, with significant effects on IFN-γ, TNF-a and IL-2 production. PD-1 mediated inhibitory signaling also depends on the strength of the TCR signaling, with greater inhibition delivered at low levels of TCR stimulation. This reduction can be overcome by costimulation through CD28 [Freeman et al, J. Exp. Med. 192: 1027-34 (2000)] or the presence of IL-2 [Carter et al, Eur. J. Immunol. 32: 634-43 (2002)]- Evidence is mounting that signaling through PD-L1 and PD-L2 may be bidirectional. That is, in addition to modifying TCR or BCR signaling, signaling may also be delivered back to the cells expressing PD-L1 and PD-L2. While treatment of dendritric cells with a naturally human anti-PD-L2 antibody isolated from a patient with Waldenstrom's macroglobulinemia was not found to upregulate MHC II or B7 costimulatory molecules, such cells did produce greater amount of proinflammatory cytokines, particularly TNF-a and IL-6, and stimulated T cell proliferation. Nguyen et al, J. Exp. Med. 196: 1393-98 (2002). Treatment of mice with this antibody also (1) enhanced resistance to transplated bl6 melanoma and rapidly induced tumor- specific CTL. Radhakrishnan et al, J. Immunol. 170: 1830-38 (2003); Radhakrishnan et al, Cancer Res. 64: 4965-72 (2004); Heckman et al, Eur. J. Immunol. 37: 1827-35 (2007); (2) blocked development of airway inflammatory disease in a mouse model of allergic asthma. Radhakrishnan et al, J. Immunol. 173: 1360-65 (2004);
Radhakrishnan et al, J. Allergy Clin. Immunol. UJy. 668-74 (2005). Further evidence of reverse signaling into dendritic cells ("DCs") results from studies of bone marrow derived DCs cultured with soluble PD-1 (PD-1 EC domain fused to Ig constant region - "s-PD-1"). Kuipers et al, Eur. J. Immunol. 36: 2472-82 (2006). This sPD-1 inhibited DC activation and increased IL-10 production, in a manner reversible through administration of anti-PD-1. Additionally, several studies show a receptor for PD-L1 or PD-L2 that is independent of PD-1. B7.1 has already been identified as a binding partner for PD-L1. Butte et al, Immunity 27: 111-22 (2007). Chemical crosslinking studies suggest that PD-L1 and B7.1 can interact through their IgV-like domains. B7.1 :PD-L1 interactions can induce an inhibitory signal into T cells.
Ligation of PD-L1 on CD4+ T cells by B7.1 or ligation of B7.1 on CD4+ T cells by PD- L1 delivers an inhibitory signal. T cells lacking CD28 and CTLA-4 show decreased proliferation and cytokine production when stimulated by anti-CD3 plus B7.1 coated beads. In T cells lacking all the receptors for B7.1 (i.e., CD28, CTLA-4 and PD-L1), T-cell proliferation and cytokine production were no longer inhibited by anti-CD3 plus B7.1 coated beads. This indicates that B7.1 acts specifically through PD-L1 on the T- cell in the absence of CD28 and CTLA-4. Similarly, T cells lacking PD-1 showed decreased proliferation and cytokine production when stimulated in the presence of anti-CD3 plus PD-L1 coated beads, demonstrating the inhibitory effect of PD-L1 ligation on B7.1 on T cells. When T cells lacking all known receptors for PD-L1 (i.e., no PD-1 and B7.1), T cell proliferation was no longer impaired by anti-CD3 plus PD- L1 coated beads. Thus, PD-L1 can exert an inhibitory effect on T cells either through B7.1 or PD-1.
The direct interaction between B7.1 and PD-L1 suggests that the current
understanding of costimulation is incomplete, and underscores the significance to the expression of these molecules on T cells. Studies of PD-L1 ~*~ T cells indicate that PD-L1 on T cells can downregulate T cell cytokine production. Latchman et al, Proc. Natl. Acad. Sci. USA 101: 10691-96 (2004). Because both PD-L1 and B7.1 are expressed on T cells, B cells, DCs and macrophages, there is the potential for directional interactions between B7.1 and PD-L1 on these cells types. Additionally, PD-L1 on non-hematopoietic cells may interact with B7.1 as well as PD-1 on T cells, raising the question of whether PD-L1 is involved in their regulation. One possible explanation for the inhibitory effect of B7.1 : PD-L1 interaction is that T cell PD-L1 may trap or segregate away APC B7.1 from interaction with CD28. As a result, the antagonism of signaling through PD-L1 , including blocking PD-L1 from interacting with either PD-1 , B7.1 or both, thereby preventing PD-L1 from sending a negative co- stimulatory signal to T-cells and other antigen presenting cells is likely to enhance immunity in response to infection (e.g., acute and chronic) and tumor immunity. In addition, the anti-PD-L1 antibodies of the present invention, may be combined with antagonists of other components of PD-1 : PD-L1 signaling, for example, antagonist anti-PD-1 and anti-PD-L2 antibodies.
In particular, the inhibition of PD-L1 signaling has been proposed as a means to enhance T cell immunity for the treatment of cancer (e.g., tumor immunity) and infection, including both acute and chronic (e.g., persistent) infection.
Inhibitors blocking the PD-L1 : PD-1 interaction are known from, i.a.,
WO2001014557, WO2002086083, WO2007005874, WO2010036959,
WO2010077634 and WO2011066389. However, as an optimal therapeutic directed to a target in this pathway has yet to be commercialized, a significant unmet medical need exists.
Description of the invention
It is an objective of the present invention to provide for anti-PD-L1 antibodies, including nucleic acids encoding and compositions containing such antibodies, and for their use to enhance T-cell function to upregulate cell-mediated immune responses and for the treatment of T cell dysfunctional disorders, such as tumor immunity. Surprisingly, it was found that the anti-PD-L1 antibodies according to the present invention, which have antibody dependent cell-mediated cytotoxicity (ADCC) activity, directly act on PD-L1 bearing tumor cells by inducing their lysis without showing any significant toxicity. Moreover, the antibodies do not only block the interaction between human PD-L1 and human PD-1 , but also the interactions between the respective mouse and cynomolgus monkey proteins.
In one embodiment, the invention provides for an isolated heavy chain variable region polypeptide comprising an HVR-H1 , HVR-H2 and HVR-H3 sequence, wherein:
(a) the HVR-H1 sequence is X YX2MX3 (SEQ ID NO:1);
(b) the HVR-H2 sequence is SIYPSGGX4TFYADX5VKG (SEQ ID NO:2);
(c) the HVR-H3 sequence is IKLGTVTTVX6Y (SEQ ID NO:3); further wherein: X^ is K, R, T, Q, G, A, W, M, I or S; X2 is V, R, K, L, or I; X3 is H( T, N, Q, A, V, Y, W, F or M; X4 is F or I; X5 is S or T; X6 is E or D.
In a preferred embodiment Xi is M, I or S; X2 is R, K, L, M or I; X3 is F or M; X4 is F or l; X5 is S or T; X6 is E or D.
In a more preferred embodiment is Xi is M, I or S; X2 is L, M or I; X3 is F or M; X4 is I; X5 is S or T; Xe is D.
In a even more preferred embodiment, Xi is S; X2 is I; X3 is M; X4 is I; X5 is T; Xe is D.
In another aspect, the polypeptide further comprises variable region heavy chain framework sequences juxtaposed between the HVRs according to the formula: (HC- FR1)-(HVR-H1)-(HC-FR2)-(HVR-H2)-(HC-FR3)-(HVR-H3)- (HC-FR4).
In yet another aspect, the framework sequences are derived from human consensus framework sequences or human germline framework sequences.
In a still further aspect, at least one of the framework sequences is the following: HC-FR1 is EVQLLESGGGLVQPGGSLRLSCAASGFTFS (SEQ ID NO:4);
HC-FR2 is WVRQAPGKG LEWVS (SEQ ID NO:5);
HC-FR3 is RFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR (SEQ ID NO:6);
HC-FR4 is WGQGTLVTVSS (SEQ ID NO:7).
In a still further aspect, the heavy chain polypeptide is further combined with a variable region light chain comprising an an HVR-L1 , HVR-L2 and HVR-L3, wherein: (a) the HVR-L1 sequence is
Figure imgf000009_0001
(SEQ ID NO.8);
(b) the HVR-L2 sequence is XioVXnX12RPS (SEQ ID NO:9);
(c) the HVR-L3 sequence is
Figure imgf000009_0002
(SEQ ID NO:10);
further wherein: X7 is N or S; Xe is T, R or S; X9 is A or G; X10 is E or D; Xn is I, N or
S; Xi2 is D, H or N; X13 is F or Y; X14 is N or S; X15 is R, T or S; X16 is G or S; X17 is I or T.
In a preferred embodiment, X7 is N or S; X8 is T, R or S; X9 is A or G; X10 is E or D; Xn is N or S; Xi2 is N; Xi3 is F or Y; X14 is S; X15 is S; Xi6 is G or S; Xi7 is T.
In a even more preferred embodiment, X7 is S; Xe is S; X9 is G; X10 is D; Xn is S; Xi2 is N; Xi3 is Y; Xu is S; X15 is S; X16 is S; X17 is T. In a still further aspect, the light chain further comprises variable region light chain framework sequences juxtaposed between the HVRs according to the formula: (LC- FR1 MHVR-L1 )-(LC-FR2)-(HVR-L2)-(LC-FR3)-(HVR-L3)-(LC-FR4). In a still further aspect, the light chain framework sequences are derived from human consensus framework sequences or human germline framework sequences.
In a still further aspect, the light chain framework sequences are lambda light chain sequences. In a still further aspect, at least one of the framework sequence is the following:
LC-FR1 is QSALTQPASVSGSPGQSITISC (SEQ ID NO:11);
LC-FR2 is WYQQHPGKAPKLMIY (SEQ ID NO:12);
LC-FR3 is GVSNRFSGSKSGNTASLTISGLQAEDEADYYC (SEQ ID NO:13);
LC-FR4 is FGTGTKVTVL (SEQ ID NO: 14).
In another embodiment, the invention provides an isolated anti-PD-L1 antibody or antigen binding fragment comprising a heavy chain and a light chain variable region sequence, wherein:
(a) the heavy chain comprises an HVR-H1 , HVR-H2 and HVR-H3, wherein further: (i) the HVR-H1 sequence is X1YX2MX3 (SEQ ID NO:1); (ii) the HVR-H2 sequence is
S I YPSGGX4TFYADX5VKG (SEQ ID NO:2); (iii) the HVR-H3 sequence is
IKLGTVTTVXeY, and (SEQ ID NO:3);
(b) the light chain comprises an HVR-L1 , HVR-L2 and HVR-L3, wherein further: (iv) the HVR-L1 sequence is
Figure imgf000010_0001
(SEQ ID NO:8); (v) the HVR-L2 sequence is X10VX11X12RPS (SEQ ID NO:9); (vi) the HVR-L3 sequence is
SSX13TX14X15X16X17RV (SEQ ID NO:10); wherein: Xi is K, R, T, Q, G, A, W, M, I or S; X2 is V, R, K, L, M or I; X3 is H, T, N, Q, A, V, Y, W, F or M; X4 is F or I; X5 is S or T; Xe is E or D; X7 is N or S; X8 is T, R or S; X9 is A or G; X 0 is E or D; Xn is I, N or S; X12 is D, H or N; X13 is F or Y; X14 is N or S; X15 is R, T or S; X 6 is G or S; Xi7 is I or T.
In a preferred embodiment, Xi is M, I or S; X2 is R, K, L, M or I; X3 is F or M; X4 is F or I; X5 is S or T; Xe is E or D; X7 is N or S; X8 is T, R or S; X9 is A or G; Xi0 is E or D; Xn is N or S; X12 is N; X13 is F or Y; X14 is S; X15 is S; X 6 is G or S; X17 is T. In a more preferred embodiment, Xi is M, I or S; X2 is L, M or I; X3 is F or M; X4 is I; X5 is S or T; X6 is D; X7 is N or S; X8 is T, R or S; X9 is A or G; X10 is E or D; Xn is N or S; X12 is N; X 3 is F or Y; X14 is S; X15 is S; Xi6 is G or S; X17 is T.
In a even more preferred embodiment, Xi is S; X2 is I; X3 is M; X4 is I; X5 is T; Xe is D; X7 is S; X8 is S; X9 is G; X-io is D; Xn is S; X12 is N; X13 is Y; X14 is S; X15 is S; X16 is S; X17 is T.
In a further aspect, the heavy chain variable region comprises one or more
framework sequences juxtaposed between the HVRs as: (HC-FR1)-(HVR-H1)-(HC- FR2)-(HVR-H2)-(HC-FR3)-(HVR- H3)-(HC-FR4), and the light chain variable regions comprises one or more framework sequences juxtaposed between the HVRs as: (LC-FR1 MHVR-L1 )-(LC-FR2)-(HVR-l_2)-(LC-FR3)-(HVR- L3)-(LC-FR4).
In a still further aspect, the framework sequences are derived from human
consensus framework sequences or human germline sequences.
In a still further aspect, one or more of the heavy chain framework sequences is the following:
HC-FR1 is EVQLLESGGGLVQPGGSLRLSCAASGFTFS (SEQ ID NO:4);
HC-FR2 is WVRQAPGKGLEWVS (SEQ ID NO:5);
HC-FR3 is RFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR (SEQ ID NO:6);
HC-FR4 is WGQGTLVTVSS (SEQ ID NO:7).
In a still further aspect, the light chain framework sequences are lambda light chain sequences.
In a still further aspect, one or more of the light chain framework sequences is the following:
LC-FR1 is QSALTQPASVSGSPGQSITISC (SEQ ID NO:11);
LC-FR2 is WYQQHPGKAPKLMIY (SEQ ID NO:12);
LC-FR3 is GVSNRFSGSKSGNTASLTISGLQAEDEADYYC; (SEQ ID NO: 13);
LC-FR4 is FGTGTKVTVL (SEQ ID NO: 14).
In a still further aspect, the heavy chain variable region polypeptide, antibody or antibody fragment further comprises at least a CH1 domain. In a more specific aspect, the heavy chain variable region polypeptide, antibody or antibody fragment further comprises a CH1, a CH2 and a CH3 domain.
In a still further aspect, the variable region light chain, antibody or antibody fragment further comprises a CL domain.
In a still further aspect, the antibody further comprises a CH1, a CH2, a CH3 and a CL domain. In a still further specific aspect, the antibody further comprises a human or murine constant region.
In a still further aspect, the human constant region is selected from the group consisting of lgG1, lgG2, lgG2, lgG3, lgG4.
In a still further specific aspect, the human or murine constant region is lgG1.
In yet another embodiment, the invention provides for an anti-PD-L1 antibody comprising a heavy chain and a light chain variable region sequence, wherein:
(a) the heavy chain comprises an HVR-H1, HVR-H2 and an HVR-H3, having at least 80% overall sequence identity to SYIMM (SEQ ID NO:15), SIYPSGGITFYADTVKG
(SEQ ID NO:16) and IKLGTVTTVDY (SEQ ID NO:17), respectively, and
(b) the light chain comprises an HVR-L1 , HVR-L2 and an HVR-L3, having at least 80% overall sequence identity to TGTSSDVGGYNYVS (SEQ ID NO:18), DVSNRPS (SEQ ID NO:19) and SSYTSSSTRV (SEQ ID NO:20), respectively.
In a specific aspect, the sequence identity is 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.
In yet another embodiment, the invention provides for an anti-PD-L1 antibody comprising a heavy chain and a light chain variable region sequence, wherein:
(a) the heavy chain comprises an HVR-H1 , HVR-H2 and an HVR-H3, having at least 80% overall sequence identity to MYMMM (SEQ ID NO:21), SIYPSGGITFYADSVKG (SEQ ID NO:22) and IKLGTVTTVDY (SEQ ID NO: 17), respectively, and
(b) the light chain comprises an HVR-L1, HVR-L2 and an HVR-L3, having at least 80% overall sequence identity to TGTSSDVGAYNYVS (SEQ ID NO:23), DVSNRPS (SEQ ID NO: 19) and SSYTSSSTRV (SEQ ID NO.20), respectively.
In a specific aspect, the sequence identity is 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.
In a still further aspect, in the antibody or antibody fragment according to the invention, as compared to the sequences of HVR-H1 (SEQ ID NO:15), HVR-H2 (SEQ ID NO:16) and HVR-H3 (SEQ ID NO:17), at least those amino acids remain unchanged that are highlighted by underlining as follows:
(a) in HVR-H1 SYIMM (SEQ ID NO: 15),
(b) in HVR-H2 SIYPSGGITFYADTVKG (SEQ ID NO: 16),
(c) in HVR-H3 IKLGTVTTVDY (SEQ ID NO: 17);
and further wherein, as compared to the sequences of HVR-L1 (SEQ ID NO: 18), HVR-L2 (SEQ ID NO: 19) and HVR-L3 (SEQ ID NO:20) at least those amino acids remain unchanged that are highlighted by underlining as follows:
(a) HVR-L1 TGTSSDVGGYNYVS (SEQ ID NO: 18)
(b) HVR-L2 DVSNRPS (SEQ ID NO:19)
(c) HVR-L3 SSYTSSSTRV (SEQ ID NO:20).
In another aspect, the heavy chain variable region comprises one or more framework sequences juxtaposed between the HVRs as: (HC-FR1)- (HVR-H1)-(HC-FR2)-(HVR- H2)-(HC-FR3)-(HVR-H3)-(HC-FR4), and the light chain variable regions comprises one or more framework sequences juxtaposed between the HVRs as: (LC- FR1)- (HVR-L1 )-(LC-FR2)-(HVR-l_2)-(LC-FR3)-(HVR-L3)-(LC-FR4).
In yet another aspect, the framework sequences are derived from human germline sequences. In a still further aspect, one or more of the heavy chain framework sequences is the following:
HC-FR1 is EVQLLESGGGLVQPGGSLRLSCAASGFTFS (SEQ ID NO:4);
HC-FR2 is WVRQAPGKG LEWVS (SEQ ID NO:5);
HC-FR3 is RFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR (SEQ ID NO:6); HC-FR4 is WGQGTLVTVSS (SEQ ID NO:7).
In a still further aspect, the light chain framework sequences are derived from a lambda light chain sequence.
In a still further aspect, one or more of the light chain framework sequences is the following:
LC-FR1 is QSALTQPASVSGSPGQSITISC (SEQ ID NO:11);
LC-FR2 is WYQQHPGKAPKLMIY (SEQ ID NO: 12);
LC-FR3 is GVSNRFSGSKSGNTASLTISGLQAEDEADYYC (SEQ ID NO:13);
LC-FR4 is FGTGTKVTVL (SEQ ID NO:14).
In a still further specific aspect, the antibody further comprises a human or murine constant region.
In a still further aspect, the human constant region is selected from the group consisting of lgG1, lgG2, lgG2, lgG3, lgG4.
In a still further embodiment, the invention provides for an isolated anti-PD-L1 antibody comprising a heavy chain and a light chain variable region sequence, wherein:
(a) the heavy chain sequence has at least 85% sequence identity to the heavy chain sequence:
EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYIMMVWRQAPGKGLEWVSSIYPSG GITFYAD KGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARIKLGTVrrVDYWGQ GTLVTVSS (SEQ ID NO:24), and
(b) the light chain sequence has at least 85% sequence identity to the light chain sequence:
QSALTQPASVSGSPGQSITISCTGTSSDVGGYNYVSWYQQHPGKAPKLMIYDVSN RPSGVSNRFSGSKSGNTASLTISGLQAEDEADYYCSSYTSSSTRVFGTGTKVTVL
(SEQ ID NO:25).
In a specific aspect, the sequence identity is 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%. In a still further embodiment, the invention provides for an isolated anti-PD-L1 antibody comprising a heavy chain and a light chain variable region sequence, wherein:
(a) the heavy chain sequence has at least 85% sequence identity to the heavy chain sequence:
EVQLLESGGGLVQPGGSLRLSCAASGFTFSMYMMMWVRQAPGKGLEVWSSIYPS GGITFYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAIYYCARIKLGTVTTVDYWG QGTLVTVSS (SEQ ID NO:26), and
(b) the light chain sequence has at least 85% sequence identity to the light chain sequence:
QSALTQPASVSGSPGQSITISCTGTSSDVGAYNYVSWYQQHPGKAPKLMIYDVSNR PSGVSNRFSGSKSGNTASLTISGLQAEDEADYYCSSYTSSSTRVFGTGTKVTVL
(SEQ ID NO:27). In a specific aspect, the sequence identity is 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.
In another embodiment the antibody binds to human, mouse or cynomolgus monkey PD-L1. In a specific aspect the antibody is capable of blocking the interaction between human, mouse or cynomolgus monkey PD-L1 and the respective human, mouse or cynomolgus monkey PD-1 receptors.
In another embodiment, the antibody binds to human PD-L1 with a KD of 5x10"9 M or less, preferably with a KD of 2x10"9 M or less, and even more preferred with a KD of 1x10"9 M or less.
In yet another embodiment the invention concerns an isolated anti-PD-L1 antibody or antigen binding fragment thereof which binds to a functional epitope comprising residues Y56 and D61 of human PD-L1 (SEQ ID NO:28).
In a specific aspect, the functional epitope further comprises E58, E60, Q66, R113 and M115 of human PD-L1 (SEQ ID NO:28).
In a more specific aspect, the antibody binds to a conformational epitope, comprising residues 54-66 and 1 2-122 of human PD-L1 (SEQ ID NO:28). In a further embodiment, the invention is related to an anti-PD-L1 antibody, or antigen binding fragment thereof, which cross-competes for binding to PD-L1 with an antibody according to the invention as described herein. In a still further embodiment, the invention provides for compositions comprising any of the above described anti-PD-L1 antibodies in combination with at least one pharmaceutically acceptable carrier.
In a still further embodiment, the invention provides for an isolated nucleic acid encoding a polypeptide, or light chain or a heavy chain variable region sequence of an anti-PD-L1 antibody, or antigen binding fragment thereof, as described herein. In a still further embodiment, the invention provides for an isolated nucleic acid encoding a light chain or a heavy chain variable region sequence of an anti-PD-L1 antibody, wherein:
(a) the heavy chain comprises an HVR-H1 , HVR-H2 and an HVR-H3 sequence having at least 80% sequence identity to SYIMM (SEQ ID NO: 15),
SIYPSGGITFYADTVKG (SEQ ID NO: 16) and IKLGTVTTVDY (SEQ ID NO: 17), respectively, or
(b) the light chain comprises an HVR-L1 , HVR-L2 and an HVR-L3 sequence having at least 80% sequence identity to TGTSSDVGGYNYVS (SEQ ID NO: 18), DVSNRPS (SEQ ID NO:19) and SSYTSSSTRV (SEQ ID NO:20), respectively.
In a specific aspect, the sequence identity is 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.
In a further aspect the nucleic acid is SEQ ID NO:30 for the heavy chain, and SEQ ID NO:31 for the light chain.
In another aspect, the nucleic acid further comprises a vector suitable for expression of the nucleic acid encoding any of the previously described anti-PD-L1 antibodies.
In a still further specific aspect, the vector further comprises a host cell suitable for expression of the nucleic acid. In a still further specific aspect, the host cell is a eukaryotic cell or a prokaryotic cell.
In a still further specific aspect, the eukaryotic cell is a mammalian cell, such as Chinese Hamster Ovary (CHO).
In a still further embodiment, the invention provides for a process of making an anti- PD- L1 antibody or antigen binding fragment thereof, comprising culturing a host cell containing nucleic acid encoding any of the previously described anti-PD-L1 antibodies or antigen-binding fragment in a form suitable for expression, under conditions suitable to produce such antibody or fragment, and recovering the antibody or fragment.
In a still further embodiment, the invention provides a kit of parts comprising a container enclosing a therapeutically effective amount of a composition disclosed herein and a package insert indicating use for the treatment of a T-cell dysfunctional disorder.
In a still further embodiment, the invention provides for a kit of parts comprising any of the above described anti-PD-L1 compositions in combination with at least one further therapeutic agent or vaccine, such as a chemotherapeutic agent.
In one aspect, the at least one chemotherapeutic agent is gemcitabine,
cyclophosphamide, fluorouracil or oxaliplatin.
In another aspect, the vaccine is Stimuvax.
In a still further embodiment, the invention provides for a method of enhancing T-cell function comprising administering an effective amount of any of the above described anti-PD-L1 antibodies or compositions. In one aspect, the anti-PD-L1 antibody or composition renders dysfunctional T-cells non-dysfunctional. In another aspect, the antibody or composition treats of prevents a symptom of persistent infection, such as viral infection, e.g. by human immunodeficiency virus (HIV), herpes virus, Eppstein-Barr virus or human papilloma virus. In a still further embodiment, the invention provides for a method of treating a T-cell dysfunctional disorder comprising administering a therapeutically effective amount of any of the above described anti-PD-L1 antibodies or compositions.
In one specific aspect, the T-cell dysfunctional disorder is tumor immunity.
In a still further aspect, the method further comprises treatment with a vaccine.
In a still further aspect, the PD-L1 antibody or composition is combined with a treatment regimen further comprising a traditional therapy selected from the group consisting of: surgery, radiation therapy, chemotherapy, targeted therapy,
immunotherapy, hormonal therapy, angiogenesis inhibition and palliative care.
In a still further specific aspect, the tumor immunity results from a cancer selected from the group consisting of: breast, lung, colon, ovarian, melanoma, bladder, kidney, liver, salivary, stomach, gliomas, thyroid, thymic, epithelial, head and neck cancers, gastric, and pancreatic cancer.
Another aspect of the invention relates to the use of antibody dependent cell- mediated cytotoxicity (ADCC) of an anti-PD-L1 antibody disclosed herein or composition in the treatment of cancer.
Therefore, the invention pertains to method of treating cancer comprising
administering to a subject in need thereof an effective amount of an anti-PD-L1 antibody which induces antibody dependent cell-mediated cytotoxicity (ADCC). In a preferred embodiment the constant region of the anti-PD-L1 antibody is lgG1.
In another preferred embodiment the cancer is selected from the group consisting of: breast, lung, colon, ovarian, melanoma, bladder, kidney, liver, salivary, stomach, gliomas, thyroid, thymic, epithelial, head and neck cancers, gastric and pancreatic cancer.
Equivalent to the above mentioned methods of enhancing T-cell function, treating a T-cell dysfunctional disorder, or treating cancer, the invention relates likewise to the use of an anti-PD-L1 antibody or composition as described above and below for the manufacture of a medicament for ehancing T-cell function, treating a T-cell dysfunctional disorder or treating cancer;
or to an anti-PD-L1 antibody or composition for use in the enhancement of T-cell function, or treatment of a T-cell dysfunctional disorder or cancer.
In yet a further embodiment, the invention is directed to engineered antibodies, or engineered antibody fragments, which are fused directly or via a linker molecule to therapeutic agents, such as cytokines (e.g. IL-2, IL-12, TNFa, IFNa, IFNb), or growth factors; which engineered antibodies or engineered antibody fragments may also be used in tumor therapy and immune system related diseases. Antibody fusion proteins, especially immunocytokines, are well known in the art. The fusion partner can be bound to the N-terminus of the antibody or antibody fragment or, preferably, to its C-terminus.
Definitions
"Dysfunction " in the context of immune dysfunction, refers to a state of immune reduced responsiveness to antigenic stimulation. The term includes the common elements of both exhaustion and/or anergy in which antigen recognition may occur, but the ensuing immune response is ineffective to control infection or tumor growth.
"Enhancing T-cell function " means to induce, cause or stimulate a T-cell to have a sustained or amplified biological function, or renew or reactivate exhausted or inactive T-cells. Examples of enhancing T-cell function include: increased secretion of γ-interferon from CD8+ T- cells, increased proliferation, increased antigen responsiveness (e.g., viral or pathogen clearance) relative to such levels before the intervention. In one embodiment, the level of enhancement is as least 50%, alternatively 60%, 70%, 80%, 90%, 100%, 120%, 150%, 200%. The manner of measuring this enhancement is known to one of ordinary skill in the art.
A "T cell dysfunctional disorder" is a disorder or condition of T-cells characterized by decreased responsiveness to antigenic stimulation. In a particular embodiment, a T- cell dysfunctional disorder is a disorder that is specifically associated with
inappropriate increased signaling through PD-1. In another embodiment, T -cell dysfunctional disorder is one in which T-cells are anergic or have decreased ability to secrete cytokines, proliferate, or execute cytolytic activity. In a specific aspect, the decreased responsiveness results in ineffective control of a pathogen or tumor expressing an immunogen. .Examples of T cell dysfunctional disorders characterized by T-cell dysfunction include unresolved acute infection, chronic infection and tumor immunity. 'Tumor immunity " refers to the process in which tumors evade immune recognition and clearance. Thus, as a therapeutic concept, tumor immunity is "treated" when such evasion is attenuated, and the tumors are recognized and attacked by the immune system. Examples of tumor recognition include tumor binding, tumor shrinkage and tumor clearance.
The term "vaccine" as used herein includes any nonpathogenic immunogen that, when inoculated into a host, induces protective immunity against a specific pathogen. Vaccines can take many forms. Vaccines can be whole organisms that share important antigens with the pathogem, but are not pathogenic themselves (e.g., cowpox). Vaccines can also be prepared from killed (e.g., Salk polio vaccine) or attenuated (lost ability to produce disease - e.g., Sabin polio vaccine). Vaccines can also be prepared from purified macromolecules isolated from the pathogenic organism. For example, toxoid vaccines (e.g. , tetanus and diphtheria) containing the inactive form of soluble bacterial toxin - resulting in the production of anti-toxin antibodies, but not immunity to the intact bacteria. Subunit vaccines (e.g., Hepatitis B) contain only a single immunogenic protein isolated from the pathogen of interest. Hapten conjugate vaccines attaches certain carbohydrate or polypeptide epitopes isolated from the pathogen of interest to immunogenic carriers, such as tetanus toxoid. These strategies essentially use the epitopes as haptens to induce antibody production, which then recognize the same epitope in the native pathogen. However, to be maximally effective, such vaccines must incorporate both B- and T- cell cell epitopes, and the T-celf epitopes must be chosen to ensure that they can be recognized, presented and responded to by the immune systems of the host individuals. DNA vaccines exploit the ability of host cells to take up and express DNA encoding pathogenic proteins that is injected intramuscularly. Host responses to immunogens can be enhanced if administered as a mixture with adjuvants. Immune adjuvants function in one or more of the following ways: (1) prolonging retention of the immunogen, (2) increased effective size of the immunogen (and hence promoting phagocytosis and presentation to macrophages), (3) stimulating the influx of macrophage or other immune cells to the injection site, or (4) promoting local cytokine production and other immunologic activities. Example adjuvants include: complete Freund's adjuvant (CFA), aluminum salts, and mycobacterial derived proteins such as muramyl di- or tri-peptides.
The term "antibody " includes monoclonal antibodies (including full length antibodies which have an immunoglobulin Fc region), antibody compositions with polyepitopic specificity, multispecific antibodies {e.g., bispecific antibodies, diabodies, and single- chain molecules, as well as antibody fragments (e.g., Fab, F(ab')2, and Fv). The term "immunoglobulin" (Ig) is used interchangeably with "antibody" herein. The basic 4- chain antibody unit is a heterotetrameric glycoprotein composed of two identical light (L) chains and two identical heavy (H) chains. An IgM antibody consists of 5 of the basic heterotetramer units along with an additional polypeptide called a J chain, and contains 10 antigen binding sites, while IgA antibodies comprise from 2-5 of the basic 4-chain units which can polymerize to form polyvalent assemblages in combination with the J chain. In the case of IgGs, the 4-chain unit is generally about 150,000 daltons. Each L chain is linked to an H chain by one covalent disulfide bond, while the two H chains are linked to each other by one or more disulfide bonds depending on the H chain isotype. Each H and L chain also has regularly spaced intrachain disulfide bridges. Each H chain has at the N-terminus, a variable domain (VH) followed by three constant domains (CH) for each of the a and γ chains and four CH domains for μ and ε isotypes. Each L chain has at the N-terminus, a variable domain (VL) followed by a constant domain at its other end. The VL is aligned with the VH and the CL is aligned with the first constant domain of the heavy chain (CH1). Particular amino acid residues are believed to form an interface between the light chain and heavy chain variable domains. The pairing of a VH and VL together forms a single antigen-binding site. For the structure and properties of the different classes of antibodies, see e.g., Basic and Clinical Immunology, 8th Edition, Daniel P. Sties, Abba I. Terr and Tristram G. Parsolw (eds), Appleton & Lange, Norwalk, CT, 1994, page 71 and Chapter 6. The L chain from any vertebrate species can be assigned to one of two clearly distinct types, called kappa and lambda, based on the amino acid sequences of their constant domains. Depending on the amino acid sequence of the constant domain of their heavy chains (CH), immunoglobulins can be assigned to different classes or isotypes. There are five classes of immunoglobulins: IgA, IgD, IgE, IgG and IgM, having heavy chains designated α, δ, ε, γ and μ, respectively. The Y and a classes are further divided into subclasses on the basis of relatively minor differences in the CH sequence and function, e.g., humans express the following subclasses: lgG1, lgG2A, lgG2B, lgG3, lgG4, lgA1 and lgK1.
An "isolated" antibody is one that has been identified, separated and/or recovered from a component of its production environment (E.g., natural or recombinant).
Preferably, the isolated polypeptide is free of association with all other components from its production environment. Contaminant components of its production environment, such as that resulting from recombinant transfected cells, are materials that would typically interfere with research, diagnostic or therapeutic uses for the antibody, and may include enzymes, hormones, and other proteinaceous or non- proteinaceous solutes. In preferred embodiments, the polypeptide will be purified: (1) to greater than 95% by weight of antibody as determined by, for example, the Lowry method, and in some embodiments, to greater than 99% by weight; (1) to a degree sufficient to obtain at least 15 residues of N-terminal or internal amino acid sequence by use of a spinning cup sequenator, or (3) to homogeneity by SDS-PAGE under non-reducing or reducing conditions using Coomassie blue or, preferably, silver stain. Isolated antibody includes the antibody in situ within recombinant cells since at least one component of the antibody's natural environment will not be present.
Ordinarily, however, an isolated polypeptide or antibody will be prepared by at least one purification step. The "variable region" or "variable domain" of an antibody refers to the amino-terminal domains of the heavy or light chain of the antibody. The variable domains of the heavy chain and light chain may be referred to as "VH" and "VL", respectively. These domains are generally the most variable parts of the antibody (relative to other antibodies of the same class) and contain the antigen binding sites.
The term "variable" refers to the fact that certain segments of the variable domains differ extensively in sequence among antibodies. The V domain mediates antigen binding and defines the specificity of a particular antibody for its particular antigen. However, the variability is not evenly distributed across the entire span of the variable domains. Instead, it is concentrated in three segments called hypervariable regions (HVRs) both in the light-chain and the heavy chain variable domains. The more highly conserved portions of variable domains are called the framework regions (FR). The variable domains of native heavy and light chains each comprise four FR regions, largely adopting a beta-sheet configuration, connected by three HVRs, which form loops connecting, and in some cases forming part of, the beta-sheet structure. The HVRs in each chain are held together in close proximity by the FR regions and, with the HVRs from the other chain, contribute to the formation of the antigen binding site of antibodies (see Kabat et al, Sequences of Immunological Interest, Fifth Edition, National Institute of Health, Bethesda, MD (1991)). The constant domains are not involved directly in the binding of antibody to an antigen, but exhibit various effector functions, such as participation of the antibody in antibody-dependent cellular toxicity. The term "monoclonal antibody" as used herein refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical except for possible naturally occurring mutations and/or post-translation modifications (e.g., isomerizations, amidations) that may be present in minor amounts. Monoclonal antibodies are highly specific, being directed against a single antigenic site. In contrast to polyclonal antibody
preparations which typically include different antibodies directed against different determinants (epitopes), each monoclonal antibody is directed against a single determinant on the antigen. In addition to their specificity, the monoclonal antibodies are advantageous in that they are synthesized by the hybridoma culture, uncontaminated by other immunoglobulins. The modifier "monoclonal" indicates the character of the antibody as being obtained from a substantially homogeneous population of antibodies, and is not to be construed as requiring production of the antibody by any particular method. For example, the monoclonal antibodies to be used in accordance with the present invention may be made by a variety of techniques, including, for example, the hybridoma method (e.g., Kohler and Milstein., Nature, 256:495-97 (1975); Hongo et al, Hybridoma, 14 (3): 253-260 (1995), Harlow et al, Antibodies: A Laboratory Manual, (Cold Spring Harbor Laboratory Press, 2nd ed. 1988); Hammerling et al, in: Monoclonal Antibodies and T-Cell Hybridomas 563- 681 (Elsevier, N. Y., 1981)), recombinant DNA methods (see, e.g., U.S. Patent No. 4,816,567), phage-display technologies (see, e.g., Clackson et al, Nature, 352: 624- 628 (1991); Marks et al, J. Mol Biol. 222: 581-597 (1992); Sidhu et al, J. Mol Biol. 338(2): 299-310 (2004); Lee et al, J. Mol Biol. 340(5): 1073-1093 (2004); Fellouse, Proc. Natl. Acad. ScL USA 101(34): 12467-12472 (2004); and Lee et al, J. Immunol. Methods 284(1-2): 119-132 (2004), and technologies for producing human or humanlike antibodies in animals that have parts or all of the human immunoglobulin loci or genes encoding human immunoglobulin sequences (see, e.g., WO
1998/24893; WO 1996/34096; WO 1996/33735; WO 1991/10741; Jakobovits et al, Proc. Natl. Acad. ScL USA 90: 2551 (1993); Jakobovits et al, Nature 362: 255-258 (1993); Bruggemann et al, Year in Immunol. 7:33 (1993); U.S. Patent Nos.
5,545,807; 5,545,806; 5,569,825; 5,625,126; 5,633,425; and 5,661,016; Marks et al, Bio/Technology 10: 779-783 (1992); Lonberg et al, Nature 368: 856-859 (1994); Morrison, Nature 368: 812-813 (1994); Fishwild et al, Nature Biotechnol 14: 845-851 (1996); Neuberger, Nature Biotechnol. 14: 826 (1996); and Lonberg and Huszar, Intern. Rev. Immunol. 13: 65-93 (1995).
An "antibody fragment" comprises a portion of an intact antibody, preferably the antigen binding and/or the variable region of the intact antibody. Examples of antibody fragments include Fab, Fab*, F(ab')2 and Fv fragments; diabodies; linear antibodies (see U.S. Patent 5,641,870, Example 2; Zapata et al, Protein Eng. 8HO): 1057-1062 [1995]); single-chain antibody molecules and multispecific antibodies formed from antibody fragments. Papain digestion of antibodies produced two identical antigen-binding fragments, called "Fab" fragments, and a residual "Fc" fragment, a designation reflecting the ability to crystallize readily. The Fab fragment consists of an entire L chain along with the variable region domain of the H chain (VH), and the first constant domain of one heavy chain (CH1). Each Fab fragment is monovalent with respect to antigen binding, i.e., it has a single antigen-binding site. Pepsin treatment of an antibody yields a single large F(ab')2 fragment which roughly corresponds to two disulfide linked Fab fragments having different antigen-binding activity and is still capable of cross-linking antigen. Fab' fragments differ from Fab fragments by having a few additional residues at the carboxy terminus of the CH1 domain including one or more cysteines from the antibody hinge region. Fab '-SH is the designation herein for Fab' in which the cysteine residue(s) of the constant domains bear a free thiol group. F(ab')2 antibody fragments originally were produced as pairs of Fab' fragments which have hinge cysteines between them. Other chemical couplings of antibody fragments are also known.
The Fc fragment comprises the carboxy-terminal portions of both H chains held together by disulfides. The effector functions of antibodies are determined by sequences in the Fc region, the region which is also recognized by Fc receptors (FcR) found on certain types of cells.
"Fv" is the minimum antibody fragment which contains a complete antigen- recognition and -binding site. This fragment consists of a dimer of one heavy- and one light-chain variable region domain in tight, non-covalent association. From the folding of these two domains emanate six hypervariable loops (3 bops each from the H and L chain) that contribute the amino acid residues for antigen binding and confer antigen binding specificity to the antibody. However, even a single variable domain (or half of an Fv comprising only three HVRs specific for an antigen) has the ability to recognize and bind antigen, although at a lower affinity than the entire binding site. "Single-chain Fv " also abbreviated as "sFv " or "scFv " are antibody fragments that comprise the VH and V|_ antibody domains connected into a single polypeptide chain. Preferably, the sFv polypeptide further comprises a polypeptide linker between the VH and Vu domains which enables the sFv to form the desired structure for antigen binding. For a review of the sFv, see Pluckthun in The Pharmacology of Monoclonal Antibodies , vol. 113, Rosenburg and Moore eds., Springer- Verlag, New York, pp. 269-315 (1994). "Functional fragments" of the antibodies of the invention comprise a portion of an intact antibody, generally including the antigen binding or variable region of the intact antibody or the Fc region of an antibody which retains or has modified FcR binding capability.
Examples of antibody fragments include linear antibody, single-chain antibody molecules and multispecific antibodies formed from antibody fragments. The term "diabodies" refers to small antibody fragments prepared by constructing sFv fragments (see preceding paragraph) with short linkers (about 5-10) residues) between the VH and VL domains such that inter-chain but not intra-chain pairing of the V domains is achieved, thereby resulting in a bivalent fragment, i.e., a fragment having two antigen-binding sites. Bispecific diabodies are heterodimers of two "crossover" sFv fragments in which the VH and VL domains of the two antibodies are present on different polypeptide chains. Diabodies are described in greater detail in, for example, EP 404,097; WO 93/11161 ; Hollinger et al, Proc. Natl. Acad. ScL USA 90: 6444-6448 (1993). The term "nanobodies" refers to single-domain antibodies which are antibody fragments consisting of a single monomeric variable antibody domain. Like a whole antibody, they are able to bind selectively to a specific antigen. With a molecular weight of only 12-15 kDa, single-domain antibodies are much smaller than common antibodies (150-160 kDa). The first single-domain antibodies were engineered from heavy-chain antibodies found in camelids. Gibbs, W. Wayt (August 2005).
"Nanobodies". Scientific American Magazine.
The monoclonal antibodies herein specifically include "chimeric" antibodies
(immunoglobulins) in which a portion of the heavy and/or light chain is identical with or homologous to corresponding sequences in antibodies derived from a particular species or belonging to a particular antibody class or subclass, while the remainder of the chain(s) is(are) identical with or homologous to corresponding sequences in antibodies derived from another species or belonging to another antibody class or subclass, as well as fragments of such antibodies, so long as they exhibit the desired biological activity (U.S. Patent No. 4,816,567; Morrison et al, Proc. Natl. Acad. ScL USA, 81 :6851-6855 (1984)). As used herein, "humanized antibody" is used a subset of "chimeric antibodies." "Humanized" forms of non-human (e.g., murine) antibodies are chimeric antibodies that contain minimal sequence derived from non-human immunoglobulin. In one embodiment, a humanized antibody is a human immunoglobulin (recipient antibody) in which residues from an HVR (hereinafter defined) of the recipient are replaced by residues from an HVR of a non-human species (donor antibody) such as mouse, rat, rabbit or non-human primate having the desired specificity, affinity, and/or capacity. In some instances, framework ("FR") residues of the human immunoglobulin are replaced by corresponding non-human residues. Furthermore, humanized antibodies may comprise residues that are not found in the recipient antibody or in the donor antibody. These modifications may be made to further refine antibody performance, such as binding affinity. In general, a humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the hypervariable loops correspond to those of a non-human immunoglobulin sequence, and all or substantially all of the FR regions are those of a human immunoglobulin sequence, although the FR regions may include one or more individual FR residue substitutions that improve antibody performance, such as binding affinity, isomerization, immunogenicity, etc. The number of these amino acid substitutions in the FR are typically no more than 6 in the H chain, and in the L chain, no more than 3. The humanized antibody optionally will also comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin. For further details, see, e.g., Jones et al, Nature 321 :522-525 (1986); Riechmann et al, Nature 332:323-329 (1988); and Presta, Curr. Op. Struct. Biol. 2:593-596 (1992). See also, for example, Vaswani and Hamilton, Ann. Allergy, Asthma & Immunol. 1 :105-115 (1998); Harris, Biochem. Soc. Transactions 23:1035- 1038 (1995); Hurle and Gross, Curr. Op. Biotech. 5:428-433 (1994); and U.S. Pat. Nos. 6,982,321 and 7,087,409.
A "human antibody" is an antibody that possesses an amino-acid sequence corresponding to that of an antibody produced by a human and/or has been made using any of the techniques for making human antibodies as disclosed herein. This definition of a human antibody specifically excludes a humanized antibody
comprising non-human antigen-binding residues. Human antibodies can be produced using various techniques known in the art, including phage-display libraries.
Hoogenboom and Winter, J. Mol. Biol, 227:381 (1991); Marks et al, J. Mol. Biol, 222:581 (1991). Also available for the preparation of human monoclonal antibodies are methods described in Cole et al, Monoclonal Antibodies and Cancer Therapy, Alan R. Liss, p. 77 (1985); Boemer et al, J. Immunol, 147(l):86-95 (1991). See also van Dijk and van de Winkel, Curr. Opin. Pharmacol, 5: 368-74 (2001). Human antibodies can be prepared by administering the antigen to a transgenic animal that has been modified to produce such antibodies in response to antigenic challenge, but whose endogenous loci have been disabled, e.g., immunized xenomice (see, e.g., U.S. Pat. Nos. 6,075,181 and 6,150,584 regarding XENOMOUSE™
technology). See also, for example, Li et al, Proc. Natl. Acad. Sci. USA, 103:3557- 3562 (2006) regarding human antibodies generated via a human B-cell hybridoma technology.
The term "hypervariable region," "HVR," or "HV," when used herein refers to the regions of an antibody variable domain which are hypervariable in sequence and/or form structurally defined loops. Generally, antibodies comprise six HVRs; three in the VH (H1, H2, H3), and three in the VL (L1, 12, L3). In native antibodies, H3 and L3 display the most diversity of the six HVRs, and H3 in particular is believed to play a unique role in conferring fine specificity to antibodies. See, e.g., Xu et al, Immunity 13:37-45 (2000); Johnson and Wu, in Methods in Molecular Biology 248:1-25 (Lo, ed., Human Press, Totowa, NJ, 2003). Indeed, naturally occurring camelid antibodies consisting of a heavy chain only are functional and stable in the absence of light chain. See, e.g., Hamers-Casterman et al., Nature 363:446-448 (1993); Sheriff et al, Nature Struct. Biol. 3:733-736 (1996).
A number of HVR delineations are in use and are encompassed herein. The Kabat Complementarity Determining Regions (CDRs) are based on sequence variability and are the most commonly used (Kabat et al., Sequences of Proteins of
Immunological Interest, 5th Ed.
Public Health Service, National Institutes of Health, Bethesda, MD. (1991)). Chothia refers instead to the location of the structural loops (Chothia and Lesk, J. Mol. Biol. 196:901-917 (1987)). The AbM HVRs represent a compromise between the Kabat HVRs and Chothia structural loops, and are used by Oxford Molecular's AbM antibody modeling software. The "contact" HVRs are based on an analysis of the available complex crystal structures. The residues from each of these HVRs are noted below.
Loop Kabat AbM Chothia Contact
L1 L24-L34 L24-L34 L26-L32 L30-L36
L2 L50-L56 L50-L56 L50-L52 L46-L55
L3 L89-L97 L89-L97 L91-L96 L89-L96
H1 H31-H35B H26-H35B H26-H32 H30-H35B
(Kabat Numbering)
H1 H31-H35 H26-H35 H26-H32 H30-H35
(Chothia Numbering)
H2 H50-H65 H50-H58 H53-H55 H47-H58
H3 H95-H102 H95-H102 H96-H101 H93-H101
HVRs may comprise "extended HVRs" as follows: 24-36 or 24-34 (L1), 46-56 or 50- 56 (L2) and 89-97 or 89-96 (L3) in the VL and 26-35 (H1), 50-65 or 49-65 (H2) and 93-102, 94-102, or 95-102 (H3) in the VH. The variable domain residues are numbered according to Kabat et al., supra, for each of these definitions.
The expression "variable-domain residue -numbering as in Kabat" or "amino-acid- position numbering as in Kabat," and variations thereof, refers to the numbering system used for heavy-chain variable domains or light-chain variable domains of the compilation of antibodies in Kabat et al., supra. Using this numbering system, the actual linear amino acid sequence may contain fewer or additional amino acids corresponding to a shortening of, or insertion into, a FR or HVR of the variable domain. For example, a heavy-chain variable domain may include a single amino acid insert (residue 52a according to Kabat) after residue 52 of H2 and inserted residues (e.g. residues 82a, 82b, and 82c, etc. according to Kabat) after heavy-chain FR residue 82. The Kabat numbering of residues may be determined for a given antibody by alignment at regions of homology of the sequence of the antibody with a "standard" Kabat numbered sequence. "Framework" or "FR" residues are those variable-domain residues other than the HVR residues as herein defined. A "human consensus framework" or "acceptor human framework" is a framework that represents the most commonly occurring amino acid residues in a selection of human immunoglobulin VL or VH framework sequences. Generally, the selection of human immunoglobulin VL or VH sequences is from a subgroup of variable domain sequences. Generally, the subgroup of sequences is a subgroup as in Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, D (1991). Examples include for the VL, the subgroup may be subgroup kappa I, kappa II, kappa III or kappa IV as in Kabat et al, supra. Additionally, for the VH, the subgroup may be subgroup I, subgroup II, or subgroup III as in Kabat et al., supra. Alternatively, a human consensus framework can be derived from the above in which particular residues, such as when a human framework residue is selected based on its homology to the donor framework by aligning the donor framework sequence with a collection of various human framework sequences. An acceptor human framework "derived from" a human immunoglobulin framework or a human consensus framework may comprise the same amino acid sequence thereof, or it may contain preexisting amino acid sequence changes. In some embodiments, the number of pre-existing amino acid changes are 10 or less, 9 or less, 8 or less, 7 or less, 6 or less, 5 or less, 4 or less, 3 or less, or 2 or less.
An "amino-acid modification" at a specified position, e.g. of the Fc region, refers to the substitution or deletion of the specified residue, or the insertion of at least one amino acid residue adjacent the specified residue. Insertion "adjacent" to a specified residue means insertion within one to two residues thereof. The insertion may be N- terminal or C-terminal to the specified residue. The preferred amino acid modification herein is a substitution.
An "affinity-matured" antibody is one with one or more alterations in one or more HVRs thereof that result in an improvement in the affinity of the antibody for antigen, compared to a parent antibody that does not possess those alteration(s). In one embodiment, an affinity-matured antibody has nanomolar or even picomolar affinities for the target antigen. Affinity-matured antibodies are produced by procedures known in the art. For example, Marks et al, Bio/Technology 10:779-783 (1992) describes affinity maturation by VH- and VL-domain shuffling. Random mutagenesis of HVR and/or framework residues is described by, for example: Barbas et al. Proc Nat. Acad. ScL USA 91 :3809-3813 (1994); Schier et al. Gene 169:147-155 (1995);
ΥάΧοη et al. J. Immunol. 155:1994-2004 (1995); Jackson et al, J. Immunol.
154(7):3310- 9 (1995); and Hawkins et al, J. Mol. Biol. 226:889-896 (1992).
As use herein, the term "specifically binds to" or is " specific for" refers to measurable and reproducible interactions such as binding between a target and an antibody, which is determinative of the presence of the target in the presence of a
heterogeneous population of molecules including biological molecules. For example, an antibody that specifically binds to a target (which can be an epitope) is an antibody that binds this target with greater affinity, avidity, more readily, and/or with greater duration than it binds to other targets. In one embodiment, the extent of binding of an antibody to an unrelated target is less than about 10% of the binding of the antibody to the target as measured, e.g., by a radioimmunoassay (RIA). In certain embodiments, an antibody that specifically binds to a target has a
dissociation constant (KD) of < IxlO^M, < 1x10"7M, < IxlO^M, < 1x10"9M, or < 1x10" 10M. In certain embodiments, an antibody specifically binds to an epitope on a protein that is conserved among the protein from different species. In another embodiment, specific binding can include, but does not require exclusive binding.
"Antibody-dependent cell-mediated cytotoxicity" or ADCC refers to a form of cytotoxicity in which secreted Ig bound onto Fc receptors (FcRs) present on certain cytotoxic cells (e.g., natural killer (NK) cells, neutrophils and macrophages) enable these cytotoxic effector cells to bind specifically to an antigen-bearing target cell and subsequently kill the target cell with cytotoxins. The antibodies "arm" the cytotoxic cells and are required for killing of the target cell by this mechanism. The primary cells for mediating ADCC, NK cells, express FcyRIII only, whereas monocytes express FcyRI, FcyRII and FcyRIII. Fc expression on hematopoietic cells is summarized in Table 3 on page 464 of Ravetch and Kinet, Annu. Rev. Immunol. 9: 457-92 (1991). To assess ADCC activity of a molecule of interest, an in vitro ADCC assay, such as that described in U.S. Patent No. 5,500,362 or 5,821,337 may be performed. Useful effector cells for such assays include peripheral blood
mononuclear cells (PBMC) and natural killer (NK) cells. Alternatively, or additionally, ADCC activity of the molecule of interest may be assessed in vivo, e.g., in an animal model such as that disclosed in Clynes et al, PNAS USA 95:652-656 (1998). Unless indicated otherwise herein, the numbering of the residues in an immunoglobulin heavy chain is that of the EU index as in Kabat et al, supra. The "EU index as in Kabat" refers to the residue numbering of the human tgG1 EU antibody. In many cancers the tumor cells express high levels of PD-L1 on their surface. Upon binding to PD-L1 on tumor cells and binding with their fragment crystalline (Fc) part to Fc- gamma receptors (FCGR) on leukocytes, anti-PD-L1 antibodies with ADCC potential can trigger ADCC which may lead to the death of these tumor cells.
The term "Fc region" herein is used to define a C-terminal region of an
immunoglobulin heavy chain, including native-sequence Fc regions and variant Fc regions. Although the boundaries of the Fc region of an immunoglobulin heavy chain might vary, the human IgG heavy- chain Fc region is usually defined to stretch from an amino acid residue at position Cys226, or from Pro230, to the carboxyl-terminus thereof. The C-terminal lysine (residue 447 according to the EU numbering system) of the Fc region may be removed, for example, during production or purification of the antibody, or by recombinantly engineering the nucleic acid encoding a heavy chain of the antibody. Accordingly, a composition of intact antibodies may comprise antibody populations with all K447 residues removed, antibody populations with no K447 residues removed, and antibody populations having a mixture of antibodies with and without the K447 residue. Suitable native-sequence Fc regions for use in the antibodies of the invention include human lgG1, lgG2 (lgG2A, JgG2B), lgG3 and lgG4. "Fc receptor" or "FcR" describes a receptor that binds to the Fc region of an antibody.The preferred FcR is a native sequence human FcR. Moreover, a preferred FcR is one which binds an IgG antibody (a gamma receptor) and includes receptors of the FcyRI, FcyRII, and FcyRIII subclasses, including allelic variants and
alternatively spliced forms of these receptors, FcyRII receptors include FcyRIIA (an "activating receptor") and FcyRI IB (an "inhibiting receptor"), which have similar amino acid sequences that differ primarily in the cytoplasmic domains thereof. Activating receptor FcyRIIA contains an immunoreceptor tyrosine -based activation motif (ITAM) in its cytoplasmic domain. Inhibiting receptor FcyRIIB contains an
immunoreceptor tyrosine -based inhibition motif (ITIM) in its cytoplasmic domain, (see M. Daeron, Annu. Rev. Immunol. 5:203-234 (1997). FcRs are reviewed in Ravetch and Kinet, Annu. Rev. Immunol. 9: 457-92 (1991); Capet et al, Immunomethods 4: 25-34 (1994); and de Haas et al, J. Lab. Clin. Med. 126: 330-41 (1995). Other FcRs, including those to be identified in the future, are encompassed by the term "FcR" herein.
The term "Fc receptor" or "FcR" also includes the neonatal receptor, FcRn, which is responsible for the transfer of maternal IgGs to the fetus. Guyer et al, J. Immunol. 117: 587 (1976) and Kim et al., J. Immunol. 24: 249 (1994). Methods of measuring binding to FcRn are known (see, e.g., Ghetie and Ward, Immunol. Today 18: (12): 592-8 (1997); Ghetie et al, Nature Biotechnology 15 (7): 637-40 (1997); Hinton et al, J. Biol. Chem. TJI (8): 6213-6 (2004); WO 2004/92219 (Hinton et al). Binding to FcRn in vivo and serum half-life of human FcRn high- affinity binding polypeptides can be assayed, e.g., in transgenic mice or transfected human cell lines expressing human FcRn, or in primates to which the polypeptides having a variant Fc region are administered. WO 2004/42072 (Presta) describes antibody variants which improved or diminished binding to FcRs. See also, e.g., Shields et al, J. Biol. Chem. 9(2):
6591-6604 (2001).
"Effector cells" are leukocytes which express one or more FcRs and perform effector functions. In one aspect, the effector cells express at least FcyRIII and perform ADCC effector function. Examples of human leukocytes which mediate ADCC include peripheral blood mononuclear cells (PBMC), natural killer (NK) cells, monocytes, cytotoxic T cells and neutrophils. The effector cells may be isolated from a native source, e.g., blood. Effector cells generally are lymphocytes associated with the effector phase, and function to produce cytokines (helper T cells), killing cells in infected with pathogens (cytotoxic T cells) or secreting antibodies (differentiated B cells).
"Binding affinity" generally refers to the strength of the sum total of non-covalent interactions between a single binding site of a molecule (e.g., of an antibody) and its binding partner (e.g., an antigen). Unless indicated otherwise, as used herein, "binding affinity", "bind to", "binds to" or "binding to" refers to intrinsic binding affinity that reflects a 1 : 1 interaction between members of a binding pair (e.g. , antibody Fab fragment and antigen). The affinity of a molecule X for its partner Y can generally be represented by the dissociation constant (KD). Affinity can be measured by common methods known in the art, including those described herein. Low-affinity antibodies generally bind antigen slowly and tend to dissociate readily, whereas high- affinity antibodies generally bind antigen faster and tend to remain bound longer. A variety of methods of measuring binding affinity are known in the art, any of which can be used for purposes of the present invention. Specific illustrative and exemplary embodiments for measuring binding affinity, i.e. binding strength are described in the following. The "KD" or "KD value" according to this invention is in one embodiment measured by a radiolabeled antigen binding assay (RIA) performed with the Fab version of the antibody and antigen molecule as described by the following assay that measures solution binding affinity of Fabs for antigen by equilibrating Fab with a minimal concentration of (125l)-labeled antigen in the presence of a titration series of unlabeled antigen, then capturing bound antigen with an anti- Fab antibody-coated plate (Chen, et al, (1999) J. ol Biol 293:865-881). To establish conditions for the assay, microtiter plates (Dynex) are coated overnight with 5 ug/ml of a capturing anti- Fab antibody (Cappel Labs) in 50 mM sodium carbonate (pH 9.6), and subsequently blocked with 2% (w v) bovine serum albumin in PBS for two to five hours at room temperature (approximately 23°C). In a non-adsorbant plate (Nunc #269620), 100 pM or 26 pM [125l]-antigen are mixed with serial dilutions of a Fab of interest
(consistent with assessement of an anti-VEGF antibody, Fab- 12, in Presta et al, (1997) Cancer Res. 57:4593-4599). The Fab of interest is then incubated overnight; however, the incubation may continue for a longer period (e.g., 65 hours) to ensure that equilibrium is reached. Thereafter, the mixtures are transferred to the capture plate for incubation at room temperature for one hour. The solution is then removed and the plate washed eight times with 0.1% Tween-20 in PBS. When the plates have dried, 150 ul/well of scintillant (Micro Scint- 20; Packard) is added, and the plates are counted on a Topcount gamma counter (Packard) for ten minutes. Concentrations of each Fab that give less than or equal to 20% of maximal binding are chosen for use in competitive binding assays. According to another embodiment, the KD is measured by using surface-plasmon resonance assays using a BIACORE®-2000 or a
BIACORE®-3000 instrument (BIAcore, Inc., Piscataway, NJ) at 25°C with
immobilized antigen CM5 chips at -10 response units (RU). Briefly, carboxymethylated dextran biosensor chips (CM5, BIAcore Inc.) are activated with N- ethyl-N'- (3-dimethylaminopropyl)-carbodiimide hydrochloride (EDC) and N- hydroxysuccinimide (NHS) according to the supplier's instructions. Antigen is diluted with 10 mM sodium acetate, pH 4.8, to 5 pg/ml (-0.2 μΜ) before injection at a flow rate of 5 ptJminute to achieve approximately 10 response units (RU) of coupled protein. Following the injection of antigen, 1 M ethanolamine is injected to block unreacted groups. For kinetics measurements, two-fold serial dilutions of Fab (0.78 n to 500 nM) are injected in PBS with 0.05% TWEEN 20™ surfactant (PBST) at 25°C at a flow rate of approximately 25 L/min. Association rates (kon) and
dissociation rates (k0ff) are calculated using a simple one-to-one Langmuir binding model (BIAcore® Evaluation Software version 3.2) by simultaneously fitting the association and dissociation sensorgrams. The equilibrium dissociation constant (KD) is calculated as the ratio kofj/kon- See> e-9-> Cnen et al, J. Mol. Biol. 293:865-881 (1999). If the on-rate exceeds 106M 1 s" by the surface-plasmon resonance assay above, then the on-rate can be determined by using a fluorescent quenching technique that measures the increase or decrease in fluorescence-emission intensity (excitation = 295 nm; emission = 340 nm, 16 nm band-pass) at 25 °C of a 20 nM anti- antigen antibody (Fab form) in PBS, pH 7.2, in the presence of increasing
concentrations of antigen as measured in a spectrometer, such as a stop-flow- equipped spectrophotometer (Aviv Instruments) or a 8000-series SLM-AMINCO™ spectrophotometer (ThermoSpectronic) with a stirred cuvette.
An "on-rate " "rate of association " "association rate " or "kon" according to this invention can also be determined as described above using a BIACORE®-2000 or a BIACORE®- 3000 system (BIAcore, Inc., Piscataway, NJ) at 25°C with immobilized antigen CM5 chips at about 10 response units (RU). Briefly, carboxymethylated dextran biosensor ships (CM5, BIAcore Inc.) are activated with N-ethyl-N'-(3- dimethylamino propyl )-carbodiimide hydrochloride (ECD) and N-hydroxysuccinimide (NHS) according to the supplier's instructions. Antigen is diluted with 10 mM sodium acetate, ph 4.8, into 5 mg/ml (~ 0.2 mM) before injection at a flow rate of 5 ml/min. to achieve approximately 10 response units (RU) of coupled protein. Following the injection of antigen, IM ethanolamine is added to block unreacted groups. For kinetics measurements, two-fold serial dilutions of Fab (0.78 nM to 500 nM) are injected in PBS with 0.05% Tween 20 (PBST) at 25°C at a flow rate of approximately 25ul/min. Association rates (kon) and dissociation rates (k0ff) are calculated using a simple one-to-one Langmuir binding model (BIAcore Evaluation Software version 3.2) by simultaneous fitting the association and dissociation sensorgram. The equilibrium dissociation constant (KD) was calculated as the ratio k0fi/kon. See, e.g., Chen, Y., et al, (1999) J. ol Biol 293:865-881. However, if the on-rate exceeds 106 M"1 s"1 by the surface plasmon resonance assay above, then the on-rate is preferably determined by using a fluorescent quenching technique that measures the increase or decrease in fluorescence emission intensity (excitation = 295 nm; emission = 340 nm, 16 nm band-pass) at 25 °C of a 20 nM anti-antigen antibody (Fab form) in PBS, pH 7.2, in the presence of increasing concentrations of antigen as measured in a a spectrometer, such as a stop-flow equipped spectrophometer (Aviv Instruments) or a 8000-series SLM-Aminco spectrophotometer (Thermo Sp ectronic) with a stirred cuvette.
The term "functional epitope" as used herein refers to amino acid residues of an antigen that contribute energetically to the binding of an antibody, i.e. forming an "energetic epitope". Mutation of any one of the energetically contributing residues of the antigen to alanine will disrupt the binding of the antibody such that the relative KD ratio (KD mutant PD-L1 / KD wild type PD-L1) of the antibody will be greater than 4 (see Example 3.x(b)).
The term "conformational epitope" as used herein refers to amino acid residues of the PD-L1 antigen that come together on the surface when the polypeptide chain folds to form the native protein, and show a significantly reduced rate of HD exchange due to Fab binding, as described in the experimental section. The conformation epitope contains, but is not limited to, the functional epitope.
The phrase "substantially reduced," or "substantially different," as used herein, denotes a sufficiently high degree of difference between two numeric values
(generally one associated with a molecule and the other associated with a
reference/comparator molecule) such that one of skill in the art would consider the difference between the two values to be of statistical significance within the context of the biological characteristic measured by said values (e.g., KD values). The difference between said two values is, for example, greater than about 10%, greater than about 20%, greater than about 30%, greater than about 40%, and/or greater than about 50% as a function of the value for the reference/comparator molecule.
The term "substantially similar" or "substantially the same," as used herein, denotes a sufficiently high degree of similarity between two numeric values (for example, one associated with an antibody of the invention and the other associated with a reference/comparator antibody), such that one of skill in the art would consider the difference between the two values to be of little or no biological and/or statistical significance within the context of the biological characteristic measured by said values {e.g., KD values). The difference between said two values is, for example, less than about 50%, less than about 40%, less than about 30%, less than about 20%, and/or less than about 10% as a function of the reference/comparator value.
"Percent (%) amino acid sequence identity" and "homology" with respect to a peptide, polypeptide or antibody sequence are defined as the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in the specific peptide or polypeptide sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2 or ALIGN software. Those skilled in the art can determine appropriate parameters for measuring alignment, including any algorithms needed to achieve maximal alignment over the full length of the sequences being compared.
A "blocking" antibody or an "antagonist" antibody is one that inhibits or reduces a biological activity of the antigen it binds to. In some embodiments, blocking antibodies or antagonist antibodies substantially or completely inhibit the biological activity of the antigen. The anti-PD-L1 antibodies of the invention block the
interaction between PD-L1 and its receptor PD-1 , and thus the signaling through PD- 1 so as to restore a functional response by T-cells from a dysfunctional state to antigen stimulation. An "agonist" or activating antibody is one that enhances or initiates signaling by the antigen to which it binds. In some embodiments, agonist antibodies cause or activate signaling without the presence of the natural ligand.
The terms "cross-compete", "cross-competition", "cross-block", "cross-blocked" and "cross-blocking" are used interchangeably herein to mean the ability of an antibody or fragment thereof to interfere with the binding directly or indirectly through allosteric modulation of the anti-PD-L1 antibodies of the invention to the target human PD-L1. The extent to which an an antibody or fragment thereof is able to interfere with the binding of another to the target, and therefore whether it can be said to cross-block or cross-compete according to the invention, can be determined using competition binding assays. One particularly suitable quantitative cross-competition assay uses a FACS- or an AlphaScreen-based approach to measure competition between the labelled (e.g. His tagged, biotinylated or radioactive labelled) an antibody or fragment thereof and the other an antibody or fragment thereof in terms of their binding to the target. In the Experimental Section a suitable assay is described for determining whether a binding molecule cross-competes or is capable of cross-competing with an antibody or fragment thereof. In general, a cross-competing antibody or fragment thereof is for example one which will bind to the target in the cross-competition assay such that, during the assay and in the presence of a second antibody or fragment thereof, the recorded displacement of the immunoglobulin single variable domain or polypeptide according to the invention is up to 100% (e.g. in FACS based
competition assay) of the maximum theoretical displacement (e.g. displacement by cold (e.g. unlabeled) antibody or fragment thereof that needs to be cross-blocked) by the to be tested potentially cross-blocking antibody or fragment thereof that is present in a given amount. Preferably, cross-competing antibodies or fragments thereof have a recorded displacement that is between 10% and 100%, more preferred between 50% to 100%.
An "isolated" nucleic acid molecule encoding the antibodies herein is a nucleic acid molecule that is identified and separated from at least one contaminant nucleic acid molecule with which it is ordinarily associated in the environment in which it was produced. Preferably, the isolated nucleic acid is free of association with all components associated with the production environment. The isolated nucleic acid molecules encoding the polypeptides and antibodies herein is in a form other than in the form or setting in which it is found in nature. Isolated nucleic acid molecules therefore are distinguished from nucleic acid encoding the polypeptides and antibodies herein existing naturally in cells. The term "control sequences" refers to DNA sequences necessary for the expression of an operably linked coding sequence in a particular host organism. The control sequences that are suitable for prokaryotes, for example, include a promoter, optionally an operator sequence, and a ribosome binding site. Eukaryotic cells are known to utilize promoters, polyadenylation signals, and enhancers. Nucleic acid is "operably linked" when it is placed into a functional relationship with another nucleic acid sequence. For example, DNA for a presequence or secretory leader is operably linked to DNA for a polypeptide if it is expressed as a preprotein that participates in the secretion of the polypeptide; a promoter or enhancer is operably linked to a coding sequence if it affects the transcription of the sequence; or a ribosome binding site is operably linked to a coding sequence if it is positioned so as to facilitate translation. Generally, "operably linked" means that the DNA sequences being linked are contiguous, and, in the case of a secretory leader, contiguous and in reading phase. However, enhancers do not have to be contiguous. Linking is accomplished by ligation at convenient restriction sites. If such sites do not exist, the synthetic oligonucleotide adaptors or linkers are used in accordance with conventional A "stable" formulation is one in which the protein therein essentially retains its physical and chemical stability and integrity upon storage. Various analytical techniques for measuring protein stability are available in the art and are reviewed in Peptide and Protein Drug Delivery, 247-301 , Vincent Lee Ed., Marcel Dekker, Inc., New York, New York, Pubs. (1991) and Jones, A. Adv. Drug Delivery Rev. 10: 29-90 (1993). Stability can be measured at a selected temperature for a selected time period. For rapid screening, the formulation may be kept at 40°C for 2 weeks to 1 month, at which time stability is measured. Where the formulation is to be stored at 2-8°C, generally the formulation should be stable at 30°C or 40°C for at least 1 month and/or stable at 2-8°C for at least 2 years. Where the formulation is to be stored at 30°C, generally the formulation should be stable for at least 2 years at 30°C and/or stable at 40°C for at least 6 months. For example, the extent of aggregation during storage can be used as an indicator of protein stability. Thus, a "stable" formulation may be one wherein less than about 10% and preferably less than about 5% of the protein are present as an aggregate in the formulation. In other embodiments, any increase in aggregate formation during storage of the formulation can be determined.
A "reconstituted" formulation is one which has been prepared by dissolving a lyophilized protein or antibody formulation in a diluent such that the protein is dispersed throughout. The reconstituted formulation is suitable for administration (e.g. subscutaneous administration) to a patient to be treated with the protein of interest and, in certain embodiments of the invention, may be one which is suitable for parenteral or intravenous administration.
An "isotonic" formulation is one which has essentially the same osmotic pressure as human blood. Isotonic formulations will generally have an osmotic pressure from about 250 to 350 mOsm. The term "hypotonic" describes a formulation with an osmotic pressure below that of human blood. Correspondingly, the term "hypertonic" is used to describe a formulation with an osmotic pressure above that of human blood. Isotonicity can be measured using a vapor pressure or ice-freezing type osmometer, for example. The formulations of the present invention are hypertonic as a result of the addition of salt and/or buffer. "Carriers" as used herein include pharmaceutically acceptable carriers, excipients, or stabilizers that are nontoxic to the cell or mammal being exposed thereto at the dosages and concentrations employed. Often the physiologically acceptable carrier is an aqueous pH buffered solution. [Examples of physiologically acceptable carriers include buffers such as phosphate, citrate, and other organic acids; antioxidants including ascorbic acid; low molecular weight (less than about 10 residues) polypeptide; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as
polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, arginine or lysine; monosaccharides, disaccharides, and other carbohydrates including glucose, mannose, or dextrins; chelating agents such as EDTA; sugar alcohols such as mannitol or sorbitol; salt- forming counterions such as sodium; and/or nonionic surfactants such as TWEEN™, polyethylene glycol (PEG), and PLURONICS™.
A "pharmaceutically acceptable acid" includes inorganic and organic acids which are non toxic at the concentration and manner in which they are formulated. For example, suitable inorganic acids include hydrochloric, perchloric, hydrobromic, hydroiodic, nitric, sulfuric, sulfonic, sulfuric, sulfanilic, phosphoric, carbonic, etc.
Suitable organic acids include straight and branched-chain alkyl, aromatic, cyclic, cycloaliphatic, arylaliphatic, heterocyclic, saturated, unsaturated, mono, di- and tricarboxylic, including for example, formic, acetic, 2-hydroxyacetic, trifluoroacetic, phenylacetic, trimethylacetic, t-butyl acetic, anthranilic, propanoic, 2- hydroxypropanoic, 2-oxopropanoic, propandioic, cyclopentanepropionic,
cyclopentane propionic, 3-phenylpropionic, butanoic, butandioic, benzoic, 3-(4- hydroxybenzoyl)benzoic, 2-acetoxy- benzoic, ascorbic, cinnamic, lauryl sulfuric, stearic, muconic, mandelic, succinic, embonic, fumaric, malic, maleic, hydroxymaleic, malonic, lactic, citric, tartaric, glycolic, glyconic, gluconic, pyruvic, glyoxalic, oxalic, mesylic, succinic, salicylic, phthalic, palmoic, palmeic, thiocyanic, methanesulphonic, ethanesulphonic, 1 ,2-ethanedisulfonic, 2-hydroxyethanesulfonic, benzenesulphonic, 4-chorobenzenesulfonic, napthalene-2-sulphonic, p-toluenesulphonic,
camphorsulphonic, 4-methylbicyclo[2.2.2]-oct-2-ene-l-carboxylic, glucoheptonic, 4,4'- methylenebis-3-(hydroxy-2-ene-l-carboxylic acid), hydroxynapthoic.
"Pharmaceutically-acceptable bases" include inorganic and organic bases which are non-toxic at the concentration and manner in which they are formulated. For example, suitable bases include those formed from inorganic base forming metals such as lithium, sodium, potassium, magnesium, calcium, ammonium, iron, zinc, copper, manganese, aluminum, N- methylglucamine, morpholine, piperidine and organic nontoxic bases including, primary, secondary and tertiary amines, substituted amines, cyclic amines and basic ion exchange resins, [e.g., N(R')4 + (where R' is independently H or C1-4 alkyl, e.g., ammonium, Tris)], for example, isopropylamine, trimethylamine, diethylamine, triethylamine, tripropylamine, ethanolamine, 2- diethylaminoethanol, trimethamine, dicyclohexylamine, lysine, arginine, histidine, caffeine, procaine, hydrabamine, choline, betaine, ethylenediamine, glucosamine, methylglucamine, theobromine, purines, piperazine, piperidine, N-ethylpiperidine, polyamine resins and the like. Particularly preferred organic non-toxic bases are isopropylamine, diethylamine, ethanolamine, trimethamine, dicyclohexylamine, choline, and caffeine. Additional pharmaceutically acceptable acids and bases useable with the present invention include those which are derived from the amino acids, for example, histidine, glycine, phenylalanine, aspartic acid, glutamic acid, lysine and asparagine. "Pharmaceutically acceptable" buffers and salts include those derived from both acid and base addition salts of the above indicated acids and bases. Specific buffers and/ or salts include histidine, succinate and acetate. / A "pharmaceutically acceptable sugar" is a molecule which, when combined with a protein of interest, significantly prevents or reduces chemical and/or physical instability of the protein upon storage. When the formulation is intended to be lyophilized and then reconstituted, "pharmaceutically acceptable sugars" may also be known as a "lyoprotectant". [Exemplary sugars and their corresponding sugar alcohols include: an amino acid such as monosodium glutamate or histidine; a methylamine such as betaine; a lyotropic salt such as magnesium sulfate; a polyol such as trihydric or higher molecular weight sugar alcohols, e.g. glycerin, dextran, erythritol, glycerol, arabitol, xylitol, sorbitol, and mannitol; propylene glycol;
polyethylene glycol; PLURONICS®; and combinations thereof. Additional exemplary lyoprotectants include glycerin and gelatin, and the sugars mellibiose, melezitose, raffmose, mannotriose and stachyose. Examples of reducing sugars include glucose, maltose, lactose, maltulose, iso-maltulose and lactulose. Examples of non-reducing sugars include non-reducing glycosides of polyhydroxy compounds selected from sugar alcohols and other straight chain polyalcohols. Preferred sugar alcohols are monoglycosides, especially those compounds obtained by reduction of disaccharides such as lactose, maltose, lactulose and maltulose. The glycosidic side group can be either glucosidic or galactosidic. Additional examples of sugar alcohols are glucitol, maltitol, lactitol and iso-maltulose. The preferred pharmaceutically-acceptable sugars are the non-reducing sugars trehalose or sucrose. Pharmaceutically acceptable sugars are added to the formulation in a "protecting amount" (e.g. pre-lyophilization) which means that the protein essentially retains its physical and chemical stability and integrity during storage (e.g., after reconstitution and storage).
The "diluent" of interest herein is one which is pharmaceutically acceptable (safe and non-toxic for administration to a human) and is useful for the preparation of a liquid formulation, such as a formulation reconstituted after lyophilization. Exemplary diluents include sterile water, bacteriostatic water for injection (BWFI), a pH buffered solution (e.g. phosphate-buffered saline), sterile saline solution, Ringer's solution or dextrose solution. In an alternative embodiment, diluents can include aqueous solutions of salts and/or buffers.
A "preservative" is a compound which can be added to the formulations herein to reduce bacterial activity. The addition of a preservative may, for example, facilitate the production of a multi-use (multiple-dose) formulation. Examples of potential preservatives include octadecyldimethylbenzyl ammonium chloride, hexamethonium chloride, benzalkonium chloride (a mixture of alkylbenzyldimethylammonium chlorides in which the alkyl groups are long-chain compounds), and benzethonium chloride. Other types of preservatives include aromatic alcohols such as phenol, butyl and benzyl alcohol, alkyl parabens such as methyl or propyl paraben, catechol, resorcinol, cyclohexanol, 3-pentanol, and w-cresol. The most preferred preservative herein is benzyl alcohol. 'Treatment' refers to clinical intervention designed to alter the natural course of the individual or cell being treated, and can be performed either for prophylaxis or during the course of clinical pathology. Desirable effects of treatment include preventing occurrence or recurrence of disease, preventing metastasis, decreasing the rate of disease progression, ameliorating or palliating the disease state, and remission or improved prognosis. In some embodiments, antibodies of the invention are used to delay development of a disease or disorder. A subject is successfully "treated", for example, using the apoptotic anti-PD-L1 antibodies of the invention if one or more symptoms associated with a T-cell dysfunctional disorder is mitigated.
An "effective amount' refers to at least an amount effective, at dosages and for periods of time necessary, to achieve the desired or indicated effect, including a therapeutic or prophylactic result. For example, an effective amount of the anti-PD-L1 antibodies of the present invention is at least the minimum concentration that results in inhibition of signaling from PD-L1, either through PD-1 on T-cells or B7.1 on other APCs or both.
A "therapeutically effective amount' is at least the minimum concentration required to effect a measurable improvement or prevention of a particular disorder. A
therapeutically effective amount herein may vary according to factors such as the disease state, age, sex, and weight of the patient, and the ability of the antibody to elicit a desired response in the individual. A therapeutically effective amount is also one in which any toxic or detrimental effects of the antibody are outweighed by the therapeutically beneficial effects. For example, a therapeutically effective amount of the anti-PD-L1 antibodies of the present invention is at least the minimum
concentration that results in inhibition of at least one symptom of a T cell
dysfunctional disorder.
A "prophylactically effective amount' refers to an amount effective, at the dosages and for periods of time necessary, to achieve the desired prophylactic result. For example, a prophylactically effective amount of the anti-PD-L1 antibodies of the present invention is at least the minimum concentration that prevents or attenuates the development of at least one symptom of a T cell dysfunctional disorder.
"Mammal" for purposes of treatment refers to any animal classified as a mammal, including humans, domestic and farm animals, and zoo, sports, or pet animals, such as dogs, horses, rabbits, cattle, pigs, hamsters, gerbils, mice, ferrets, rats, cats, etc. Preferably, the mammal is human.
The term " 'pharmaceutical formulation" refers to a preparation that is in such form as to permit the biological activity of the active ingredient to be effective, and that contains no additional components that are unacceptably toxic to a subject to which the formulation would be administered. Such formulations are sterile.
A "sterile" formulation is aseptic or free from all living microorganisms and their spores.
The term "about" as used herein refers to the usual error range for the respective value readily known to the skilled person in this technical field. An "autoimmune disorder" is a disease or disorder arising from and directed against an individual's own tissues or organs or a co-segregation or manifestation thereof or resulting condition therefrom. Autoimmune diseases can be an organ-specific disease (i.e., the immune response is specifically directed against an organ system such as the endocrine system, the hematopoietic system, the skin, the cardiopulmonary system, the gastrointestinal and liver systems, the renal system, the thyroid, the ears, the neuromuscular system, the central nervous system, etc.) or a systemic disease that can affect multiple organ systems (for example, systemic lupus erythematosus (SLE), rheumatoid arthritis (RA), polymyositis, etc.). Preferred such diseases include autoimmune rheumatologic disorders (such as, for example, RA, Sjogren's syndrome, scleroderma, lupus such as SLE and lupus nephritis,
polymyositis-dermatomyositis, cryoglobulinemia, anti-phospholipid antibody syndrome, and psoriatic arthritis), autoimmune gastrointestinal and liver disorders (such as, for example, inflammatory bowel diseases {e.g., ulcerative colitis and Crohn's disease), autoimmune gastritis and pernicious anemia, autoimmune hepatitis, primary biliary cirrhosis, primary sclerosing cholangitis, and celiac disease), vasculitis (such as, for example, ANCA-negative vasculitis and ANCA-associated vasculitis, including Churg-Strauss vasculitis, Wegener's granulomatosis, and microscopic polyangiitis), autoimmune neurological disorders (such as, for example, multiple sclerosis, opsoclonus myoclonus syndrome, myasthenia gravis,
neuromyelitis optica, Parkinson's disease, Alzheimer's disease, and autoimmune polyneuropathies), renal disorders (such as, for example, glomerulonephritis,
Goodpasture's syndrome, and Berger"s disease), autoimmune dermatologic disorders (such as, for example, psoriasis, urticaria, hives, pemphigus vulgaris, bullous pemphigoid, and cutaneous lupus erythematosus), hematologic disorders (such as, for example, thrombocytopenic purpura, thrombotic thrombocytopenic purpura, post-transfusion purpura, and autoimmune hemolytic anemia),
atherosclerosis, uveitis, autoimmune hearing diseases (such as, for example, inner ear disease and hearing loss), Behcet's disease, Raynaud's syndrome, organ transplant, and autoimmune endocrine disorders (such as, for example, diabetic- related autoimmune diseases such as insulin-dependent diabetes mellitus (IDDM), Addison's disease, and autoimmune thyroid disease (e.g., Graves' disease and thyroiditis)). More preferred such diseases include, for example, RA, ulcerative colitis, ANCA-associated vasculitis, lupus, multiple sclerosis, Sjogren's syndrome, Graves' disease, IDDM, pernicious anemia, thyroiditis, and glomerulonephritis.
The term "cytotoxic agent" as used herein refers to a substance that inhibits or prevents the function of cells and/or causes destruction of cells. The term includes radioactive isotopes (e.g. At211, 1131, 1125, Y90, Re186, Re188, Sm153, Bi212, P32 and radioactive isotopes of Lu), and toxins such as small-molecule toxins or enzymatically active toxins of bacterial, fungal, plant or animal origin, or fragments thereof. A "chemotherapeutic agent" is a chemical compound useful in the treatment of cancer. Examples of chemotherapeutic agents include alkylating agents such as thiotepa and cyclophosphamide; alkyl sulfonates such as busulfan, improsulfan, and piposulfan; aziridines such as benzodopa, carboquone, meturedopa, and uredopa; ethylenimines and methylamelamines including altretamine, triethylenemelamine, trietylenephosphoramide, triethiylenethiophosphoramide and trimethylolomelamine; acetogenins (especially bullatacin and butlatacinone); delta-9-tetrahydrocannabinol (dronabinol); beta-lapachone; lapachol; colchicines; betulinic acid; a camptothecin (including the synthetic analogue topotecan (CPT-11 (irinotecan),
acetylcamptothecin, scopolectin, and 9- aminocamptothecin); bryostatin;
pemetrexed; callystatin; CC-1065 (including its adozelesin, carzelesin and bizelesin synthetic analogues); podophyllotoxin; podophyllinic acid; teniposide; cryptophycins (particularly cryptophycin 1 and cryptophycin 8); dolastatin; duocarmycin (including the synthetic analogues, KW-2189 and CB1-TM1); eleutherobin; pancratistatin; TLK- 286; CDP323, an oral alpha-4 integrin inhibitor; a sarcodictyin; spongistatin; nitrogen mustards such as chlorambucil, chlornaphazine, cholophosphamide, estramustine, ifosfamide, mechlorethamine, mechlorethamine oxide hydrochloride, melphalan, novembichin, phenestenne, prednimustine, trofosfamide, uracil mustard; nitrosureas such as carmustine, chlorozotocin, fotemustine, lomustine, nimustine, and
ranimnustine; antibiotics such as the enediyne antibiotics (e. g., calicheamicin, especially calicheamicin gammall and calicheamicin omegall (see, e.g., Nicolaou et ah, Angew. Chem Intl. Ed. Engl., 33: 183-186 (1994)); dynemicin, including dynemicin A; an esperamicin; as well as neocarzinostatin chromophore and related chromoprotein enediyne antibiotic chromophores), aclacinomysins, actinomycin, authramycin, azaserine, bleomycins, cactinomycin, carabicin, carminomycin, carzinophilin, chromomycinis, dactinomycin, daunorubicin, detorubicin, 6-diazo-5- oxo-L-norleucine, doxorubicin (including morpholino-doxorubicin, cyanomorpholino- doxorubicin, 2-pyrrolino- doxorubicin, doxorubicin HCI liposome injection and deoxydoxorubicin), epirubicin, esorubicin, idarubicin, marcellomycin, mitomycins such as mitomycin C, mycophenolic acid, nogalamycin, olivomycins, peplomycin, potfiromycin, puromycin, quelamycin, rodorubicin, streptonigrin, streptozocin, tubercidin, ubenimex, zinostatin, zorubicin; anti-metabolites such as methotrexate, gemcitabine, tegafur, capecitabine, an epothilone, and 5-fluorouracil (5-FU); folic acid analogues such as denopterin, methotrexate, pteropterin, trimetrexate; purine analogs such as fludarabine, 6-mercaptopurine, thiamiprine, thioguanine; pyrimidine analogs such as ancitabine, azacitidine, 6-azauridine, carmofur, cytarabine, dideoxyuridine, doxifluridine, enocitabine, floxuridine, and imatinib (a 2- phenylaminopyrimidine derivative), as well as other c-Kit inhibitors; anti-adrenals such as aminoglutethimide, mitotane, trilostane; folic acid replenisher such as frolinic acid; aceglatone; aldophosphamide glycoside; aminolevulinic acid; eniluracil;
amsacrine; bestrabucil; bisantrene; edatraxate; defofamine; demecolcine;
diaziquone; elfornithine; elliptinium acetate; etoglucid; gallium nitrate; hydroxyurea; lentinan; lonidainine; maytansinoids such as maytansine and ansamitocins;
mitoguazone; mitoxantrone; mopidanmol; nitraerine; pentostatin; phenamet;
pirarubicin; losoxantrone; 2-ethylhydrazide; procarbazine; PSK® polysaccharide complex (JHS Natural Products, Eugene, OR); razoxane; rhizoxin; sizofiran;
spirogermanium; tenuazonic acid; triaziquone; 2,2',2"-trichlorotriethylamine;
trichothecenes (especially T-2 toxin, verracurin A, roridin A and anguidine); urethan; vindesine; dacarbazine; mannomustine; mitobronitol; mitolactol; pipobroman;
gacytosine; arabinoside ("Ara-C"); thiotepa; taxoids, e.g., paclitaxel, albumin- engineered nanoparticle formulation of paclitaxel, and doxetaxel; chloranbucil; 6- thioguanine; mercaptopurine; methotrexate; platinum analogs such as cisplatin and carboplatin; vinblastine; platinum; etoposide (VP-16); ifosfamide; mitoxantrone;
vincristine; oxaliplatin; leucovovin; vinorelbine; novantrone; edatrexate; daunomycin; aminopterin; ibandronate; topoisomerase inhibitor RFS 2000; difluorometlhylornithine (DMFO); retinoids such as retinoic acid; pharmaceutically acceptable salts, acids or derivatives of any of the above; as well as combinations of two or more of the above such as CHOP, an abbreviation for a combined therapy of cyclophosphamide, doxorubicin, vincristine, and prednisolone, and FOLFOX, an abbreviation for a treatment regimen with oxaliplatin combined with 5-FU and leucovovin.
Other therapeutic agents that may be used in combination with the anti-PD-L1 antibodies of the invention are bisphosphonates such as clodronate, NE-58095, zoledronic acid/zoledronate, alendronate, pamidronate, tiludronate, or risedronate; as well as troxacitabine (a 1 ,3-dioxolane nucleoside cytosine analog); anti-sense oligonucleotides, particularly those that inhibit expression of genes in signaling pathways implicated in abherant cell proliferation, such as, for example, PKC-alpha, Raf, H-Ras, and epidermal growth factor receptor (EGF-R); vaccines such as
Stimuvax vaccine, Theratope vaccine and gene therapy vaccines, for example, Allovectin vaccine, Leuvectin vaccine, and Vaxid vaccine; topoisomerase 1 inhibitor; an anti-estrogen such as fulvestrant; a Kit inhibitor such as imatinib or EXEL-0862 (a tyrosine kinase inhibitor); EGFR inhibitor such as erlotinib or cetuximab; an anti- VEGF inhibitor such as bevacizumab; arinotecan; rmRH; lapatinib and lapatinib ditosylate (an ErbB-2 and EGFR dual tyrosine kinase small-molecule inhibitor also known as GW572016); 17AAG (geldanamycin derivative that is a heat shock protein (Hsp) 90 poison), and pharmaceutically acceptable salts, acids or derivatives of any of the above.
"Stimuvax" is a BLP25 liposome cancer vaccine designed to induce an immune response to cancer cells that express MUC1 , a protein antigen widely expressed on common cancers. MUC1 is over expressed on many cancers such as lung cancer, breast cancer, prostate cancer and colorectal cancer. Stimuvax is thought to work by stimulating the body's immune system to identify and destroy cancer cells expressing MUC1.
Brief Description of the Figures
Figure 1 shows that A09-246-2 efficiently blocks 125I-PD-L1 binding to immobilized PD-1-Fc . Inactive mutant: Mutant VL-A31G,D52E,R99Y of A09-188-1. A09-246-2 (1): Expressed in HEK 293 cells. A09-246-2 (2): Expressed in CHO-S cells, batch #1. A09-246-2 (3): Expressed in CHO-S cells, batch #2.
Figure 2 shows sequence of the extracellular domain (fused to a 6 amino acid His tag, SEQ ID NO:29) of PD-L1. Peptides that could be identified by MS are indicated by grey bars. Those that showed protection from HD exchange in the presence of Fab are represented by black bars. Peptides that could not be analyzed are highlighted by underlining and italicizing in the sequence. Figure 3 shows the epitope of A09-246-2 on PD-L1. The backbone of PD-L1 is shown in a ribbon representation. Amino acids which, when mutated to alanine, destabilize the A09-246-2 - PD-L1 binding by more than 0.7 kcal/mol are shown as sticks.
Figure 4 shows that A09-246-2 efficiently enhances T cell activities represented by IL-2 production as shown by SEA human PBMC assay.
Figures 5-16 show that A09-246-2 increases ADCC in different tumor lines
(stimulated and non-stimulated) and allotypes.
Experimental Se on The working examples presented below are intended to illustrate particular embodiments of the invention, and are not intended to limit the scope of the specification or the claims in any way.
1. Selection and Improvement of Antibodies
Antibodies were selected from phage Fab display libraries. The selection included two different arms one utilizing biotinylated human PD-L1 on the different selection rounds and other alternating human and mouse PD-L1 as target on different rounds. 3840 clones were screened by ELISA to identify 170 individual PD-L1 binders. Based on the inhibition of PD-1 ligand binding, 48 hits were selected and were expressed in medium scale for further characterization.
The selected hits were reformatted and expressed as IgGs. Hit optimization candidates were selected based on the potency to block binding of PD-1 to PD-L1 and the ability of binding to both human and mouse versions of PD-L1. Binding to PD-L1 was originally determined by ELISA and later quantified by Biacore and binding to PD-L1 expressing cells by FACS. Four candidates fitted the predefined profile, including A09-188-1 which contained a lambda light chain.
A09-188-1 was chosen for affinity maturation and sequence optimization. The goals of the affinity maturation were increased affinity to the human target, cross-reactivity to the murine target, and improvement of manufacturabiiity. Heavy chain mutations in the HVR's were introduced by codon based randomization. This heavy chain diversity was combined with light chain diversity introduced by light chain shuffling to generate the affinity maturation library. Further heavy and light chain FR and HVR residues were mutated to increase stability of the antibody and introduce amino acids found in the germline, such as the heavy chain FR mutation 193V.
This yielded the HVR sequences given below. It could be shown that at least the residues X1-X17 are variable in terms of target binding and have preferred meanings as herein disclosed.
HVR-H1 sequence is X1YX2MX3 (SEQ ID NO:1);
HVR-H2 sequence is SIYPSGGX4TFYADX5VKG (SEQ ID NO:2);
HVR-H3 sequence is IKLGTVTTVX6Y (SEQ ID NO:3);
wherein: X! is K, R, T, Q, G, A, W, M, I or S; X2 is V, R, K, L, M or I; X3 is H, T, N, Q, A, V, Y, W, F or M; X4 is F or I; X5 is S or T; Xe is E or D
HVR-L1 sequence is TGTXyXeDVGXgYNYVS (SEQ ID NO:8);
HVR-L2 sequence is X10VXnXi2RPS (SEQ ID NO:9);
HVR-L3 sequence is SSX13TX14Xi5Xi6Xi7RV (SEQ ID NO: 10);
wherein: X7 is N or S; X8 is T, R or S; X9 is A or G; X10 is E or D; Xn is I, N or S; Xi2 is D, H or N; X13 is F or Y; Xi4 is N or S; X15 is R, T or S; Xi6 is G or S; X17 is I or T.
2. Manufacturing, Purification and Formulation 2.1 Bioproduction and Clarification
Antibody A09-246-2 corresponding to SEQ ID NO:32 (heavy chain) and SEQ ID NO:33 (light chain), was expressed from CHO-S cells transfected with the KOL isotype DNA sequence and sequence-optimized EU version, respectively. Cell cultures were conducted in batch mode in a 250L Single-use-Bioreactor (SUB) (Table 2-2). Cells were grown in ProCH05 growth media supplemented with 4 m L- Glutamine + 25 pg/mL puromycin at 37 °C. The cultures were fed with 15% Efficient Feed B and 1.0 mM valproic acid 3 days after inoculation.
Crude conditioned media from the bioreactor runs were clarified using 1.1 m2
Millistak+ Pod D0HC (Millipore MD0HC10FS1) and 0.11 m2 Millistak+ Pod A1HC (Millipore MA1HC01FS1) filters, followed by terminal filtration with a Sartopore 2 filter (Sartorius 5445307H8-SS). 2.2 Purification
The purification process consisted of two chromatography steps; (a) MabSelect Protein A to capture the antibody from the clarified harvest, and (b) Hydroxyapatite Type II polish step to remove remaining aggregated product, host cell proteins and DNA, and product related impurities. An intermediate Q-filtration step was inserted between the 2 chromatography steps to further reduce DNA. SDS-PAGE and size exclusion chromatography SE-HPLC were used to analyze in-process samples during purification. Protein content of the Mabselect in-process samples was performed using the Protein A HPLC method while UVA is spectroscopy was used for all other process steps.
Post Mabselect eluates were subjected to 30 min of low pH viral inactivation (pH 3.7) and subsequently neutralized to pH 7.0 prior to the next purification step.
The final polishing step was the hydroxyapatite Type II chromatography. The conductivity of the Sartobind Q filtrate was adjusted to < 3 mS/cm with water, and pH reduced to 6.5 with acetic acid before sample loading.
Bound anti-PD-L1 product was eluted with a NaCI step gradient. Aggregated product-related impurities was eluted with the Strip Buffer.
2.3 Formulation, Ultrafiltration and Diafiltration
Purified anti-PDL1 from the hydroxyapatite polishing step were concentrated and then diafiltered into their respective buffers according to the Table below. The bulk products were then sterile-filtered through 0.2 filter units and further diluted with formulation buffer to their final concentrations. Formulated bulk substance were further tested for endotoxin and checked by SE-HPLC.
Figure imgf000051_0001
2.4 Human Formulation
The following target administration and formulation profile was set:
Route of administration: iv infusion
Human dose range: 1-15 mg/kg
Concentration: 10 mg/ml
Storage conditions: liquid or frozen
Shelf life: more than 12m The following liquid formulation was selected:
10.0 mg/mL A09-246-2
10 mM Acetate
5.1% (w/v) Mannitol
1.4 mM Methionine
0.05% (w/v) Tween 20
adjusted to pH 5.5
The formulation contains antioxidative excipients and was shown to be sufficiently stable at the following stress conditions:
Light stress
Shear stress
Freeze-thaw cycles
Oxidation stress
Stability was assessed at 2-8°C and 25°C up to 26 and 13 weeks, respectively. The formulation was found to be sufficiently stable at 2-8°C up to the latest timepoint of 26 weeks. Also, a freeze-dried formulation was made with excellent stability at 25°C up to 26 weeks. 3. Biochemical and Biological Characterization
3.1 Biacore Binding Affinity andSpecificity
Binding affinity and selectivity was determined by Biacore assays. The affinity of the lead antibody candidate for human and non human orthologues is summarized in the table below. The binding affinity of anti PD-L1 antibody A09-246-2 according to this invention for human, mouse and cynomolgus monkey proteins was statistically similar but highly reduced for dog, rat and rabbit proteins that displayed a very fast dissociation profile. ka d/M sl kd d/sl * , KD(M> KD(nM) : .+/- STD
Human 2.72E+05 1.83E-04 6.73E-10 0.7 0.09
Monkey 2.49E+05 2.79E-04 1.12E-09 1.1 0.02
Mouse 1.77E+05 1.64E-04 9.26E-10 0.9 0.04
Dog 2.38E+06 1.07E-02 4.50E-09 4.5 0.4
Rat 3.54E+05 2.20E-02 6.68E-08 66.8 8.8
Rabbit 2.77E+05 2.82E-02 1.05E-07 105.4 11.2
The kinetic profiles for A09-188-1 and further mutants thereof are shown in the table below:
Figure imgf000053_0001
A09-214-1 VH-M311,M33I,S63T,I93V 0.40 179.1 0.08
A09-215-1 VH-M33L. 35F.S63T.I93V 1.28 50.6 0.24
A09-216-1 VH-M311,M33L,S63T,I93V 0.91 77.8 0.17
A09-219-1 VH-M31S,M33I,M35F,S63T,I93V 0.18 278.5 0.03
A09-220-1 VH-M31S,M33L,M35F,S63T,I93V 0.78 68.3 0.15
A09-221-1 VH-M31 S, M33I ,S63T, I93V 0.44 126.7 0.08
A09-222-1 VH- 31 S, M33L,S63T,I93V 1.24 47.1 0.23
A09-223-1 VH-M31 S, 35F.S63T, I93V 3.62 13.5 0.68
Light chain variant of A09-188-1 *
A09-202-1 VL-A31G 4.15 18.8 0.78
Heavy and light chain combination
variants of A09-188-1 *
VL-A31G; VH-
A09-248-2 M31I,M33I,M35F,S63T,I93V 0.10 436.4 0.02
VL-A31G; VH-
A09-239-2 M31I, 33L,M35F,S63T,I93V 0.36 119.7 0.08
VL-A31G; VH-
A09-240-2 M33I,M35F,S63T,I93V 0.16 245.9 0.03
VL-A31G; VH-
A09-241-2 M31I,M33I,S63T,I93V 0.32 166.4 0.07
VL-A31G; VH-
A09-242-2 M33L,M35F,S63T,I93V 0.76 55.6 0.16
VL-A31G; VH-
A09-243-2 M31I,M33L,S63T,I93V 0.63 85.0 0.13
VL-A31G; VH-
A09-244-2 M31S,M33I,M35F,S63T,I93V 0.12 279.7 0.03
VL-A31G; VH-
A09-245-2 M31S,M33L,M35F,S63T,I93V 0.43 77.2 0.09
VL-A31G; VH-
A09-246-2 M31S,M33I,S63T,I93V 0.34 125.4 0.07 VL-A31G; VH-
A09-247-2 MSIS.MSSL.SeST.ISSV 0.76 57.8 0.16
(*) Amino acid positions counted from the N-terminus of the heavy and light chains, respectively 3.2 Selectivity
Selectivity was determined by evaluating the binding to members of the B7 family including hu-PD- L1-huFc, hu-PDL-2-huFc, hu-B7.1-huFc, hu-B7.2-huFc, huB7-H2- huFc and huB7-H3-huFc by Biacore.
All the anti-huPD-L1 MAb tested including A09-246-2 reacted specifically with only huPD-L1 protein and not with any other B7 Family proteins.
3.3 PD-L1 : PD-1 Interaction Blocking
The ability of A09-246-2 and a control antibody to compete with the binding of radio- labelled PD-L1 to immobilized PD-1 was determined by radioactive competitive displacement assay. Figure 1 shows representative competition curves for the test antibodies. The results demonstrated that A09-246-2 efficiently blocks the interaction of PD-1 and PD-L1 with an IC50 of 0.071 ± 0.008 nM (0.01 ± 0.001 μg/ml).
The follow assay protocol was used:
1. Add 60 ml/well of PBS, containing 1 mg/ml of human PD-1Fc (R&D Systems, 1086-PD; lyophilized PD-1 dissolved with PBS at 200 mg/ml) to white Costar plates (Corning 3922). Incubate overnight at 4 °C.
2. Rinse wells 1 time with PBS.
3. Block wells with 120 ml of 0.5% BSA (Sigma A-3059) dissolved in binding buffer, for 1 h at room temperature (RT).
4. Rinse wells 1x with binding buffer.
5. Add 50 ml of test sample to wells (antibody, supernatant). Dilute antibodies to 20 nM in assay buffer and serial dilute 9x at a 1 :4 dilution. Samples are diluted to 2x final concentration, prior to adding to the wells (usually starting at 10 nM - 1x concentration). 6. Nonspecific binding: add 50 ml of PD-L1/Fc (R&D Systems, 156-B7) at a final concentration of 250 n in place of the test sample at a 500 fold excess to the labeled PD-L1. Total wells receive the same volume of assay buffer.
7. Add 50 ml of 0.5 nM 125I-PD-L1 (custom labeled at Perkin Elmer, lot number CIS32211 , 250 nM, 2400 Ci/mmol) to each well. Dilute to 2x the final concentration in assay buffer -final concentration = 0.25 nM.
8. Shake the plate for 2-2.5 h at 37 °C.
9. Wash the wells 5 times with cold binding buffer.
10. Add 100 ml of Microscint 20 (Packard 6013641) to each well. Incubate for at least one h at RT.
11. Count luminescence on Topcount (125l-Microscint protocol).
Binding Buffer: 50 mM Hepes, pH 7.5, 130 mM NaCI, 5.1 mM KCI, 1.3 mM MgS04 Assay buffer: binding buffer + 0.5% BSA
3.4 PD-L1 : B7.1 Interaction Blocking
The ability of A09-246-2 to block soluble B7.1 binding to PD-L1 on cell surface was measured by FACS. Results indicated A09-246-2 efficiently blocks the interaction of B7.1 and PD-L1 with an IC50 of 0.2 ± 0.004nM (0.03 ± 0.0006 μg/ml).
3.5 Epitope Mapping
a) Hydrogen-Deuterium Exchange
The extracellular domain of PD-L1 antigen (SEQ ID NO:29) was incubated in heavy water (D20) solution to allow amide protons on the protein backbone to exchange with deuterons from the solvent, in either the presence or absence of excess anti- PD-L1 Fab or a non-specific Fab. The samples were digested with protease and analysed by liquid chromatography-mass spectrometry (LC-MS) to determine the level of deuteration in each peptide. The Fab corresponding to A09-246-2 was used instead of the full IgG in order to simplify the mass spectrometry analysis by decreasing the number of peptides generated by protease digestion. Despite this, some regions remained that could not be identified and analyzed (underlined, italicized sequence portions in Figure 2), however these regions represent a small fraction of the sequence, and mostly reside in the second immunoglobulin domain, distant from the epitope containing region. Residues 32-39 in domain I of the extracellular domain were also resistant to identification by mass spectrometry and encompass the site of an N-linked
glycosylation; as A09-246-2 is known to bind an aglycosylated version of PD-L1 produced in E. coli, the inability to analyze this peptide for HD exchange rates was not of concern.
Several peptides from antigen were observed to have a significantly reduced rate of exchange of protons for deuterons in the presence of Fab than in its absence, suggesting that at least some residues from these peptides are in direct contact with the Fab and constitute a conformational epitope (Figure 2). Although the two peptides showing protection from solvent are far apart in the primary sequence (underlined, bold print in Figure 2, they are proximal in the three-dimensional structure of PD-L1 and constitute each a single binding patch on the surface of the antigen (see Figure 3).
In summary, HD exchange identified two peptides
(i) residues 36-48 in Figure 2 (extracellular domain plus His tag, SEQ ID NO:29), corresponding to residues 54-66 of the full length sequence (SEQ ID NO:28)
(ii) residues 94-104 in Figure 2 (SEQ ID NO:29), corresponding to residues 112- 122 SEQ ID NO:28
that form a conformational epitope on PD-L1 and that contains the functional epitope of A09-246-2. b) Mutagenesis
To obtain a finer, residue-level mapping of the epitope and to complement the HD exchange data, molecular modelling and manual inspection of the crystal structure of PD-L1 (Lin, D.Y.-W. era/. PNAS 105, 3011-6 (2008; PDB record 3BIK) was used to select solvent exposed residues within and around the epitope identified by HD exchange. The selected residues were mutated either to alanine (large to small) or to another, potentially more disruptive amino acid (small to large).
In total, 48 point mutants were designed, expressed and purified from HEK cells, and tested for binding to A09-246-2 using surface plasmon resonance (SPR). Binding hotspots, or residues that contribute most to the binding energy (Wells. J.A., PNAS 93, 1-6, 1996), were identified as those that did not meet a threshold binding signal at 100 nM antigen. Furthermore, the affinity of the antibody for wild-type and each mutant was determined and used to calculate the contribution of each epitope residue to the binding energy.
The results are summarized in the table below, where 48 point mutants of PD-L1 were compared to wild-type PD-L1 antigen for antibody binding. SPR (Biacore) was used to perform a kinetic study allowing determination of kinetic rate constants (ka and kd). Briefly, goat polyclonal anti-human Fc antibody was chemically coupled to a CM5 chip. A11-128 was injected next and captured by the polyclonal. Buffer was used to wash out unbound antibody until the baseline RU stabilized. Antigen (wild- type or mutant PD-L1) was next injected at a fixed concentration for 3 minutes and the association was recorded. Buffer was injected for a further 3 minutes and dissociation was observed. The antigens were injected at concentrations of 100 nM, 50 nM, 25 nM, 12.5 nM and 6.25 nM (except for Y56 and D61 mutants, which were injected at 1 uM, 500 nM, 250 nM, 125 nM and 62.5 nM). Between each cycle, the chip was regenerated with low pH buffer and fresh A09-246-2 was captured prior to injecting the next concentration of antigen.The rate constants were determined by iterative fitting of the data to a 1 :1 binding model by an algorithm that minimizes Chi- squared. The equilibrium dissociation constant (KD) was calculated as the ratio of the kinetic constants and the change in the Gibbs free energy of binding of mutant relative to wild-type PD-L1 (AAGmut) was derived from the ratio of the wild-type and mutant KD S. The free energy changes are highlighted according to destabilization of antibody-antigen binding; "**": >3 kcal/mol destabilization (binding hotspots); "*": > 0.7 kcal/mol. Mutants at Y56 had such a low affinity that the KD could be accurately measured and the minimum KD is given instead. For D61A no binding could be found. According to this analysis, amino acids marked with "**" or "*" are part of the functional epitope. The temperature midpoint of fluorescently monitored thermal denaturation is given for the wild type and mutant proteins. ND: Not Determined; BP: Biphasic. The qualitative appearance of the wild type and mutant proteins on size exclusion chromatography (SEC) is also given. M: monodisperse and the same elution volume as wild type; M/T: peak at the same elution volume as wild type but with an additional tail. For KD and T1 2, the mean and standard deviation is given where n > 1.
Figure imgf000059_0001
115A 0.97* 2.79 +/- 0.17 51.4 +/- 0.1 M
S117A -0.60 0.20 +/- 0.04 52.7 +/- 0.3 M
A121 R -0.10 0.46 +/- 0.20 54.0 +/- 0.5 M
D122A -0.13 0.44 +/- 0.02 ND M
Y123A 0.40 1.07 +/- 0.05 ND M
K124A 0.10 0.65 +/- 0.09 53.1 +/- 0.6 M
R125A 0.41 1.09 +/- 0.04 51.8 +/- 0.2
T127 -0.25 0.36 +/- 0.01 54.0 M
T127A -0.13 0.44 +/- 0.03 51.4 +/- 0.0 M
K129A -0.21 0.38 +/- 0.18 50.8 +/- 1.2 M
It was important to confirm that the lack of binding to A09-246-2 of the Y56A, Y56K and D61 A point mutants was indeed due to loss of hotspot residues and not to global unfolding of the antigen. The structural integrity of the mutated proteins was confirmed using a fluorescence monitored thermal unfolding assay in which the protein is incubated with a dye that is quenched in aqueous solution but fluoresces when bound by exposed hydrophobic residues. As the temperature increases, thermal denaturation of the protein exposes the hydrophobic core residues and this can be monitored by an increase in fluorescence of the dye. Mutants of Y56 or D61 all display a two state transition similar to wild-type PD-L1 , indicating a folded structure at room temperature. The data were fit to equation 1 (adapted from Bullock, A. N. et al. Thermodynamic stability of wild-type and mutant p53 core domain. PNAS 94, 14338-14342 (1997)) to determine the temperature at the inflection point of the curve (T 1/2).
Equation 1:
Figure imgf000060_0001
Mutants of Y56 and D61 displayed minimal destabilization of the antigen indicated by a small decrease in the TV2 of fluorescence monitored unfolding (table above). This confirms that Y56 and D61 are true binding hotspots for A09-246-2. The structural integrity of most of the other mutant proteins was also confirmed by this method (table above). The observation that most mutant proteins behaved similarly to wild type on analytical size exclusion chromatography (last column in the above table) provides further support for native structure of mutant antigen proteins. 3.6 Binding to Tumor Cells and Primary Cells
The binding of A09-246-2 to PD-L1 on the surface of tumor cells as well as on primary human and experimental animal cells was confirmed by a FACS assay. A09- 246-2 demonstrated reactivity to human PD-L1 on all seven tested human tumor lines (A431 , epithelial carcinoma cell line; A549, lung adenocarcinoma epithelial cells; BxPC3, pancreatic cancer cells; HCT116, colorectal carcinoma; M24, melanoma cell lines; PC3mm2, prostate cancer cell line; U-87 MG, glioblastoma- astrocytoma) of which PD-L1 was up-regulated by interferon treatment to enable detection. Because primary PBMC have low levels of PD-L1 expression which is difficult to be detected, human PBMC or PBMC from dog, rabbit and rat were all subjected to PHA stimulation for 2 days. A09-246-2 demonstrated reactivity to PD-L1 on human and animal primary cells.
3.7 EC50 Measured by Direct FACS Binding Assay
The dose dependent binding ability of A09-246-2 to the target on the cell surface was confirmed by FACS. A09-246-2 efficiently binds to human PD-L1 expressed on the HEK cell surface with an EC50 of 0.3 ± 0.02nM (0.04 ± 0.003 Mg/ml); to cynomolgus monkey expressed on the HEK cell surface with an EC50 of 0.94 ± 0.015nM (0.14 ± 0.002 μg/ml); to mouse PD-L1 expressed on the HEK293 cell surface with an EC50 of 0.34 ± 0.08 nM (0.05 ± 0.012 μg/ml) and mouse PD-L1 expressed on the EL4 cell surface with an EC50 of 0.91 ± 0.21 nM (0.13 ± 0.03 μg/ml). The assays qualitatively described the dose dependent binding characteristics of anti-PD-L1.
3.8 Activity in cellular assays
Currently there is no scientific evidence that the engagement of PD-L1 with it ligands transduces stimulatory signalling through PD-L1 into the PD-L1 expressing cells, therefore the developed assays employed T cell activation in the procedures. The ability of anti-PD-L1 antibody to enhance T cell immuno-responses was measured in vitro in cellular assays using murine T cells or human PBMC. a) OT-1 Assay
Antigen-specific CD8 T cells were generated by stimulating splenocytes from OT-1 transgenic mice with Ova peptide SIINFEKL and cyropreserved. mPD-L1 over- expressing EL4 cells were used as antigen presenting cells. Serial dilutions of tested compounds were incubated with thawed OT-1 T cells and SIINFEKL-loaded APC for 48 hours. IFN-γ in the supernatant was measured using mlFN^y ELISA. Anti-PD-L1 (A09-246-2) efficiently enhanced T cell activities represented by IFN-γ production with an EC50 of 0.28 ± 0.1 nM (0.04 ± 0.015 μg/ml) b) SEA Assay
During the human PBMC assay development, it could be demonstrated that only anti-PD-L1 treatment did not trigger IL-2 or IFN-γ production in the absence of T cell activation and did not enhance IL-2 production in the presence of optimal activation either. The ability of anti-PD-L1 to enhance IL-2 production by T cells responding to super antigen activation was assessed. Super antigen such as Staphylococcal enterotoxin A (SEA) is able to crosslink the T cell receptor (TCR) and MHC class II to activate CD4 T cells. The dose dependent activity of A09-246-2 to enhance T cell functions was assessed upon such activation. Serial dilutions of A09-246-2 were incubated with human PBMC in the presence of SEA for 96 hours. Human IL-2 in the supernatant was measured using human IL-2 ELISA. Results indicated anti-PD-L1 efficiently enhanced T cell activities represented by IL-2 production with an EC50 of 0.08 ±0.03 nM (0.012 ± 0.005 μg/ml)
3.9 Antibody dependent cell-mediated Cytotoxicity (ADCC)
ADCC was measured utilizing two different human tumor lines A431 and A549 as target cells and human PBMC as effector cells. In some cases, tests were performed using target cells following stimulation with Interferon-gamma to increase the expression of PD-L1. The anti-EGFR antibody, cetuximab, was used as an ADCC positive control. Given the fact that the Fcyllla receptor 158V allotype displays a higher affinity for human lgG1 and increases ADCC, the observed results were correlated with the donor's allotype.
ADCC activity of A09-246-2 was comparable to that mediated with the anti-EGFR antibody cetuximab, inducing approximately 50% of maximum lysis in both cell lines. INF-γ treatment did not alter the response of A431 cells for all the different allotypes tested (VA , V/F and F/F). A significant difference (almost twice) between stimulated and not stimulated cells was observed when A549 cells were employed for PBMC from V V and V/F donors. No ADCC was observed when PBMC from F/F donors were analyzed with A549 cells.
4. In vivo Activity
In the studies presented here, the efficacy of PD-L1 antibody (Ab) blockade against various murine tumor models was investigated. Inhibition of the PD-1/PD-L1 interaction is proposed to exert a therapeutic effect by restoring anti-tumor CD8+ T cell responses, thus all of the preclinical efficacy studies were conducted in syngeneic murine tumor models in which the immune system of the host is fully intact. To circumvent the need for a surrogate antibody, the the antibody used in the studies was specifically selected for cross-reactivity to murine PD-L1. However, because the antibody is fully human, neutralizing immunogenicity is elicited in mice, which limits the effective dosing window to a seven day period. Despite this significant dosing limitation, the selected antibody has demonstrated significant activity as a monotherapy and in various combination therapy settings. The antitumor activity of the anti-PD-L1 antibody demonstrated a dose-dependent trend when given as a monotherapy against MC38 tumors.
Immunohistochemical analysis of PD-L1 expression within responsive and non- responsive tumor models revealed a strong link between the level of PD-L1 expression and the level of anti-tumor efficacy. To confirm the proposed mechanism of action (MOA), a study was conducted in MC38 tumor bearing mice that were systemically depleted of CD8+ T cells. In animals depleted of CD8+ T cells, the efficacy of anti-PD-L1 therapy was completely abrogated, confirming that cytotoxic T lymphocyte (CTL) effector function is responsible for the inhibition of tumor growth. To evaluate the combination potential of anti-PD-L1 therapy, combination partners were selected known to elicit anti-tumor T cell responses or otherwise enhance the effects of immunotherapy. In combination with fractionated radiotherapy against MC38 tumors, the anti-PD-L1 antibody showed strong synergistic activity, with curative potential. Combination with a single low-dose of cyclophosphamide resulted in enhanced anti-tumor effects in the MC-38 model that were associated with an increased frequency of tumor-antigen specific CD8+ T cells. Anti-PD-L1 therapy significantly extended survival time when combined with Gemcitabine in the PANC02 orthotopic tumor model of pancreatic cancer. When anti-PD-L1 was combined with cyclophosphamide pre-treatment followed by vaccination with Stimuvax, a significant increase in tumor growth inhibition was achieved in both the MC38/MUC1 and PANC02/MUC1 tumor models. Significantly enhanced efficacy was also observed when the anti-PD-L1 antibody was combined with the core components of the FOLFOX chemotherapy regimen. Thus, several promising combination approaches for anti-PD-L1 therapy were successfully identified, including three "standard of care" treatment regimens (radiation therapy; FOLFOX; Gemcitabine).
Mechanistic data derived from these studies demonstrated that anti-PD-L1 therapy is consistently associated with increased percentages of CD8+ T cells, CD8+ T effector memory cells, and PD-1+CD8+ T cells in the spleens and tumors of treated mice.
4.1 Dose-response in MC38 tumor model and combination with CPA
In this study, mice were inoculated subcutaneously in the right flank with 1x106 MC38 colon carcinoma cells. When tumors reached a mean volume of -50 mm3, mice were sorted into treatment groups (N=14) (defined as study day 0). Groups were administered A09-246-2 intravenously at dose levels of 100, 200, 400, or 800 pg on days 0, 3, and 6. A control group was treated with 200 pg of an inactive isotype antibody. Tumors were measured twice weekly for the study duration. All treatment groups demonstrated significant efficacy (P <0.050) when compared to the isotype control group. Although the 800 pg dose group did not show enhanced efficacy over the 400 pg group, a significant trend toward a dose-dependent effect was observed. In a second dose-response study that followed the same design, a general trend toward dose-dependent activity was again observed. However, the 800 pg dose group in that particular study showed significantly lower anti-tumor activity than did the 400 pg dose group. The lack of increased efficacy at doses above 400 pg may indicate an efficacy plateau as a result of target saturation, or a stronger
immunogenic effect may occur at higher doses, resulting in lower drug exposure. Additionally, these studies explored the efficacy of anti-PD-L1 in combination with pre-treatment with a low, immunomodulatory dose of cyclophosphamide (CPA). The CPA combination was observed to significantly improve the efficacy of low doses of anti-PD-L1 (100 pg), and this effect was associated with increased frequencies of p15E tumor antigen-specific CD8+ T cells as determined by ELISPOT.
Immunophenotyping data from these studies revealed that anti-PD-L1 therapy is associated with significantly increased percentages of various CD8+ T cell subsets in spleens: total CD8+ T cells, p15E tumor antigen-specific CD8+ T cells, PD-1+CD8+ T cells, and CD8+ T effector memory (TEM) and CD8+ T central memory (TC ) cells. Increased intratumoral accumulation of CD8+ T cells and CD8+ TE cells was also observed. These observations support htat anti-PD-L1 therapy as an effective strategy for driving anti-tumor CD8+ T cell responses.
4.2 Efficacy in C1498/GFP disseminated leukemia model
To create the disseminated leukemia model, C4198-GFP leukemia cells (2x104) were injected i.v. into C57BL/6 mice on day 0. Mice were then randomized into treatment groups (N=5) that received either a 400 pg dose of anti-PD-L1 Ab (A09-246-2) or an equivalent dose of an inactive isotype antibody on days 1, 4, and 7 by i.p. injection. The primary endpoint of this study was survival based on the onset of clinical signs, indicative of metastatic dissemination, which warranted euthanasia. At the end of the study (day 76), 20% of mice (1/5) were still alive in the isotype antibody treated group, and 80% (4/5) survivors remained in the A09-246-2 treated group.
4.3 Combination with Gemcitabine in the PANC02 orthotopic model
Three separate studies were conducted to investigate the combination of the anti- PD-L1 MAb (A09-246-2) and Gemcitabine (GEM). The studies were designed to explore the positioning of anti-PD-L1 therapy within the chemotherapy "holiday" period of a 21 day or 28 day cycle of GEM. Orthotopic models involve the inoculation of tumor cells into the organ of origin, resulting in a close recapitulation of disease progression as it occurs in the human setting. To create a model of pancreatic adenocarcinoma, PANC02 cells (1x106) were injected into the pancreas of C57BU6 female mice. Five days later, mice were randomized into treatment groups. GEM was dosed at 150 mg/kg in all studies and A09-246-2 was dosed at 400 pg per mouse. In two studies, a 28 day cycle of GEM was modeled (administration on days 5, 19, 26), with a 14 day holiday period during which A09-246-2 was given on days 8, 11, 14. In a third study, a 21 day cycle of GEM was modeled (administration on days 5, 12, 26, 33), with a 14 day holiday period during which A09-246-2 was given on days 13, 16, 19. Monotherapy with GEM or anti-PD-L1 failed to extend survival time in this model. However, in all three studies, the combination of GEM and A09-246-2 significantly extended mean survival time (P <0.02). Immunophenotyping revealed several effects in groups receiving A09-246-2, both as a monotherapy and in combination with GEM, that were consistent with the proposed MOA of anti-PD-L1 including increased percentages of CD8+ TEM in spleens, an increased ratio of splenic CD8+ TEM to TREG cells, and increased percentages of splenic PD-1+CD8+ T cells. Furthermore, immunophenotyping of tumor infiltrating lymphocytes (TIL) showed significantly increased percentages of CD8+ TIL in the combination group.
4.4 Combination with low dose cyclophosphamide (CPA)
Low-dose CPA is known to enhance anti-tumor immune responses through the inhibition of immunosuppressive regulatory T cells. The potential for low-dose CPA pre-treatment was investigated to enhance the efficacy of the anti-PD-L1 Ab (A09- 246-2) in the MC38 subcutaneous tumor model. Mice were inoculated
subcutaneously in the right flank with 1x106 MC38 colon carcinoma cells. When tumors reached a mean volume of ~50 mm3, mice were sorted into treatment groups (N=14) on day 0. The combination group received 100 pg of A09-246-2 by i.v.
injection on days 0, 3, and 6, with or without pre-treatment with a 100 mg/kg dose of CPA delivered i.v. on day -1. A control treatment group received 100 pg of an inactive isotype antibody in combination with CPA pretreatment. The combination treatment group demonstrated a statistically significant enhancement (p <0.050) of anti-tumor activity when compared against the isotype and monotherapy control groups. Using an ELISPOT assay, the effects of treatment on the magnitude of CD8+ T cell responses directed against the well-characterized p15E tumor antigen were measured. Both CPA and A09-246-2 showed substantially increased levels of p15E- reactive CD8+T cells (~100 spots in both groups) when compared to the isotype control (-25 spots), with the combination group showing a further enhancement (-250 spots). Thus, the anti-tumor efficacy of the CPA plus A09-246-2 combination was associated with increased frequencies of tumor-antigen reactive CTL.
4.5 Combination with Cyclophosphamide/Stimuvax
The ability of PD-L1 blockade to restore anti-tumor T cell responses provides a strong rationale for combination with cancer vaccines. Stimuvax is a vaccine against the human MUC1 antigen, which is commonly overexpressed by solid tumors. Mice transgenic for the human MUC1 protein (MUCl .tg mice) are immunologically tolerant of the antigen, and, when inoculated with murine tumors that also express human MUC1, provide a relevant model of the clinical vaccination setting. In the clinic, cyclophosphamide (CPA) pre-treatment is used in combination with Stimuvax as a strategy for transiently depleting immunosuppressive Treg cells that can inhibit the vaccine response.
In this study, UCI.tg mice were inoculated subcutaneously in the right rear flank with 1x106 MC38/ UC1 colon carcinoma cells. Five days after tumor cell inoculation, mice were randomized into treatment groups (N=10) on day -3. On day -3, a 100 mg/kg dose of CPA was administered by i.v. administration. Vaccination was initiated on day 0 and was repeated weekly. Anti-PD-L1 Ab (A09-246-2) was dosed by i.p. injection on days 0, 3, and 6. Tumors were measured twice weekly. The combination of CPA/Stimuvax and A09-246-2 demonstrated significantly enhanced (p <0.050) tumor growth inhibition when compared against treatment with CPA/Stimuvax.
In a second study, 1x106 PANC02/MUC1 cells were inoculated into the pancreas of MUCI.tg mice. Four days later, mice were randomized into groups (N=8) and treatment was initiated. The same treatment schedule was applied as for the first study. The combination of CPA/Stimuvax and anti-PD-L1 (A09-246-2) significantly increased mean survival time (MST) when compared against treatment with
CPA/Stimuvax (MST of 43.5 days vs. 70 days, P = 0.0001). Immunophenotyping by FACS showed a significant trend towards increased percentages of CD8+ TE and CD8+ TCM in the combination group.
4.6 Combination with fractionated radiotherapy
Radiotherapy (RT) has been demonstrated to enhance the immunogenicity of tumor cells, through increased expression of MHC class I and diversification of the intracellular peptide pool. To test anti-PD-L1 antibody treatment in combination with radiotherapy, MC38 colon carcinoma cells (1x105) were inoculated intramuscularly into the right quadriceps of C57BL/6 female mice. When tumors reached a mean volume of 150 mm3, mice were sorted into treatment groups (N=8) on day 0. The tumor-bearing legs were isolated and treated with 360 cGy of gamma irradiation from a cesium-137 source on days 0, 1, 2, 3, and 4 (total dose of 1800 cGy). Anti-PD-L1 Ab (A09-246-2) was dosed i.v. at 400 pg on days 3, 6, and 9. The A09-246-2 and radiotherapy combination resulted in a high rate of tumor regressions, ultimately leading to 6/10 complete responses (CR). Mice with CR were re-challenged by inoculation of MC38 tumor cells, and 3/6 mice remained tumor-free seventy-four days after the re-challenge, indicating that effective immune memory was generated by the combination therapy. Conversely, a control group treated with an isotype control antibody in combination with radiation showed significant tumor growth inhibition, but did not induce regressions.
A repeat of the RT and anti-PD-L1 (A09-246-2) combination study was performed, with the inclusion of a second combination therapy group in which the mice were systemically depleted of CD8+ T cells. Additional immunological readouts measured in this study included FACS-based immunophenotyping of splenocytes, in vivo proliferation analysis, and ELISPOT assay. Again, the combination demonstrated synergistic efficacy that induced an initial phase of regression or stasis in all of the tumors. However, complete regression was only observed in 1/8 mice, with one other mouse experiencing a prolonged period of tumor stasis. Depletion of CD8+ T cells completely abrogated the synergy of the combination, confirming that the mechanism involves the stimulation of anti-tumor CD8+ T cell responses. This observation was further supported by increased frequencies of CD8+ T cells reactive to the p15E tumor antigen. Immunophenotyping by FACS revealed increased percentages of CD8+ T cell proliferation in spleens, and increased splenic percentages of CD8+ TEM and CD8+ TCM-
4.7 Combination with core components of the FOLFOX regimen
FOLFOX is a combination chemotherapy regimen, consisting of folinic acid, 5- fluorouracil (5-FU), and oxaliplatin (OX), used in the treatment of stage III colorectal cancer. The potential for combining anti-PD-L1 with the core components of
FOLFOX (5-fluorouracil and oxaliplatin) in the subcutaneous MC38 colon carcinoma model were studied. Mice were inoculated in the right subcutaneous flank with 1x106 MC38 colon carcinoma cells. When tumors reached a mean volume of -50 mm3, mice were sorted into treatment groups (N=10) on day 0. 5-FU (60 mg/kg i.v.) and OX (5 mg/kg i.p.) were administered on days 0 and 14. Anti-PD-L1 Ab (A09-246-2) (400 pg i.v.) was given on days 3, 6, and 9. The combination treatment was observed to have significantly greater efficacy (p <0.050) when compared to A09-246-2 given alone, or 5-FU and OX given in combination with an isotype antibody. A repeat of the anti-PD-L1 Ab and FOLFOX combination study was performed and, again, the combination demonstrated significantly greater (p <0.050) anti-tumor activity than either of the monotherapy regimens. FACS-based immunophenotyping conducted in these studies revealed increases in several immunological markers consistent with a CD8+ T cell driven MOA, including increased splenic levels of p15E tumor antigen specific CD8+ T cells, an increase in the splenic ratio of TEM to regulatory T cells (Treg), and increased splenic percentages of CD8+PD-1+ T cells. Furthermore, the percentage of tumor infiltrating natural killer (NK) cells and CD8+ T cells was observed to increase significantly in the combination group.
4.84-week repeat dose pilot toxicity study in cynomolgus monkey
Four groups of 2 male and 2 female cynomolgus monkeys were treated with anti human PD-L1 (A09-246-2) at dose levels of 0 (vehicle), 20, 60 and 140 mg/kg by weekly intravenous infusion for total of 5 administrations.
The TK evaluation indicates that all animals were exposed to the test material throughout the study. The exposure levels increased roughly proportionally to dose increasing at both 1st and 4th dose, without any relevant accumulation or gender- dependency at any dose. Anti drug antibody were detected in 2/4 and 1/4 monkeys at 20 and 140 mg/kg levels respectively. There was no premature animal death in the study. No treatment related changes were noted in the 20 and 60 mg/kg dosing groups for all parameters evaluated in the study.
At the high dose level of 140 mg/kg, treatment related findings include slight decrease of lymphocytes in haematology testing, slight decrease in lymphocyte count together with a decrease in NK cell count on study day 30. There were no significant histological changes in major organs/tissues except moderate perivascular hemorrhage and inflammation/vessel necrosis observed at local injection site at the 140 mg/kg. There was no clear trend or change observed in multicytokine analysis at this dose level. Based on the results from this study the No Observable Adverse Effect Level (NOAEL) was identified as 140 mg/kg.
Conclusion: A09-246-2 was tolerated in cynomolgus monkey at dose levels up to 140 mg/kg after receiving a total of 5 consecutive weekly doses. Injection site reactions with moderate severity of subcutaneous/perivascular and vascular inflammatory and degenerative changes were observed at 140 mg/kg.

Claims

Patent Claims
1. An isolated heavy chain variable region polypeptide comprising an HVR-H1 , HVR- H2 and HVR-H3 sequence, wherein:
(a) the HVR-H1 sequence is X1YX2MX3 (SEQ ID NO:1);
(b) the HVR-H2 sequence is SIYPSGGX4TFYADX5VKG (SEQ ID NO:2);
(c) the HVR-H3 sequence is IKLGTVTTVX6Y (SEQ ID NO:3);
further wherein: X is K, R, T, Q, G, A, W, M, I or S; X2 is V, R, K, L, or I; X3 is H, T, N, Q, A, V, Y, W, F or M; X4 is F or I; X5 is S or T; Xe is E or D.
2. The polypeptide of Claim 1 wherein Xi is M, I or S; X2 is R, K, L, M or I; X3 is F or M; X4 is F or I; X5 is S or T; Xe is E or D.
3. The polypeptide of Claim 1 wherein Xi is M, I or S; X2 is L, or I; X3 is F or M; X4 is l; X5 is S or T; X6 is D.
4. The polypeptide of Claim 1 wherein Xi is S; X2 is I; X3 is M; X4 is I; X5 is T; X<5 is D.
5. The polypeptide of any of Claims 1-4 further comprising variable region heavy chain framework sequences HC-FR1 , HC-FR2, HC-FR3 and HC-FR4, juxtaposed between the HVRs, thus forming the sequence of the formula: (HC-FR1)-(HVR-H1)- (HC-FR2)-(HVR-H2)-(HC-FR3)-(HVR-H3)-(HC-FR4).
6. The polypeptide of Claim 5 wherein the framework sequences are derived from human consensus framework sequences.
7. The polypeptide of Claim 5 wherein the framework sequences are derived from human germline framework sequences.
8. The polypeptide of Claim 5 wherein one or more of the framework sequences is the following:
HC-FR1 is EVQLLESGGGLVQPGGSLRLSCAASGFTFS (SEQ ID NO:4);
HC-FR2 is WVRQAPGKGLEWVS (SEQ ID NO:5);
HC-FR3 is RFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR (SEQ ID NO:6); HC-FR4 is WGQGTLVTVSS (SEQ ID NO:7).
9. The polypeptide of Claim 8 further comprising at least a CH1 domain.
10. The polypeptide of Claim 9 further comprising a CH1 , a CH2 and a CH3 domain.
11. The isolated heavy chain polypeptide of any of Claims 1-10 in combination with a variable region light chain comprising an HVR-L1, HVR-L2 and HVR-L3, wherein: (a) the HVR-L1 sequence is TGTX7X8DVGX9YNYVS (SEQ ID NO: 8);
(b) the HVR-L2 sequence is X10VXnXi2RPS (SEQ ID NO: 9);
(c) the HVR-L3 sequence is SSX13TX14Xi5Xi6Xi7RV (SEQ ID NO: 10);
further wherein: X7 is N or S; Xa is T, R or S; X9 is A or G; Xi0 is E or D; Xn is I, N or
S; Xi2 is D, H or N; X13 is F or Y; X 4 is N or S; X15 is R, T or S; X16 is G or S; Xi7 is I or T.
12. The polypeptide of Claim 11 wherein X7 is N or S; Xe is T, R or S; Xg is A or G; X10 is E or D; X is N or S; Xi2 is N; X13 is F or Y; XM is S; Xi5 is S; Xi6 is G or S; X17 is T.
13. The polypeptide of Claim 11 wherein X7 is S; Xa is S; X9 is G; Xi0 is D; Xn is S; Xi2 is N; X13 is Y; X is S; Xi5 is S; Xi6 is S; X17 is T.
14. The polypeptide of any of Claims 11-13 further comprising variable region light chain framework sequences LC-FR1, LC-FR2, LC-FR3 and LC-FR4, juxtaposed between the HVRs, thus forming the sequence of the formula: (LC-FR1)-(HVR-L1)- (LC-FR2HHVR-I_2)-(LC-FR3)-(HVR-L3HLC-FR4).
15. The polypeptide of Claim 14 wherein the framework sequences are derived from human consensus framework sequences.
16. The polypeptide of Claim 14 wherein the framework sequences are derived from human germline framework sequences.
17. The polypeptide of Claim 14 wherein one or more of the framework sequences is the following:
LC-FR1 is QSALTQPASVSGSPGQSITISC (SEQ ID NO: 11);
LC-FR2 is WYQQHPGKAPKL IY (SEQ ID NO: 12);
LC-FR3 is GVSNRFSGSKSGNTASLTISGLQAEDEADYYC (SEQ ID NO: 13);
LC-FR4 is FGTGTKVTVL (SEQ ID NO: 14).
18. The polypeptide of claim 17 further comprising a CL domain.
19. An isolated anti-PD-L1 antibody or antigen binding fragment thereof comprising a heavy chain and a light chain variable region sequence, wherein:
(a) the heavy chain comprises an HVR-H1 , HVR-H2 and HVR-H3, wherein further: (i) the HVR-H1 sequence is XnYX2MX3 (SEQ ID NO: 1); (ii) the HVR-H2 sequence is SIYPSGGX4TFYADX5VKG (SEQ ID NO: 2); (iii) the HVR-H3 sequence is
IKLGTVTTVXeY, and (SEQ ID NO: 3);
(b) the light chain comprises an HVR-L1 , HVR-L2 and HVR-L3, wherein further: (iv) the HVR-L1 sequence is TGTX7X8DVGX9YNYVS (SEQ ID NO: 8); (v) the HVR-L2 sequence is X10VXnXi2RPS (SEQ ID NO: 9); (vi) the HVR-L3 sequence is
Figure imgf000072_0001
wherein further: Xi is K, R, T, Q, G, A, W, M, I or S; X2 is V, R, K, L, M or I; X3 is H, T, N, Q, A, V, Y, W, F or M; X4 is F or I; X5 is S or T; Xe is E or D; X7 is N or S; Xe is T, R or S; X9 is A or G; X10 is E or D; Xu is I, N or S; X12 is D, H or N; X13 is F or Y; X is N or S; X15 is R, T or S; X16 is G or S; X17 is I or T.
20. The antibody or antibody fragment of Claim 19 wherein X^ is M, I or S; X2 is R, K, L, M or I; X3 is F or M; X4 is F or I; X5 is S or T; Xe is E or D; X7 is N or S; Xe is T, R or S; X9 is A or G; X10 is E or D; Xu is N or S; X12 is N; Xi3 is F or Y; X14 is S; X15 is S; X16 is G or S; Xi7 is T.
21. The antibody or antibody fragment of Claim 19, wherein X^ is M, I or S; X2 is L, M or I; X3 is F or M; X4 is I; X5 is S or T; X6 is D; X7 is N or S; X8 is T, R or S; X9 is A or G; X10 is E or D; X is N or S; X12 is N; X13 is F or Y; X14 is S; X15 is S; X16 is G or S;
22. The antibody or antibody fragment of Claim 19, wherein X-i is S; X2 is I; X3 is M; X4 is I; X5 is T; X6 is D; X7 is S; Xa is S; X9 is G; X 0 is D; X1† is S; X12 is N; X13 is Y; X is S; X15 is S; X16 is S; Xi7 is T.
23. The antibody or antibody fragment of any of Claims 19-22 further comprising: (a) variable region heavy chain framework sequences HC-FR1, HC-FR2, HC-FR3 and HC-FR4, juxtaposed between the HVRs, thus forming the sequence of the formula: (HC-FR1)-(HVR-H1)-(HC-FR2)-(HVR-H2)-(HC-FR3)- (HVR-H3)-(HC-FR4), and
(b) variable region light chain framework sequences LC-FR1, LC-FR2, LC-FR3 and LC-FR4, juxtaposed between the HVRs, thus forming the sequence of the formula: (LC-FR1 MHVR-L1 )-(LC-FR2)-(HVR-L2)-(LC-FR3)- (HVR-L3)-(LC-FR4).
24. The antibody or antibody fragment of Claim 23 wherein the framework sequences are derived from human consensus framework sequences.
25. The antibody or antibody fragment of Claim 23 wherein the framework sequences are derived from human germline framework sequences.
26. The antibody or antibody fragment of Claim 23 wherein one or more of the framework sequences is the following:
HC-FR1 is EVQLLESGGGLVQPGGSLRLSCAASGFTFS (SEQ ID NO:4);
HC-FR2 is WVRQAPGKGLEWVS (SEQ ID NO:5);
HC-FR3 is RFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR (SEQ ID NO:6);
HC-FR4 is WGQGTLVTVSS (SEQ ID NO:7).
27. The antibody or antibody fragment of Claim 23 wherein one or more of the framework sequences is the following:
LC-FR1 is QSALTQPASVSGSPGQSITISC (SEQ ID NO: 11);
LC-FR2 is WYQQHPGKAPKLMIY (SEQ ID NO: 12);
LC-FR3 is GVSNRFSGSKSGNTASLTISGLQAEDEADYYC; (SEQ ID NO: 13); LC-FR4 is FGTGTKVTVL (SEQ ID NO: 14).
28. The antibody or antibody fragment of Claim 23 wherein:
(a) the variable heavy chain framework sequences are the following:
(i) HC-FR1 is EVQLLESGGGLVQPGGSLRLSCAASGFTFS (SEQ ID NO:4);
(ii) HC-FR2 is WVRQAPGKGLEvWS (SEQ ID NO: 5);
(iii) HC-FR3 is RFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR (SEQ ID NO:6); (iv) HC-FR4 is WGQGTLVTVSS (SEQ ID NO: 7); and
(b) the variable light chain framework sequences are the following:
(i) LC-FR1 is QSALTQPASVSGSPGQSITISC (SEQ ID NO:11);
(ii) LC-FR2 is WYQQHPGKAPKLMIY (SEQ ID NO: 12);
(iii) LC-FR3 is GVSNRFSGSKSGNTASLTISGLQAEDEADYYC (SEQ ID NO: 13); (iv) LC-FR4 is FGTGTKVTVL (SEQ ID NO: 14).
29. The antibody or antibody fragment of Claim 28 further comprising at least a CH1 domain.
30. The antibody or antibody fragment of Claim 28 or 29 further comprising a CL domain.
31. The antibody or antibody fragment of any of Claims 28-30 further comprising a CH1 , a CH2 and a CH3 domain.
32. The antibody or antibody fragment of Claim 28 further comprising a human or murine constant region.
33. The antibody or antibody fragment of Claim 32, wherein the constant region is selected from the group consisting of lgG1, lgG2, lgG3 and lgG4.
34. The antibody or antibody fragment of Claim 33 wherein the constant region is lgG1.
35. An antibody or antigen binding fragment thereof comprising a heavy chain and a light chain variable region sequence, wherein:
(a) the heavy chain comprises an HVR-H1 , HVR-H2 and an HVR-H3, having at least 80% overall sequence identity to SYIMM (SEQ ID NO: 15), SIYPSGGITFYADTVKG (SEQ ID NO: 16) and IKLGTVTTVDY (SEQ ID NO: 17), respectively, and
(b) the light chain comprises an HVR-L1 , HVR-L2 and an HVR-L3, having at least 80% overall sequence identity to TGTSSDVGGYNYVS (SEQ ID NO: 18), DVSNRPS (SEQ ID NO: 19) and SSYTSSSTRV (SEQ ID NO: 20), respectively.
36. The antibody or antibody fragment of Claim 35, wherein the sequence identity is at least 90%.
37. The antibody or antibody fragment of Claim 35, wherein, as compared to the sequences of HVR-H1 (SEQ ID NO: 15), HVR-H2 (SEQ ID NO: 16) and HVR-H3
(SEQ ID NO: 17), at least those amino acids remain unchanged that are highlighted by underlining as follows:
(a) in HVR-H1 SYIMM (SEQ ID NO: 15),
(b) in HVR-H2 SIYPSGGITFYADTVKG (SEQ ID NO: 16),
(c) in HVR-H3 IKLGTVTTVDY (SEQ ID NO: 17);
and further wherein, as compared to the sequences of HVR-L1 (SEQ ID NO: 18), HVR-L2 (SEQ ID NO: 9) and HVR-L3 (SEQ ID NO: 20 at least those amino acids remain unchanged that are highlighted by underlining as follows:
(a) HVR-L1 TGTSSDVGGYNYVS (SEQ ID NO: 18)
(b) HVR-L2 DVSNRPS (SEQ ID NO: 19)
(c) HVR-L3 SSYTSSSTRV (SEQ ID NO: 20).
38. The antibody or antibody fragment of any of Claims 35-37 further comprising:
(a) variable region heavy chain (VH) framework sequences HC-FR1 , HC-FR2, HC- FR3 and HC-FR4, juxtaposed between the HVRs, thus forming the sequence of the formula: (HC-FR1)-(HVR-H1)-(HC-FR2)-(HVR-H2)-(HC- FR3)-(HVR-H3)-(HC-FR4), and
(b) variable region light chain (VL) framework sequences LC-FR1, LC-FR2, LC-FR3 and LC-FR4, juxtaposed between the HVRs, thus forming the sequence of the formulat: (LC-FR1)-(HVR-L1)-(LC-FR2)-(HVR-L2)-(LC-FR3)- (HVR-L3)-(LC-FR4).
39. The antibody or antibody fragment of Claim 38, wherein the VH and VL framework sequences are derived from human germline sequences.
40. The antibody or antibody fragment of Claim 38 wherein the VH framework sequences are the following:
HC-FR1 is EVQLLESGGGLVQPGGSLRLSCAASGFTFS (SEQ ID NO:4);
HC-FR2 is WVRQAPGKGLEWVS (SEQ ID NO: 5);
HC-FR3 is RFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR (SEQ ID NO:6);
HC-FR4 is WGQGTLVTVSS (SEQ ID NO: 7).
41. The antibody or antibody fragment of Claim 38 wherein the VL framework sequences are the following:
LC-FR1 is QSALTQPASVSGSPGQSITISC (SEQ ID NO:11);
LC-FR2 is WYQQHPGKAPKLMIY (SEQ ID NO: 12);
LC-FR3 is GVSNRFSGSKSGNTASLTISGLQAEDEADYYC (SEQ ID NO: 13);
LC-FR4 is FGTGTKVTVL (SEQ ID NO: 14).
42. An isolated anti-PD-L1 antibody or antigen binding fragment thereof comprising a heavy chain variable region sequence and a light chain variable region sequence, wherein:
(a) the heavy chain sequence has at least 85% sequence identity to the heavy chain sequence:
EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYI MWVRQAPGKGLEWVSSIYPSG GITFYAD KGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARIKLGTVTTVDYWGQ GTLVTVSS (SEQ ID NO: 24), and
(b) the light chain sequence has at least 85% sequence identity to the light chain sequence:
QSALTQPASVSGSPGQSITISCTGTSSDVGGYNYVSWYQQHPGKAPKLMIYDVSN RPSGVSNRFSGSKSGNTASLTISGLQAEDEADYYCSSYTSSSTRVFGTGTKVTVL
(SEQ ID NO: 25).
43. The antibody or antigen binding fragment of Claim 42, wherein the sequence identity is at least 90%.
44. An isolated anti-PD-L1 antibody or antigen binding fragment thereof comprising a heavy chain variable region sequence and light chain variable region sequence, wherein: (a) the heavy chain comprises the sequence:
EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYIMMWVRQAPGKGLEWVSSIYPSG GITFYAD KGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARIKLGTVTTVDYWGQ GTLVTVSS (SEQ ID NO: 24), and
(b) the light chain comprises the sequence:
QSALTQPASVSGSPGQSITISCTGTSSDVGGYNYVSWYQQHPGKAPKLMIYDVSN RPSGVSNRFSGSKSGNTASLTISGLQAEDEADYYCSSYTSSSTRVFGTGTKVTVL
(SEQ ID NO: 25).
45. The antibody of Claim 44 wherein the antibody further comprises a CH1 , a CH2, a CH3 and a CL domain.
46. The antibody of any of Claims 19-45 wherein the antibody binds to human, mouse or cynomolgus monkey PD-L1.
47. The antibody of any of Claims 19-46 wherein the antibody is capable of blocking the interaction between human, mouse or cynomolgus monkey PD-L1 and the respective human, mouse or cynomolgus monkey PD-1 receptors.
48. The antibody of any of Claims 19-47 wherein the antibody binds to human PD-L1 with a KD of 5x10"9 M or less.
49. An isolated anti-PD-L1 antibody or antigen binding fragment thereof which binds to a functional epitope comprising residues Y56 and D61 of human PD-L1 (SEQ ID NO:28).
50. The isolated anti-PD-L1 antibody or antigen binding fragment of claim 49 wherein the functional epitope further comprises residues E58, E60, Q66, R113 and M115 of human PD-L1 (SEQ ID NO:28).
51. An isolated anti-PD-L1 antibody or antigen binding fragment thereof which binds to a conformational epitope comprising residues 54-66 and 112-122 of human PD-L1 (SEQ ID NO:28).
52. An isolated anti-PD-L1 antibody or antigen binding fragment thereof wherein the antibody cross-competes for binding to PD-L1 with an antibody or antigen binding fragment of any of Claims 19-51.
53. A composition comprising the anti-PD-L1 antibody or antigen binding fragment of any of Claims 19-52 and at least one pharmaceutically acceptable carrier.
54. An isolated nucleic acid encoding the polypeptide of any of Claims 1-18.
55. An isolated nucleic acid encoding the light chain or a heavy chain sequence of an anti-PD-L1 antibody or antigen binding fragment of any of Claims 19-52.
56. An isolated nucleic acid encoding a light chain or a heavy chain variable sequence of an anti-PD-L1 antibody or antigen binding fragment, wherein:
(a) the heavy chain comprises an HVR-H1 , HVR-H2 and an HVR-H3 sequence having at least 80% sequence identity to SYIMM (SEQ ID NO: 15),
SIYPSGGITFYADTVKG (SEQ ID NO. 16) and IKLGTVTTVDY (SEQ ID NO: 17), respectively, or
(b) the light chain comprises an HVR-L1 , HVR-L2 and an HVR-L3 sequence having at least 80% sequence identity to TGTSSDVGGYNYVS (SEQ ID NO: 18),
DVSNRPS (SEQ ID NO: 19) and SSYTSSSTRV (SEQ ID NO: 20), respectively.
57. The nucleic acid of Claim 56, wherein sequence identity is at least 90%.
58. The nucleic acid of Claim 56 or 57, wherein the anti-PD-L1 antibody further comprises a VL and a VH framework region derived from a human germline sequence.
59. The nucleic acid of any of Claims 55-57, wherein the anti-PD-L1 antibody comprises a constant region derived from a human or murine antibody.
60. The nucleic acid of Claim 59, wherein the constant region is lgG1.
61. The nucleic acid of Claim 60, which is SEQ ID NO: 30 for the heavy chain, and SEQ ID NO: 31 for the light chain.
62. A vector comprising the nucleic acid of any of claims 54-61.
63. A host cell comprising the vector of Claim 62.
64. The host cell of Claim 63 which is eukaryotic.
65. The host cell of Claim 63 which is mammalian.
66. The host cell of Claim 65 which is a Chinese Hamster Ovary (CHO) cell.
67. The host cell of Claim 63 which is prokaryotic.
68. The host cell of Claim 67 which is E. coli.
69. A process for making an anti-PD-L1 antibody or antigen binding fragment thereof comprising culturing the host cell of any of Claims 63-68 under conditions suitable for the expression of the vector encoding the anti-PD-L1 antibody or antigen binding fragment, and recovering the antibody or fragment.
70. A kit of parts comprising the composition of Claim 53 and at least one further therapeutic agent or vaccine.
71. A kit of parts according to Claim 70, wherein the further therapeutic agent is a chemotherapeutic agent.
72. The kit of parts according to Claim 71, wherein the chemotherapeutic agent is gemcitabine.
73. A kit of parts according to Claim 71 , wherein the chemotherapeutic agent is cyclophosphamide.
74. A kit of parts according to Claim 71, wherein the chemotherapeutic agents are 5- fluorouracil and oxaliplatin.
75. The kit of parts according to Claim 70, wherein the further therapeutic agent is cyclophosphamide and the vaccine is Stimuvax.
76. A method of treating cancer comprising administering to a subject in need thereof an effective amount of an anti-PD-L1 antibody which induces antibody dependent cell-mediated cytotoxicity (ADCC).
77. The method of Claim 76 wherein the constant region of the anti-PD-L1 antibody is lgG1.
78. The method of Claim 77 wherein the anti-PD-L1 antibody is an antibody of any of Claims 19-52.
79. A method of treating cancer comprising administering to a subject in need thereof an effective amount of the composition of Claim 53.
80. The method of any of Claims 76 - 79 wherein the cancer is selected from the group consisting of: breast, lung, colon, ovarian, melanoma, bladder, kidney, liver, salivary, stomach, gliomas, thyroid, thymic, epithelial, head and neck cancers, gastric and pancreatic cancer.
81. A method of enhancing T-cell function comprising administration of an effective amount of the composition of Claim 53 to a dysfunctional T-cell.
82. A method of treating a T-cell dysfunctional disorder comprising administering a therapeutically effective amount of the composition of Claim 53 to a patient suffering from a T-cell dysfunctional disorder.
83. The method of Claim 82, wherein the T-cell dysfunctional disorder is tumor immunity.
84. The method of Claim 83, wherein the tumor immunity results from a cancer selected from the group consisting of: breast, lung, colon, ovarian, melanoma, bladder, kidney, liver, salivary, stomach, gliomas, thyroid, thymic, epithelial, head and neck cancers, gastric and pancreatic cancer.
85. The method of any of Claims 76 - 84, further comprising the administration of at least one further therapeutic agent or vaccine.
86. The method of Claim 85, wherein the further therapeutic agent is a
chemotherapeutic agent.
87. The method of Claim 86, wherein the chemotherapeutic agent is gemcitabine.
88. The method of Claim 86, wherein the chemotherapeutic agent is
cyclophosphamide.
89. The method of Claim 86, wherein the chemotherapeutic agents are 5-fluorouracil and oxaliplatin.
90. The method of Claim 85, wherein the further therapeutic agent is
cyclophosphamide and the vaccine is Stimuvax.
91. The method of any of Claims 76 - 90, wherein the method further comprises the application of a treatment regimen selected from the group consisting of: surgery, radiation therapy, chemotherapy, targeted therapy, immunotherapy, hormonal therapy, angiogenesis inhibiton and palliative care.
92. The method of Claim 91 , wherein the treatment regime is radiation therapy.
PCT/EP2012/004822 2011-11-28 2012-11-21 Anti-pd-l1 antibodies and uses thereof WO2013079174A1 (en)

Priority Applications (32)

Application Number Priority Date Filing Date Title
CN201280058422.3A CN103987405B (en) 2011-11-28 2012-11-21 Anti- PD L1 antibody and application thereof
EP12790432.4A EP2785375B1 (en) 2011-11-28 2012-11-21 Anti-pd-l1 antibodies and uses thereof
KR1020177021068A KR101981873B1 (en) 2011-11-28 2012-11-21 Anti-pd-l1 antibodies and uses thereof
MX2014006316A MX349096B (en) 2011-11-28 2012-11-21 Anti-pd-l1 antibodies and uses thereof.
DK12790432.4T DK2785375T3 (en) 2011-11-28 2012-11-21 ANTI-PD-L1 ANTIBODIES AND USES THEREOF
SG11201402603WA SG11201402603WA (en) 2011-11-28 2012-11-21 Anti-pd-l1 antibodies and uses thereof
SI201231849T SI2785375T1 (en) 2011-11-28 2012-11-21 Anti-pd-l1 antibodies and uses thereof
JP2014542728A JP6138813B2 (en) 2011-11-28 2012-11-21 Anti-PD-L1 antibody and use thereof
LTEP12790432.4T LT2785375T (en) 2011-11-28 2012-11-21 Anti-pd-l1 antibodies and uses thereof
US14/360,775 US9624298B2 (en) 2011-11-28 2012-11-21 Anti-PD-L1 antibodies and uses thereof
ES12790432T ES2808152T3 (en) 2011-11-28 2012-11-21 Anti-PD-L1 antibodies and their uses
EA201400625A EA036814B9 (en) 2011-11-28 2012-11-21 Anti-pd-l1 antibody (embodiments), composition comprising this antibody and use thereof
RS20201263A RS61033B1 (en) 2011-11-28 2012-11-21 Anti-pd-l1 antibodies and uses thereof
BR112014012819-7A BR112014012819B1 (en) 2011-11-28 2012-11-21 ANTI-PD-L1 ANTIBODY OR ANTIGEN BINDING FRAGMENT AND COMPOSITION
KR1020147017974A KR101764096B1 (en) 2011-11-28 2012-11-21 Anti-pd-l1 antibodies and uses thereof
EP20186754.6A EP3763741A1 (en) 2011-11-28 2012-11-21 Anti-pd-l1 antibodies and uses thereof
CA2856895A CA2856895C (en) 2011-11-28 2012-11-21 Anti-pd-l1 antibodies and uses thereof
AU2012344260A AU2012344260B2 (en) 2011-11-28 2012-11-21 Anti-PD-L1 antibodies and uses thereof
IL232778A IL232778B (en) 2011-11-28 2014-05-25 Anti-pd-l1 antibodies and uses thereof
ZA2014/04790A ZA201404790B (en) 2011-11-28 2014-06-27 Anti-pd-l1 antibodies and uses thereof
HK15101432.7A HK1200736A1 (en) 2011-11-28 2015-02-10 Anti-pd-l1 antibodies and uses thereof pd-l1
US15/454,939 US10759856B2 (en) 2011-11-28 2017-03-09 Anti-PD-L1 antibodies and uses thereof
US15/454,959 US10487147B2 (en) 2011-11-28 2017-03-09 Anti-PD-L1 antibodies and uses thereof
AU2017268603A AU2017268603B2 (en) 2011-11-28 2017-11-30 Anti-PD-L1 antibodies and uses thereof
US16/984,365 US11884724B2 (en) 2011-11-28 2020-08-04 Anti-PD-L1 antibodies and uses thereof
IL276573A IL276573A (en) 2011-11-28 2020-08-09 Anti-pd-l1 antibodies and uses thereof
HRP20201595TT HRP20201595T1 (en) 2011-11-28 2020-10-07 Anti-pd-l1 antibodies and uses thereof
CY20201100946T CY1123435T1 (en) 2011-11-28 2020-10-08 ANTI-PD-L1 ANTIBODIES AND USES THEREOF
NL301081C NL301081I2 (en) 2011-11-28 2020-12-18 Avelumab
FR20C1068C FR20C1068I2 (en) 2011-11-28 2020-12-29 ANTI-PD-L1 ANTIBODIES AND THEIR USE
LTPA2021001C LTC2785375I2 (en) 2011-11-28 2021-01-05 ANTI-PD-L1 ANTIBODIES AND THEIR USE
NO2021003C NO2021003I1 (en) 2011-11-28 2021-01-19 avelumab

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201161563903P 2011-11-28 2011-11-28
US61/563,903 2011-11-28

Related Child Applications (4)

Application Number Title Priority Date Filing Date
US14/360,775 A-371-Of-International US9624298B2 (en) 2011-11-28 2012-11-21 Anti-PD-L1 antibodies and uses thereof
US15/454,959 Division US10487147B2 (en) 2011-11-28 2017-03-09 Anti-PD-L1 antibodies and uses thereof
US15/454,939 Division US10759856B2 (en) 2011-11-28 2017-03-09 Anti-PD-L1 antibodies and uses thereof
US15/454,939 Continuation US10759856B2 (en) 2011-11-28 2017-03-09 Anti-PD-L1 antibodies and uses thereof

Publications (1)

Publication Number Publication Date
WO2013079174A1 true WO2013079174A1 (en) 2013-06-06

Family

ID=47221305

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2012/004822 WO2013079174A1 (en) 2011-11-28 2012-11-21 Anti-pd-l1 antibodies and uses thereof

Country Status (28)

Country Link
US (4) US9624298B2 (en)
EP (2) EP3763741A1 (en)
JP (2) JP6138813B2 (en)
KR (2) KR101764096B1 (en)
CN (1) CN103987405B (en)
AR (1) AR089010A1 (en)
AU (2) AU2012344260B2 (en)
BR (1) BR112014012819B1 (en)
CA (1) CA2856895C (en)
CY (1) CY1123435T1 (en)
DK (1) DK2785375T3 (en)
EA (1) EA036814B9 (en)
ES (1) ES2808152T3 (en)
FR (1) FR20C1068I2 (en)
HK (1) HK1200736A1 (en)
HR (1) HRP20201595T1 (en)
HU (2) HUE051954T2 (en)
IL (2) IL232778B (en)
LT (2) LT2785375T (en)
MX (1) MX349096B (en)
NL (1) NL301081I2 (en)
NO (1) NO2021003I1 (en)
PT (1) PT2785375T (en)
RS (1) RS61033B1 (en)
SG (1) SG11201402603WA (en)
SI (1) SI2785375T1 (en)
WO (1) WO2013079174A1 (en)
ZA (1) ZA201404790B (en)

Cited By (642)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2014195852A1 (en) 2013-06-03 2014-12-11 Glaxosmithkline Intellectual Property (No.2) Limited Combinations of an anti-pd-l1 antibody and a mek inhibitor and/or a braf inhibitor
WO2015036511A1 (en) * 2013-09-12 2015-03-19 F. Hoffmann-La Roche Ag Combination therapy of antibodies against human csf-1r and antibodies against human pd-l1
WO2015036499A1 (en) * 2013-09-11 2015-03-19 Medimmune Limited Anti-b7-h1 antibodies for treating tumors
WO2015048520A1 (en) * 2013-09-27 2015-04-02 Genentech, Inc. Anti-pdl1 antibody formulations
WO2015061668A1 (en) * 2013-10-25 2015-04-30 Dana-Farber Cancer Institute, Inc. Anti-pd-l1 monoclonal antibodies and fragments thereof
WO2015066413A1 (en) 2013-11-01 2015-05-07 Novartis Ag Oxazolidinone hydroxamic acid compounds for the treatment of bacterial infections
WO2015100282A1 (en) 2013-12-24 2015-07-02 Bristol-Myers Squibb Company Tricyclic compounds as anticancer agents
WO2015107495A1 (en) 2014-01-17 2015-07-23 Novartis Ag N-azaspirocycloalkane substituted n-heteroaryl compounds and compositions for inhibiting the activity of shp2
WO2015118175A2 (en) 2014-02-10 2015-08-13 Merck Patent Gmbh TARGETED TGFβ INHIBITION
WO2015138920A1 (en) 2014-03-14 2015-09-17 Novartis Ag Antibody molecules to lag-3 and uses thereof
WO2015109124A3 (en) * 2014-01-15 2015-09-24 Kadmon Corporation, Llc Immunomodulatory agents
WO2015148379A1 (en) 2014-03-24 2015-10-01 Novartis Ag Monobactam organic compounds for the treatment of bacterial infections
US9192667B2 (en) 2013-04-22 2015-11-24 Hoffmann-La Roche Inc. Method of treating cancer by administering CSF-1R antibodies and a TLR9 agonist
WO2015187835A2 (en) 2014-06-06 2015-12-10 Bristol-Myers Squibb Company Antibodies against glucocorticoid-induced tumor necrosis factor receptor (gitr) and uses thereof
WO2015193352A1 (en) 2014-06-17 2015-12-23 Medimmune Limited Methods of cancer treatment with antagonists against pd-1 and pd-l1 in combination with radiation therapy
WO2016004876A1 (en) 2014-07-09 2016-01-14 Shanghai Birdie Biotech, Inc. Anti-pd-l1 combinations for treating tumors
WO2016020836A1 (en) 2014-08-06 2016-02-11 Novartis Ag Quinolone derivatives as antibacterials
WO2016040880A1 (en) 2014-09-13 2016-03-17 Novartis Ag Combination therapies of alk inhibitors
WO2016050721A1 (en) * 2014-09-30 2016-04-07 Intervet International B.V. Pd-l1 antibodies binding canine pd-l1
WO2016054555A2 (en) 2014-10-03 2016-04-07 Novartis Ag Combination therapies
WO2016057846A1 (en) 2014-10-08 2016-04-14 Novartis Ag Compositions and methods of use for augmented immune response and cancer therapy
WO2016061142A1 (en) 2014-10-14 2016-04-21 Novartis Ag Antibody molecules to pd-l1 and uses thereof
CN105695406A (en) * 2016-04-27 2016-06-22 天津普瑞赛尔生物科技有限公司 Method for preparing DC-CIK immune cells with high-efficiency tumor killing property and prepared DC-CIK immune cells
WO2016097995A1 (en) 2014-12-16 2016-06-23 Novartis Ag Isoxazole hydroxamic acid compounds as lpxc inhibitors
WO2016100882A1 (en) 2014-12-19 2016-06-23 Novartis Ag Combination therapies
WO2016106266A1 (en) 2014-12-22 2016-06-30 Bristol-Myers Squibb Company TGFβ RECEPTOR ANTAGONISTS
WO2016123454A1 (en) 2015-01-29 2016-08-04 Board Of Trustees Of Miching State University Cryptic polypeptides and uses thereof
WO2016127052A1 (en) 2015-02-05 2016-08-11 Bristol-Myers Squibb Company Cxcl11 and smica as predictive biomarkers for efficacy of anti-ctla4 immunotherapy
WO2016081518A3 (en) * 2014-11-17 2016-08-18 Adicet Bio, Inc. Engineered gamma delta t-cells
WO2016137985A1 (en) 2015-02-26 2016-09-01 Merck Patent Gmbh Pd-1 / pd-l1 inhibitors for the treatment of cancer
WO2016140884A1 (en) 2015-03-02 2016-09-09 Rigel Pharmaceuticals, Inc. TGF-β INHIBITORS
WO2016145085A2 (en) 2015-03-09 2016-09-15 Celldex Therapeutics, Inc. Cd27 agonists
WO2016145102A1 (en) 2015-03-10 2016-09-15 Aduro Biotech, Inc. Compositions and methods for activating "stimulator of interferon gene" -dependent signalling
WO2016161279A1 (en) 2015-04-03 2016-10-06 Bristol-Myers Squibb Company Inhibitors of indoleamine 2,3-dioxygenase for the treatment of cancer
WO2016162505A1 (en) 2015-04-08 2016-10-13 F-Star Biotechnology Limited Her2 binding agent therapies
WO2016183118A1 (en) 2015-05-12 2016-11-17 Bristol-Myers Squibb Company Tricyclic compounds as anticancer agents
WO2016181348A1 (en) 2015-05-14 2016-11-17 Pfizer Inc. Combinations comprising a pyrrolidine-2,5-dione ido1 inhibitor and an anti-body
WO2016183115A1 (en) 2015-05-12 2016-11-17 Bristol-Myers Squibb Company 5h-pyrido[3,2-b]indole compounds as anticancer agents
WO2016183114A1 (en) 2015-05-11 2016-11-17 Bristol-Myers Squibb Company Tricyclic compounds as anticancer agents
WO2016196228A1 (en) 2015-05-29 2016-12-08 Bristol-Myers Squibb Company Antibodies against ox40 and uses thereof
WO2016196218A1 (en) 2015-05-31 2016-12-08 Curegenix Corporation Combination compositions for immunotherapy
WO2016201425A1 (en) 2015-06-12 2016-12-15 Bristol-Myers Squibb Company Treatment of cancer by combined blockade of the pd-1 and cxcr4 signaling pathways
WO2016205277A1 (en) * 2015-06-16 2016-12-22 Merck Patent Gmbh Pd-l1 antagonist combination treatments
WO2017000983A1 (en) 2015-06-29 2017-01-05 Ose Immunotherapeutics Method for inducing early t memory response with short peptides anti-tumor vaccine
WO2017004016A1 (en) 2015-06-29 2017-01-05 The Rockefeller University Antibodies to cd40 with enhanced agonist activity
WO2017019757A1 (en) 2015-07-28 2017-02-02 Bristol-Myers Squibb Company Tgf beta receptor antagonists
WO2017019897A1 (en) 2015-07-29 2017-02-02 Novartis Ag Combination therapies comprising antibody molecules to tim-3
WO2017019894A1 (en) 2015-07-29 2017-02-02 Novartis Ag Combination therapies comprising antibody molecules to lag-3
WO2017035118A1 (en) 2015-08-25 2017-03-02 Bristol-Myers Squibb Company Tgf beta receptor antagonists
US9598422B2 (en) 2014-11-05 2017-03-21 Flexus Biosciences, Inc. Immunoregulatory agents
US9605070B2 (en) 2014-01-31 2017-03-28 Novartis Ag Antibody molecules to TIM-3 and uses thereof
WO2017055484A1 (en) 2015-09-29 2017-04-06 INSERM (Institut National de la Santé et de la Recherche Médicale) Methods for determining the metabolic status of lymphomas
WO2017058780A1 (en) 2015-09-30 2017-04-06 Merck Patent Gmbh Combination of a pd-1 axis binding antagonist and an alk inhibitor for treating alk-negative cancer
KR20170039706A (en) * 2014-08-05 2017-04-11 씨비 테라퓨틱스, 인코포레이티드 Anti-pd-l1 antibodies
US20170100425A1 (en) * 2014-07-10 2017-04-13 Biothera, Inc. Beta-glucan in combination with anti-cancer agents affecting the tumor microenvironment
WO2017069291A1 (en) 2015-10-23 2017-04-27 Canbas Co., Ltd. Peptides and peptidomimetics in combination with t cell activating and/or checkpoint inhibiting agents for cancer treatment
US9643972B2 (en) 2014-11-05 2017-05-09 Flexus Biosciences, Inc. Immunoregulatory agents
WO2017087678A2 (en) 2015-11-19 2017-05-26 Bristol-Myers Squibb Company Antibodies against glucocorticoid-induced tumor necrosis factor receptor (gitr) and uses thereof
WO2017093933A1 (en) 2015-12-03 2017-06-08 Glaxosmithkline Intellectual Property Development Limited Cyclic purine dinucleotides as modulators of sting
WO2017097407A1 (en) * 2015-12-07 2017-06-15 Merck Patent Gmbh Aqueous pharmaceutical formulation comprising anti-pd-1 antibody avelumab
WO2017098421A1 (en) 2015-12-08 2017-06-15 Glaxosmithkline Intellectual Property Development Limited Benzothiadiazine compounds
US9683048B2 (en) 2014-01-24 2017-06-20 Novartis Ag Antibody molecules to PD-1 and uses thereof
WO2017106656A1 (en) 2015-12-17 2017-06-22 Novartis Ag Antibody molecules to pd-1 and uses thereof
WO2017103283A1 (en) 2015-12-17 2017-06-22 Photocure Asa Neoadjuvant therapy for bladder cancer
WO2017103895A1 (en) 2015-12-18 2017-06-22 Novartis Ag Antibodies targeting cd32b and methods of use thereof
WO2017106291A1 (en) 2015-12-15 2017-06-22 Bristol-Myers Squibb Company Cxcr4 receptor antagonists
WO2017112741A1 (en) 2015-12-22 2017-06-29 Novartis Ag Mesothelin chimeric antigen receptor (car) and antibody against pd-l1 inhibitor for combined use in anticancer therapy
WO2017118634A1 (en) 2016-01-04 2017-07-13 INSERM (Institut National de la Santé et de la Recherche Médicale) Use of pd-1 and tim-3 as a measure for cd8+ cells in predicting and treating renal cell carcinoma
JP2017522905A (en) * 2014-07-03 2017-08-17 ベイジーン リミテッド Anti-PD-L1 antibodies and their use for therapy and diagnosis
WO2017140821A1 (en) 2016-02-19 2017-08-24 Novartis Ag Tetracyclic pyridone compounds as antivirals
WO2017144681A1 (en) 2016-02-25 2017-08-31 Cell Medica Switzerland Ag Binding members to pd-l1
WO2017153952A1 (en) 2016-03-10 2017-09-14 Glaxosmithkline Intellectual Property Development Limited 5-sulfamoyl-2-hydroxybenzamide derivatives
WO2017159699A1 (en) 2016-03-15 2017-09-21 Chugai Seiyaku Kabushiki Kaisha Methods of treating cancers using pd-1 axis binding antagonists and anti-gpc3 antibodies
WO2017160754A1 (en) 2016-03-15 2017-09-21 Mersana Therapeutics,Inc. Napi2b-targeted antibody-drug conjugates and methods of use thereof
WO2017163186A1 (en) 2016-03-24 2017-09-28 Novartis Ag Alkynyl nucleoside analogs as inhibitors of human rhinovirus
WO2017178572A1 (en) 2016-04-13 2017-10-19 Vivia Biotech, S.L Ex vivo bite-activated t cells
EP3094736A4 (en) * 2014-01-14 2017-10-25 Dana-Farber Cancer Institute, Inc. Compositions and methods for identification, assessment, prevention, and treatment of melanoma using pd-l1 isoforms
WO2017184619A2 (en) 2016-04-18 2017-10-26 Celldex Therapeutics, Inc. Agonistic antibodies that bind human cd40 and uses thereof
WO2017191545A1 (en) 2016-05-05 2017-11-09 Glaxosmithkline Intellectual Property (No.2) Limited Enhancer of zeste homolog 2 inhibitors
WO2017196867A1 (en) * 2016-05-09 2017-11-16 Igm Biosciences, Inc. Anti-pd-l1 antibodies
WO2017200969A1 (en) 2016-05-20 2017-11-23 Eli Lilly And Company Combination therapy with notch and pd-1 or pd-l1 inhibitors
WO2017202744A1 (en) 2016-05-26 2017-11-30 Merck Patent Gmbh Pd-1 / pd-l1 inhibitors for cancer treatment
WO2017212425A1 (en) 2016-06-08 2017-12-14 Glaxosmithkline Intellectual Property Development Limited Chemical compounds as atf4 pathway inhibitors
WO2017216705A1 (en) 2016-06-14 2017-12-21 Novartis Ag Crystalline form of (r)-4-(5-(cyclopropylethynyl)isoxazol-3-yl)-n-hydroxy-2-methyl-2-(methylsulfonyl)butanamide as an antibacterial agent
WO2017216686A1 (en) 2016-06-16 2017-12-21 Novartis Ag 8,9-fused 2-oxo-6,7-dihydropyrido-isoquinoline compounds as antivirals
WO2017218533A1 (en) 2016-06-13 2017-12-21 Torque Therapeutics, Inc. Methods and compositions for promoting immune cell function
WO2017216685A1 (en) 2016-06-16 2017-12-21 Novartis Ag Pentacyclic pyridone compounds as antivirals
WO2017220989A1 (en) 2016-06-20 2017-12-28 Kymab Limited Anti-pd-l1 and il-2 cytokines
WO2017223422A1 (en) 2016-06-24 2017-12-28 Infinity Pharmaceuticals, Inc. Combination therapies
KR20180004277A (en) * 2016-03-04 2018-01-10 쓰촨 케룬-바이오테크 바이오파마수티컬 컴퍼니 리미티드 PDL-1 antibody, pharmaceutical composition thereof and uses thereof
WO2018013818A2 (en) 2016-07-14 2018-01-18 Bristol-Myers Squibb Company Antibodies against tim3 and uses thereof
WO2018015879A1 (en) 2016-07-20 2018-01-25 Glaxosmithkline Intellectual Property Development Limited Isoquinoline derivatives as perk inhibitors
WO2018017633A1 (en) 2016-07-21 2018-01-25 Bristol-Myers Squibb Company TGF Beta RECEPTOR ANTAGONISTS
US9885721B2 (en) 2014-05-29 2018-02-06 Spring Bioscience Corporation PD-L1 antibodies and uses thereof
WO2018029367A1 (en) 2016-08-12 2018-02-15 Merck Patent Gmbh Combination therapy for cancer
WO2018029474A2 (en) 2016-08-09 2018-02-15 Kymab Limited Anti-icos antibodies
US9895441B2 (en) 2012-05-31 2018-02-20 Genentech, Inc. Methods of treating cancer using PD-L1 axis binding antagonists and VEGF antagonists
US9913461B2 (en) 2014-12-09 2018-03-13 Regeneron Pharmaceuticals, Inc. Genetically modified mouse whose genome comprises a humanized CD274 gene
WO2018047109A1 (en) 2016-09-09 2018-03-15 Novartis Ag Polycyclic pyridone compounds as antivirals
US9920123B2 (en) 2008-12-09 2018-03-20 Genentech, Inc. Anti-PD-L1 antibodies, compositions and articles of manufacture
WO2018057955A1 (en) 2016-09-23 2018-03-29 Elstar Therapeutics, Inc. Multispecific antibody molecules comprising lambda and kappa light chains
WO2018060926A1 (en) 2016-09-28 2018-04-05 Novartis Ag Beta-lactamase inhibitors
US9938345B2 (en) 2014-01-23 2018-04-10 Regeneron Pharmaceuticals, Inc. Human antibodies to PD-L1
WO2018065938A1 (en) 2016-10-06 2018-04-12 Pfizer Inc. Dosing regimen of avelumab for the treatment of cancer
WO2018068336A1 (en) * 2016-10-15 2018-04-19 Innovent Biologics (Suzhou) Co., Ltd Pd-1 antibodies
WO2018073753A1 (en) 2016-10-18 2018-04-26 Novartis Ag Fused tetracyclic pyridone compounds as antivirals
US9957323B2 (en) 2016-06-20 2018-05-01 Kymab Limited Anti-ICOS antibodies
WO2018081621A1 (en) 2016-10-28 2018-05-03 Bristol-Myers Squibb Company Methods of treating urothelial carcinoma using an anti-pd-1 antibody
WO2018085555A1 (en) 2016-11-03 2018-05-11 Bristol-Myers Squibb Company Activatable anti-ctla-4 antibodies and uses thereof
WO2018098269A2 (en) 2016-11-23 2018-05-31 Mersana Therapeutics, Inc. Peptide-containing linkers for antibody-drug conjugates
WO2018098352A2 (en) 2016-11-22 2018-05-31 Jun Oishi Targeting kras induced immune checkpoint expression
US9987500B2 (en) 2014-01-23 2018-06-05 Regeneron Pharmaceuticals, Inc. Human antibodies to PD-1
WO2018100534A1 (en) 2016-12-01 2018-06-07 Glaxosmithkline Intellectual Property Development Limited Combination therapy
WO2018100535A1 (en) 2016-12-01 2018-06-07 Glaxosmithkline Intellectual Property Development Limited Combination therapy
WO2018110515A1 (en) 2016-12-12 2018-06-21 第一三共株式会社 Combination of antibody-drug conjugate and immune checkpoint inhibitor
WO2018132279A1 (en) 2017-01-05 2018-07-19 Bristol-Myers Squibb Company Tgf beta receptor antagonists
WO2018136700A1 (en) 2017-01-20 2018-07-26 Arcus Biosciences, Inc. Azolopyrimidine for the treatment of cancer-related disorders
EP3277320A4 (en) * 2015-03-30 2018-08-01 Stcube, Inc. Antibodies specific to glycosylated pd-l1 and methods of use thereof
WO2018138110A1 (en) 2017-01-25 2018-08-02 Ose Immunotherapeutics Method for manufacturing a stable emulsion for peptide delivery
WO2018138591A1 (en) 2017-01-24 2018-08-02 Pfizer Inc. Calicheamicin derivatives and antibody drug conjugates thereof
WO2018146612A1 (en) 2017-02-10 2018-08-16 Novartis Ag 1-(4-amino-5-bromo-6-(1 h-pyrazol-1-yl)pyrimidin-2-yl)-1 h-pyrazol-4-ol and use thereof in the treatment of cancer
WO2018152396A1 (en) 2017-02-17 2018-08-23 Innate Tumor Immunity, Inc. Substituted imidazo-quinolines as nlrp3 modulators
WO2018151820A1 (en) 2017-02-16 2018-08-23 Elstar Therapeutics, Inc. Multifunctional molecules comprising a trimeric ligand and uses thereof
WO2018160538A1 (en) 2017-02-28 2018-09-07 Mersana Therapeutics, Inc. Combination therapies of her2-targeted antibody-drug conjugates
EP3372615A1 (en) 2017-03-06 2018-09-12 Merck Patent GmbH Composition comprising avelumab
WO2018162749A1 (en) 2017-03-09 2018-09-13 Genmab A/S Antibodies against pd-l1
WO2018162446A1 (en) 2017-03-06 2018-09-13 Merck Patent Gmbh Aqueous anti-pd-l1 antibody formulation
WO2018172508A1 (en) 2017-03-24 2018-09-27 INSERM (Institut National de la Santé et de la Recherche Médicale) Methods and compositions for treating melanoma
WO2018183928A1 (en) 2017-03-31 2018-10-04 Bristol-Myers Squibb Company Methods of treating tumor
WO2018178040A1 (en) 2017-03-30 2018-10-04 Merck Patent Gmbh Combination of an anti-pd-l1 antibody and a dna-pk inhibitor for the treatment of cancer
WO2018187613A2 (en) 2017-04-07 2018-10-11 Bristol-Myers Squibb Company Anti-icos agonist antibodies and uses thereof
WO2018195283A1 (en) 2017-04-19 2018-10-25 Elstar Therapeutics, Inc. Multispecific molecules and uses thereof
WO2018194496A2 (en) 2017-04-17 2018-10-25 Закрытое Акционерное Общество "Биокад" Monoclonal antibody to pd-l1
WO2018195397A2 (en) 2017-04-21 2018-10-25 Kyn Therapeutics Indole ahr inhibitors and uses thereof
WO2018198076A1 (en) 2017-04-28 2018-11-01 Aduro Biotech, Inc. Bis 2'-5'-rr-(3'f-a)(3'f-a) cyclic dinucleotide compound and uses thereof
WO2018200430A1 (en) 2017-04-26 2018-11-01 Bristol-Myers Squibb Company Methods of antibody production that minimize disulfide bond reduction
WO2018198079A1 (en) 2017-04-27 2018-11-01 Novartis Ag Fused indazole pyridone compounds as antivirals
WO2018198091A1 (en) 2017-04-28 2018-11-01 Novartis Ag Antibody conjugates comprising toll-like receptor agonist and combination therapies
WO2018201047A1 (en) 2017-04-28 2018-11-01 Elstar Therapeutics, Inc. Multispecific molecules comprising a non-immunoglobulin heterodimerization domain and uses thereof
WO2018203302A1 (en) 2017-05-05 2018-11-08 Novartis Ag Tricyclic 2-quinolinones as antibacterials
CN108779180A (en) * 2016-03-23 2018-11-09 迈博斯生物医药(苏州)有限公司 Novel anti-PD-L1 antibody
WO2018209049A1 (en) 2017-05-12 2018-11-15 Bristol-Myers Squibb Company Inhibitors of indoleamine 2,3-dioxygenase and methods of their use
WO2018213377A1 (en) 2017-05-17 2018-11-22 Arcus Biosciences, Inc. Quinazoline-pyrazole derivatives for the treatment of cancer-related disorders
WO2018213297A1 (en) 2017-05-16 2018-11-22 Bristol-Myers Squibb Company Treatment of cancer with anti-gitr agonist antibodies
WO2018222901A1 (en) 2017-05-31 2018-12-06 Elstar Therapeutics, Inc. Multispecific molecules that bind to myeloproliferative leukemia (mpl) protein and uses thereof
WO2018223002A1 (en) 2017-06-01 2018-12-06 Xencor, Inc. Bispecific antibodies that bind cd 123 cd3
WO2018220546A1 (en) 2017-05-31 2018-12-06 Novartis Ag Crystalline forms of 5-bromo-2,6-di(1 h-pyrazol-1-yl)pyrimidin-4-amine and new salts
WO2018222718A1 (en) 2017-05-30 2018-12-06 Bristol-Myers Squibb Company Treatment of lag-3 positive tumors
WO2018223004A1 (en) 2017-06-01 2018-12-06 Xencor, Inc. Bispecific antibodies that bind cd20 and cd3
WO2018222711A2 (en) 2017-05-30 2018-12-06 Bristol-Myers Squibb Company Compositions comprising a combination of an anti-lag-3 antibody, a pd-1 pathway inhibitor, and an immunotherapeutic agent
WO2018220446A1 (en) 2017-06-01 2018-12-06 Compugen Ltd. Triple combination antibody therapies
WO2018222722A2 (en) 2017-05-30 2018-12-06 Bristol-Myers Squibb Company Compositions comprising an anti-lag-3 antibody or an anti-lag-3 antibody and an anti-pd-1 or anti-pd-l1 antibody
WO2018223040A1 (en) 2017-06-01 2018-12-06 Bristol-Myers Squibb Company Methods of treating a tumor using an anti-pd-1 antibody
WO2018225093A1 (en) 2017-06-07 2018-12-13 Glaxosmithkline Intellectual Property Development Limited Chemical compounds as atf4 pathway inhibitors
WO2018225033A1 (en) 2017-06-09 2018-12-13 Glaxosmithkline Intellectual Property Development Limited Combination therapy
WO2018229715A1 (en) 2017-06-16 2018-12-20 Novartis Ag Compositions comprising anti-cd32b antibodies and methods of use thereof
WO2018237157A1 (en) 2017-06-22 2018-12-27 Novartis Ag Antibody molecules to cd73 and uses thereof
WO2018237173A1 (en) 2017-06-22 2018-12-27 Novartis Ag Antibody molecules to cd73 and uses thereof
WO2018235056A1 (en) 2017-06-22 2018-12-27 Novartis Ag Il-1beta binding antibodies for use in treating cancer
WO2018234879A1 (en) 2017-06-22 2018-12-27 Novartis Ag Il-1beta binding antibodies for use in treating cancer
WO2019006007A1 (en) 2017-06-27 2019-01-03 Novartis Ag Dosage regimens for anti-tim-3 antibodies and uses thereof
WO2019006283A1 (en) 2017-06-30 2019-01-03 Bristol-Myers Squibb Company Amorphous and crystalline forms of ido inhibitors
WO2019008507A1 (en) 2017-07-03 2019-01-10 Glaxosmithkline Intellectual Property Development Limited 2-(4-chlorophenoxy)-n-((1 -(2-(4-chlorophenoxy)ethynazetidin-3-yl)methyl)acetamide derivatives and related compounds as atf4 inhibitors for treating cancer and other diseases
WO2019008506A1 (en) 2017-07-03 2019-01-10 Glaxosmithkline Intellectual Property Development Limited N-(3-(2-(4-chlorophenoxy)acetamido)bicyclo[1.1.1]pentan-1-yl)-2-cyclobutane-1-carboxamide derivatives and related compounds as atf4 inhibitors for treating cancer and other diseases
WO2019014402A1 (en) 2017-07-14 2019-01-17 Innate Tumor Immunity, Inc. Nlrp3 modulators
EP3431088A1 (en) * 2017-07-20 2019-01-23 Paris Sciences et Lettres - Quartier Latin Mntbap for use in inducing a transient immune tolerance
WO2019018730A1 (en) 2017-07-20 2019-01-24 Novartis Ag Dosage regimens of anti-lag-3 antibodies and uses thereof
WO2019021208A1 (en) 2017-07-27 2019-01-31 Glaxosmithkline Intellectual Property Development Limited Indazole derivatives useful as perk inhibitors
WO2019025545A1 (en) 2017-08-04 2019-02-07 Genmab A/S Binding agents binding to pd-l1 and cd137 and use thereof
WO2019035938A1 (en) 2017-08-16 2019-02-21 Elstar Therapeutics, Inc. Multispecific molecules that bind to bcma and uses thereof
US10214586B2 (en) 2015-08-24 2019-02-26 Eli Lilly And Company PD-L1 antibodies
WO2019040780A1 (en) 2017-08-25 2019-02-28 Five Prime Therapeutics Inc. B7-h4 antibodies and methods of use thereof
WO2019049061A1 (en) 2017-09-07 2019-03-14 Glaxosmithkline Intellectual Property Development Limited 5-(1 h-benzo[d]imidazo-2-yl)-pyridin-2-amine and 5-(3h-imidazo[4,5-b]pyridin-6-yl)-pyridin-2-amine derivatives as c-myc and p300/cbp histone acetyltransferase inhibitors for treating cancer
WO2019053617A1 (en) 2017-09-12 2019-03-21 Glaxosmithkline Intellectual Property Development Limited Chemical compounds
EP2944323B1 (en) 2013-01-11 2019-03-27 Dingfu Biotarget Co., Ltd Agents for treating tumours, use and method thereof
WO2019059411A1 (en) 2017-09-20 2019-03-28 Chugai Seiyaku Kabushiki Kaisha Dosage regimen for combination therapy using pd-1 axis binding antagonists and gpc3 targeting agent
EP3470426A1 (en) 2017-10-10 2019-04-17 Numab Therapeutics AG Multispecific antibody
EP3470429A1 (en) * 2017-10-10 2019-04-17 Numab Innovation AG Antibodies targeting pdl1 and methods of use thereof
WO2019074824A1 (en) 2017-10-09 2019-04-18 Bristol-Myers Squibb Company Inhibitors of indoleamine 2,3-dioxygenase and methods of their use
WO2019074822A1 (en) 2017-10-09 2019-04-18 Bristol-Myers Squibb Company Inhibitors of indoleamine 2,3-dioxygenase and methods of their use
WO2019075032A1 (en) 2017-10-13 2019-04-18 Merck Patent Gmbh Combination of a parp inhibitor and a pd-1 axis binding antagonist
WO2019072868A1 (en) 2017-10-10 2019-04-18 Numab Therapeutics AG Multispecific antibody
WO2019075090A1 (en) 2017-10-10 2019-04-18 Tilos Therapeutics, Inc. Anti-lap antibodies and uses thereof
WO2019072870A1 (en) 2017-10-10 2019-04-18 Numab Innovation Ag Antibodies targeting cd137 and methods of use thereof
WO2019072869A1 (en) 2017-10-10 2019-04-18 Numab Innovation Ag Antibodies targeting pdl1 and methods of use thereof
WO2019075468A1 (en) 2017-10-15 2019-04-18 Bristol-Myers Squibb Company Methods of treating tumor
WO2019077062A1 (en) 2017-10-18 2019-04-25 Vivia Biotech, S.L. Bite-activated car-t cells
WO2019077132A1 (en) 2017-10-19 2019-04-25 Debiopharm International S.A. Combination product for the treatment of cancer
WO2019079520A2 (en) 2017-10-18 2019-04-25 Alpine Immune Sciences, Inc. Variant icos ligand immunomodulatory proteins and related compositions and methods
WO2019081983A1 (en) 2017-10-25 2019-05-02 Novartis Ag Antibodies targeting cd32b and methods of use thereof
WO2019089753A2 (en) 2017-10-31 2019-05-09 Compass Therapeutics Llc Cd137 antibodies and pd-1 antagonists and uses thereof
WO2019090198A1 (en) 2017-11-06 2019-05-09 Bristol-Myers Squibb Company Isofuranone compounds useful as hpk1 inhibitors
WO2019089921A1 (en) 2017-11-01 2019-05-09 Bristol-Myers Squibb Company Immunostimulatory agonistic antibodies for use in treating cancer
WO2019090330A1 (en) 2017-11-06 2019-05-09 Bristol-Myers Squibb Company Methods of treating a tumor
WO2019097479A1 (en) 2017-11-17 2019-05-23 Novartis Ag Novel dihydroisoxazole compounds and their use for the treatment of hepatitis b
WO2019097369A1 (en) 2017-11-14 2019-05-23 Pfizer Inc. Ezh2 inhibitor combination therapies
WO2019104289A1 (en) 2017-11-27 2019-05-31 Mersana Therapeutics, Inc. Pyrrolobenzodiazepine antibody conjugates
WO2019101347A1 (en) 2017-11-27 2019-05-31 Ose Immunotherapeutics Improved treatment of cancer
WO2019108900A1 (en) 2017-11-30 2019-06-06 Novartis Ag Bcma-targeting chimeric antigen receptor, and uses thereof
WO2019113464A1 (en) 2017-12-08 2019-06-13 Elstar Therapeutics, Inc. Multispecific molecules and uses thereof
US10323004B2 (en) 2016-05-04 2019-06-18 Bristol-Myers Squibb Company Inhibitors of indoleamine 2,3-dioxygenase and methods of their use
WO2019123285A1 (en) 2017-12-20 2019-06-27 Novartis Ag Fused tricyclic pyrazolo-dihydropyrazinyl-pyridone compounds as antivirals
WO2019123207A1 (en) 2017-12-18 2019-06-27 Pfizer Inc. Methods and combination therapy to treat cancer
WO2019122884A1 (en) 2017-12-19 2019-06-27 Kymab Limited Antibodies to icos
WO2019126691A1 (en) 2017-12-21 2019-06-27 Mersana Therapeutics, Inc. Pyrrolobenzodiazepine antibody conjugates
CN109963589A (en) * 2016-10-30 2019-07-02 上海复宏汉霖生物技术股份有限公司 Anti- PD-L1 antibody and variant
WO2019133747A1 (en) 2017-12-27 2019-07-04 Bristol-Myers Squibb Company Anti-cd40 antibodies and uses thereof
WO2019129211A1 (en) * 2017-12-28 2019-07-04 Nanjing Legend Biotech Co., Ltd. Antibodies and variants thereof against pd-l1
WO2019136432A1 (en) 2018-01-08 2019-07-11 Novartis Ag Immune-enhancing rnas for combination with chimeric antigen receptor therapy
WO2019134946A1 (en) 2018-01-04 2019-07-11 INSERM (Institut National de la Santé et de la Recherche Médicale) Methods and compositions for treating melanoma resistant
WO2019136112A1 (en) 2018-01-05 2019-07-11 Bristol-Myers Squibb Company Inhibitors of indoleamine 2,3-dioxygenase and methods of their use
WO2019140150A1 (en) 2018-01-12 2019-07-18 Bristol-Myers Squibb Company Combination therapy with anti-il-8 antibodies and anti-pd-1 antibodies for treating cancer
WO2019140229A1 (en) 2018-01-12 2019-07-18 Bristol-Myers Squibb Company Antibodies against tim3 and uses thereof
WO2019144098A1 (en) 2018-01-22 2019-07-25 Bristol-Myers Squibb Company Compositions and methods of treating cancer
WO2019143607A1 (en) 2018-01-16 2019-07-25 Bristol-Myers Squibb Company Methods of treating cancer with antibodies against tim3
WO2019144126A1 (en) 2018-01-22 2019-07-25 Pascal Biosciences Inc. Cannabinoids and derivatives for promoting immunogenicity of tumor and infected cells
WO2019152660A1 (en) 2018-01-31 2019-08-08 Novartis Ag Combination therapy using a chimeric antigen receptor
WO2019152743A1 (en) 2018-01-31 2019-08-08 Celgene Corporation Combination therapy using adoptive cell therapy and checkpoint inhibitor
WO2019160956A1 (en) 2018-02-13 2019-08-22 Novartis Ag Chimeric antigen receptor therapy in combination with il-15r and il15
WO2019162325A1 (en) 2018-02-21 2019-08-29 INSERM (Institut National de la Santé et de la Recherche Médicale) Use of sk1 as biomarker for predicting response to immunecheckpoint inhibitors
WO2019165315A1 (en) 2018-02-23 2019-08-29 Syntrix Biosystems Inc. Method for treating cancer using chemokine antagonists alone or in combination
WO2019166951A1 (en) 2018-02-28 2019-09-06 Novartis Ag Indole-2-carbonyl compounds and their use for the treatment of hepatitis b
WO2019175243A1 (en) 2018-03-14 2019-09-19 Merck Patent Gmbh Compounds and uses thereof to treat tumors in a subject
WO2019178362A1 (en) 2018-03-14 2019-09-19 Elstar Therapeutics, Inc. Multifunctional molecules that bind to calreticulin and uses thereof
WO2019178364A2 (en) 2018-03-14 2019-09-19 Elstar Therapeutics, Inc. Multifunctional molecules and uses thereof
WO2019178269A2 (en) 2018-03-14 2019-09-19 Surface Oncology, Inc. Antibodies that bind cd39 and uses thereof
WO2019183040A1 (en) 2018-03-21 2019-09-26 Five Prime Therapeutics, Inc. ANTIBODIES BINDING TO VISTA AT ACIDIC pH
US10428146B2 (en) 2014-07-22 2019-10-01 Cb Therapeutics, Inc. Anti PD-1 antibodies
WO2019191676A1 (en) 2018-03-30 2019-10-03 Bristol-Myers Squibb Company Methods of treating tumor
WO2019190327A2 (en) 2018-03-30 2019-10-03 Merus N.V. Multivalent antibody
WO2019193541A1 (en) 2018-04-06 2019-10-10 Glaxosmithkline Intellectual Property Development Limited Bicyclic aromatic ring derivatives of formula (i) as atf4 inhibitors
WO2019193540A1 (en) 2018-04-06 2019-10-10 Glaxosmithkline Intellectual Property Development Limited Heteroaryl derivatives of formula (i) as atf4 inhibitors
US10441654B2 (en) 2014-01-24 2019-10-15 Children's Hospital Of Eastern Ontario Research Institute Inc. SMC combination therapy for the treatment of cancer
WO2019200229A1 (en) 2018-04-13 2019-10-17 Novartis Ag Dosage regimens for anti-pd-l1 antibodies and uses thereof
WO2019200256A1 (en) 2018-04-12 2019-10-17 Bristol-Myers Squibb Company Anticancer combination therapy with cd73 antagonist antibody and pd-1/pd-l1 axis antagonist antibody
EP3083686B1 (en) 2013-12-17 2019-10-23 F.Hoffmann-La Roche Ag Methods of treating cancers using pd-1 axis binding antagonists and taxanes
WO2019204743A1 (en) 2018-04-19 2019-10-24 Checkmate Pharmaceuticals, Inc. Synthetic rig-i-like receptor agonists
WO2019204665A1 (en) 2018-04-18 2019-10-24 Xencor, Inc. Pd-1 targeted heterodimeric fusion proteins containing il-15/il-15ra fc-fusion proteins and pd-1 antigen binding domains and uses thereof
WO2019204257A1 (en) 2018-04-16 2019-10-24 Arrys Therapeutics, Inc. Ep4 inhibitors and use thereof
WO2019204592A1 (en) 2018-04-18 2019-10-24 Xencor, Inc. Il-15/il-15ra heterodimeric fc fusion proteins and uses thereof
US10457725B2 (en) 2016-05-13 2019-10-29 Regeneron Pharmaceuticals, Inc. Methods of treating skin cancer by administering a PD-1 inhibitor
WO2019209896A1 (en) 2018-04-25 2019-10-31 Innate Tumor Immunity, Inc. Nlrp3 modulators
WO2019211489A1 (en) 2018-05-04 2019-11-07 Merck Patent Gmbh COMBINED INHIBITION OF PD-1/PD-L1, TGFβ AND DNA-PK FOR THE TREATMENT OF CANCER
WO2019213340A1 (en) 2018-05-03 2019-11-07 Bristol-Myers Squibb Company Uracil derivatives as mer-axl inhibitors
WO2019232244A2 (en) 2018-05-31 2019-12-05 Novartis Ag Antibody molecules to cd73 and uses thereof
WO2019232528A1 (en) 2018-06-01 2019-12-05 Xencor, Inc. Dosing of a bispecific antibody that bind cd123 and cd3
WO2019229658A1 (en) 2018-05-30 2019-12-05 Novartis Ag Entpd2 antibodies, combination therapies, and methods of using the antibodies and combination therapies
WO2019229701A2 (en) 2018-06-01 2019-12-05 Novartis Ag Binding molecules against bcma and uses thereof
WO2019243832A1 (en) 2018-06-22 2019-12-26 Bicycletx Limited Bicyclic peptide ligands specific for nectin-4
WO2019246528A1 (en) * 2018-06-22 2019-12-26 Vyriad Methods of treating cancer using combination therapy
WO2020006016A1 (en) 2018-06-27 2020-01-02 Bristol-Myers Squibb Company Naphthyridinone compounds useful as t cell activators
WO2020006018A1 (en) 2018-06-27 2020-01-02 Bristol-Myers Squibb Company Substituted naphthyridinone compounds useful as t cell activators
WO2020010250A2 (en) 2018-07-03 2020-01-09 Elstar Therapeutics, Inc. Anti-tcr antibody molecules and uses thereof
WO2020010177A1 (en) 2018-07-06 2020-01-09 Kymera Therapeutics, Inc. Tricyclic crbn ligands and uses thereof
WO2020012334A1 (en) 2018-07-10 2020-01-16 Novartis Ag 3-(5-hydroxy-1-oxoisoindolin-2-yl)piperidine-2,6-dione derivatives and their use in the treatment of ikaros family zinc finger 2 (ikzf2)-dependent diseases
WO2020014132A2 (en) 2018-07-09 2020-01-16 Five Prime Therapeutics, Inc. Antibodies binding to ilt4
WO2020012337A1 (en) 2018-07-10 2020-01-16 Novartis Ag 3-(5-amino-1-oxoisoindolin-2-yl)piperidine-2,6-dione derivatives and their use in the treatment of i karos family zinc finger 2 (ikzf2)-dependent diseases
WO2020014327A2 (en) 2018-07-11 2020-01-16 Five Prime Therapeutics, Inc. Antibodies binding to vista at acidic ph
WO2020012339A1 (en) 2018-07-09 2020-01-16 Glaxosmithkline Intellectual Property Development Limited Chemical compounds
US10544099B2 (en) 2016-05-04 2020-01-28 Bristol-Myers Squibb Company Inhibitors of indoleamine 2,3-dioxygenase and methods of their use
WO2020023356A1 (en) 2018-07-23 2020-01-30 Bristol-Myers Squibb Company Inhibitors of indoleamine 2,3-dioxygenase and methods of their use
WO2020023355A1 (en) 2018-07-23 2020-01-30 Bristol-Myers Squibb Company Inhibitors of indoleamine 2,3-dioxygenase and methods of their use
WO2020023707A1 (en) 2018-07-26 2020-01-30 Bristol-Myers Squibb Company Lag-3 combination therapy for the treatment of cancer
WO2020027224A1 (en) 2018-07-31 2020-02-06 国立大学法人東京大学 Super versatile method for imparting new binding specificity to antibody
WO2020031107A1 (en) 2018-08-08 2020-02-13 Glaxosmithkline Intellectual Property Development Limited Chemical compounds
WO2020037094A1 (en) 2018-08-16 2020-02-20 Innate Tumor Immunity, Inc. Substitued 4-amino-1h-imidazo[4,5-c]quinoline compounds and improved methods for their preparation
WO2020037091A1 (en) 2018-08-16 2020-02-20 Innate Tumor Immunity, Inc. Imidazo[4,5-c]quinoline derived nlrp3-modulators
WO2020037092A1 (en) 2018-08-16 2020-02-20 Innate Tumor Immunity, Inc. Imidazo[4,5-c]quinoline derived nlrp3-modulators
US10570204B2 (en) 2013-09-26 2020-02-25 The Medical College Of Wisconsin, Inc. Methods for treating hematologic cancers
WO2020039321A2 (en) 2018-08-20 2020-02-27 Pfizer Inc. Anti-gdf15 antibodies, compositions and methods of use
WO2020043683A1 (en) 2018-08-27 2020-03-05 Pieris Pharmaceuticals Gmbh Combination therapies comprising cd137/her2 bispecific agents and pd-1 axis inhibitors and uses thereof
WO2020051424A1 (en) 2018-09-07 2020-03-12 Pic Therapeutics Eif4e inhibitors and uses thereof
WO2020053654A1 (en) 2018-09-12 2020-03-19 Novartis Ag Antiviral pyridopyrazinedione compounds
US10604574B2 (en) 2016-06-30 2020-03-31 Oncorus, Inc. Oncolytic viral delivery of therapeutic polypeptides
WO2020064971A1 (en) 2018-09-26 2020-04-02 Merck Patent Gmbh Combination of a pd-1 antagonist, an atr inhibitor and a platinating agent for the treatment of cancer
WO2020069372A1 (en) 2018-09-27 2020-04-02 Elstar Therapeutics, Inc. Csf1r/ccr2 multispecific antibodies
WO2020072821A2 (en) 2018-10-03 2020-04-09 Xencor, Inc. Il-12 heterodimeric fc-fusion proteins
US10620211B2 (en) 2015-02-03 2020-04-14 Ventana Medical Systems, Inc. Histochemical assay for evaluating expression of programmed death ligand 1 (PD-L1)
WO2020077276A2 (en) 2018-10-12 2020-04-16 Xencor, Inc. Pd-1 targeted il-15/il-15ralpha fc fusion proteins and uses in combination therapies thereof
WO2020076969A2 (en) 2018-10-10 2020-04-16 Tilos Therapeutics, Inc. Anti-lap antibody variants and uses thereof
US10626155B2 (en) 2011-06-24 2020-04-21 Cytune Pharma IL-15 and IL-15R\alpha sushi domain based immunocytokines
WO2020079581A1 (en) 2018-10-16 2020-04-23 Novartis Ag Tumor mutation burden alone or in combination with immune markers as biomarkers for predicting response to targeted therapy
WO2020081928A1 (en) 2018-10-19 2020-04-23 Bristol-Myers Squibb Company Combination therapy for melanoma
US10633342B2 (en) 2016-05-04 2020-04-28 Bristol-Myers Squibb Company Inhibitors of indoleamine 2,3-dioxygenase and methods of their use
EP3643727A1 (en) 2014-08-15 2020-04-29 Merck Patent GmbH Sirp-alpha immunoglobulin fusion proteins
WO2020086476A1 (en) 2018-10-22 2020-04-30 Glaxosmithkline Intellectual Property Development Limited Dosing
WO2020086724A1 (en) 2018-10-23 2020-04-30 Bristol-Myers Squibb Company Methods of treating tumor
WO2020092385A1 (en) 2018-10-29 2020-05-07 Mersana Therapeutics, Inc. Cysteine engineered antibody-drug conjugates with peptide-containing linkers
WO2020093024A2 (en) 2018-11-01 2020-05-07 Merck Patent Gmbh Methods of administering anti-tim-3 antibodies
WO2020093023A1 (en) 2018-11-01 2020-05-07 Merck Patent Gmbh Anti-tim-3 antibodies
WO2020089811A1 (en) 2018-10-31 2020-05-07 Novartis Ag Dc-sign antibody drug conjugates
WO2020095184A1 (en) 2018-11-05 2020-05-14 Pfizer Inc. Combinations for treating cancer
WO2020094744A1 (en) 2018-11-06 2020-05-14 Genmab A/S Antibody formulation
WO2020095183A1 (en) 2018-11-05 2020-05-14 Pfizer Inc. Combination for treating cancer
WO2020102501A1 (en) 2018-11-16 2020-05-22 Bristol-Myers Squibb Company Anti-nkg2a antibodies and uses thereof
US10660909B2 (en) 2016-11-17 2020-05-26 Syntrix Biosystems Inc. Method for treating cancer using chemokine antagonists
WO2020104496A1 (en) 2018-11-20 2020-05-28 INSERM (Institut National de la Santé et de la Recherche Médicale) Bispecific antibody targeting transferrin receptor 1 and soluble antigen
WO2020104479A1 (en) 2018-11-20 2020-05-28 INSERM (Institut National de la Santé et de la Recherche Médicale) Methods and compositions for treating cancers and resistant cancers with anti transferrin receptor 1 antibodies
WO2020109328A1 (en) 2018-11-26 2020-06-04 Debiopharm International S.A. Combination treatment of hiv infections
WO2020110056A1 (en) 2018-11-30 2020-06-04 Glaxosmithkline Intellectual Property Development Limited Compounds useful in hiv therapy
WO2020117849A1 (en) 2018-12-04 2020-06-11 Bristol-Myers Squibb Company Methods of analysis using in-sample calibration curve by multiple isotopologue reaction monitoring
WO2020115261A1 (en) 2018-12-07 2020-06-11 INSERM (Institut National de la Santé et de la Recherche Médicale) Methods and compositions for treating melanoma
WO2020117988A1 (en) 2018-12-04 2020-06-11 Tolero Pharmaceuticals, Inc. Cdk9 inhibitors and polymorphs thereof for use as agents for treatment of cancer
WO2020120592A1 (en) 2018-12-12 2020-06-18 INSERM (Institut National de la Santé et de la Recherche Médicale) Methods and compositions for predicting and treating melanoma
EP3670659A1 (en) 2018-12-20 2020-06-24 Abivax Biomarkers, and uses in treatment of viral infections, inflammations, or cancer
WO2020127411A1 (en) 2018-12-19 2020-06-25 INSERM (Institut National de la Santé et de la Recherche Médicale) Methods and compositions for treating cancers by immuno-modulation using antibodies against cathespin-d
WO2020128620A1 (en) 2018-12-21 2020-06-25 Novartis Ag Use of il-1beta binding antibodies
WO2020132646A1 (en) 2018-12-20 2020-06-25 Xencor, Inc. Targeted heterodimeric fc fusion proteins containing il-15/il-15ra and nkg2d antigen binding domains
WO2020127965A1 (en) 2018-12-21 2020-06-25 Onxeo New conjugated nucleic acid molecules and their uses
WO2020128893A1 (en) 2018-12-21 2020-06-25 Pfizer Inc. Combination treatments of cancer comprising a tlr agonist
WO2020128972A1 (en) 2018-12-20 2020-06-25 Novartis Ag Dosing regimen and pharmaceutical combination comprising 3-(1-oxoisoindolin-2-yl)piperidine-2,6-dione derivatives
WO2020127885A1 (en) 2018-12-21 2020-06-25 INSERM (Institut National de la Santé et de la Recherche Médicale) Compositions for treating cancers and resistant cancers
WO2020128636A1 (en) 2018-12-21 2020-06-25 Novartis Ag Use of il-1 beta antibodies in the treatment or prevention of myelodysplastic syndrome
WO2020128613A1 (en) 2018-12-21 2020-06-25 Novartis Ag Use of il-1beta binding antibodies
WO2020128637A1 (en) 2018-12-21 2020-06-25 Novartis Ag Use of il-1 binding antibodies in the treatment of a msi-h cancer
US10696648B2 (en) 2016-05-04 2020-06-30 Bristol-Myers Squibb Company Inhibitors of indoleamine 2,3-dioxygenase and methods of their use
US10696650B2 (en) 2017-08-17 2020-06-30 Ikena Oncology, Inc. AHR inhibitors and uses thereof
WO2020136235A1 (en) 2018-12-28 2020-07-02 Transgene Sa M2-defective poxvirus
WO2020150114A1 (en) 2019-01-14 2020-07-23 Innate Tumor Immunity, Inc. Heterocyclic nlrp3 modulators, for use in the treatment of cancer
WO2020150116A1 (en) 2019-01-14 2020-07-23 Innate Tumor Immunity, Inc. Nlrp3 modulators
WO2020150113A1 (en) 2019-01-14 2020-07-23 Innate Tumor Immunity, Inc. Substituted quinazolines as nlrp3 modulators, for use in the treatment of cancer
WO2020150115A1 (en) 2019-01-14 2020-07-23 Innate Tumor Immunity, Inc. Nlrp3 modulators
US10723799B2 (en) 2016-06-13 2020-07-28 I-Mab Biopharma Us Limited Anti-PD-L1 antibodies and uses thereof
EP3478723A4 (en) * 2016-06-29 2020-07-29 Checkpoint Therapeutics, Inc. Pd-l1-specific antibodies and methods of using the same
WO2020157131A1 (en) 2019-01-30 2020-08-06 INSERM (Institut National de la Santé et de la Recherche Médicale) Methods and compositions for identifying whether a subject suffering from a cancer will achieve a response with an immune-checkpoint inhibitor
WO2020161083A1 (en) 2019-02-04 2020-08-13 INSERM (Institut National de la Santé et de la Recherche Médicale) Methods and compositions for modulating blood-brain barrier
EP3559045A4 (en) * 2016-12-23 2020-08-19 REMD Biotherapeutics, Inc. Immunotherapy using antibodies that bind programmed death ligand-1 (pd-l1)
WO2020165370A1 (en) 2019-02-13 2020-08-20 INSERM (Institut National de la Santé et de la Recherche Médicale) Methods and compositions for selecting a cancer treatment in a subject suffering from cancer
WO2020165833A1 (en) 2019-02-15 2020-08-20 Novartis Ag 3-(1-oxo-5-(piperidin-4-yl)isoindolin-2-yl)piperidine-2,6-dione derivatives and uses thereof
WO2020165834A1 (en) 2019-02-15 2020-08-20 Novartis Ag Substituted 3-(1-oxoisoindolin-2-yl)piperidine-2,6-dione derivatives and uses thereof
WO2020171757A1 (en) * 2019-02-18 2020-08-27 Medivir Aktiebolag Methods for treating liver cancers using an orally administered dioxolane nucleotide in combination with an anti-pd1 or anti-pdl1 monoclonal antibody
WO2020187998A1 (en) 2019-03-19 2020-09-24 Fundació Privada Institut D'investigació Oncològica De Vall Hebron Combination therapy with omomyc and an antibody binding pd-1 or ctla-4 for the treatment of cancer
WO2020198676A1 (en) 2019-03-28 2020-10-01 Bristol-Myers Squibb Company Methods of treating tumor
WO2020198077A1 (en) 2019-03-22 2020-10-01 Sumitomo Dainippon Pharma Oncology, Inc. Compositions comprising pkm2 modulators and methods of treatment using the same
WO2020198672A1 (en) 2019-03-28 2020-10-01 Bristol-Myers Squibb Company Methods of treating tumor
US10793563B2 (en) 2018-01-29 2020-10-06 Merck Patent Gmbh GCN2 inhibitors and uses thereof
WO2020201753A1 (en) 2019-04-02 2020-10-08 Bicycletx Limited Bicycle toxin conjugates and uses thereof
WO2020216379A1 (en) 2019-04-26 2020-10-29 I-Mab Human pd-l1 antibodies
WO2020221796A1 (en) 2019-04-30 2020-11-05 INSERM (Institut National de la Santé et de la Recherche Médicale) Methods and compositions for treating melanoma
EP3736287A1 (en) 2015-05-11 2020-11-11 The Johns Hopkins University Autoimmune antibodies for use in inhibiting cancer cell growth
WO2020239558A1 (en) 2019-05-24 2020-12-03 Pfizer Inc. Combination therapies using cdk inhibitors
WO2020243423A1 (en) 2019-05-31 2020-12-03 Ikena Oncology, Inc. Tead inhibitors and uses thereof
WO2020243570A1 (en) 2019-05-30 2020-12-03 Bristol-Myers Squibb Company Cell localization signature and combination therapy
WO2020243563A1 (en) 2019-05-30 2020-12-03 Bristol-Myers Squibb Company Multi-tumor gene signatures for suitability to immuno-oncology therapy
WO2020243568A1 (en) 2019-05-30 2020-12-03 Bristol-Myers Squibb Company Methods of identifying a subject suitable for an immuno-oncology (i-o) therapy
US10858432B2 (en) 2015-12-02 2020-12-08 Stcube, Inc. Antibodies specific to glycosylated PD-1 and methods of use thereof
US10857181B2 (en) 2015-04-21 2020-12-08 Enlivex Therapeutics Ltd Therapeutic pooled blood apoptotic cell preparations and uses thereof
US10864203B2 (en) 2016-07-05 2020-12-15 Beigene, Ltd. Combination of a PD-1 antagonist and a RAF inhibitor for treating cancer
WO2020249071A1 (en) * 2019-06-12 2020-12-17 Nanjing GenScript Biotech Co., Ltd. Anti-pd-l1/anti-lag-3 multiple antigen binding proteins and methods of use thereof
US10874743B2 (en) 2017-12-26 2020-12-29 Kymera Therapeutics, Inc. IRAK degraders and uses thereof
US10875864B2 (en) 2011-07-21 2020-12-29 Sumitomo Dainippon Pharma Oncology, Inc. Substituted imidazo[1,2-B]pyridazines as protein kinase inhibitors
WO2021003417A1 (en) 2019-07-03 2021-01-07 Sumitomo Dainippon Pharma Oncology, Inc. Tyrosine kinase non-receptor 1 (tnk1) inhibitors and uses thereof
EP3763742A1 (en) 2014-09-01 2021-01-13 Birdie Biopharmaceuticals Inc. Anti-pd-l1 conjugates for treating tumors
RU2742312C1 (en) * 2015-02-26 2021-02-04 Мерк Патент Гмбх Pd-1/pd-l1 inhibitors for treating cancer
WO2021041588A1 (en) 2019-08-28 2021-03-04 Bristol-Myers Squibb Company Substituted pyridopyrimidinonyl compounds useful as t cell activators
WO2021048292A1 (en) 2019-09-11 2021-03-18 INSERM (Institut National de la Santé et de la Recherche Médicale) Methods and compositions for treating melanoma
WO2021053559A1 (en) 2019-09-18 2021-03-25 Novartis Ag Entpd2 antibodies, combination therapies, and methods of using the antibodies and combination therapies
WO2021055698A1 (en) 2019-09-19 2021-03-25 Bristol-Myers Squibb Company Antibodies binding to vista at acidic ph
WO2021055994A1 (en) 2019-09-22 2021-03-25 Bristol-Myers Squibb Company Quantitative spatial profiling for lag-3 antagonist therapy
WO2021053560A1 (en) 2019-09-18 2021-03-25 Novartis Ag Combination therapy with entpd2 and cd73 antibodies
WO2021053207A1 (en) 2019-09-20 2021-03-25 Transgene Combination of a poxvirus encoding hpv polypeptides and il-2 with an anti-pd-l1 antibody
US10959986B2 (en) 2018-08-29 2021-03-30 Bristol-Myers Squibb Company Inhibitors of indoleamine 2,3-dioxygenase and methods of their use
WO2021062018A1 (en) 2019-09-25 2021-04-01 Bristol-Myers Squibb Company Composite biomarker for cancer therapy
WO2021062244A1 (en) 2019-09-25 2021-04-01 Surface Oncology, Inc. Anti-il-27 antibodies and uses thereof
WO2021058711A2 (en) 2019-09-27 2021-04-01 Glaxosmithkline Intellectual Property Development Limited Antigen binding proteins
WO2021067863A2 (en) 2019-10-03 2021-04-08 Xencor, Inc. Targeted il-12 heterodimeric fc-fusion proteins
WO2021064180A1 (en) 2019-10-03 2021-04-08 INSERM (Institut National de la Santé et de la Recherche Médicale) Methods and compositions for modulating macrophages polarization
WO2021072298A1 (en) 2019-10-11 2021-04-15 Genentech, Inc. Pd-1 targeted il-15/il-15ralpha fc fusion proteins with improved properties
WO2021074391A1 (en) 2019-10-17 2021-04-22 INSERM (Institut National de la Santé et de la Recherche Médicale) Methods for diagnosing nasal intestinal type adenocarcinomas
US10987322B2 (en) 2014-06-06 2021-04-27 Flexus Biosciences, Inc. Immunoregulatory agents
US10988477B2 (en) 2018-01-29 2021-04-27 Merck Patent Gmbh GCN2 inhibitors and uses thereof
WO2021079958A1 (en) 2019-10-25 2021-04-29 第一三共株式会社 Combination of anti-garp antibody and immunoregulator
WO2021079195A1 (en) 2019-10-21 2021-04-29 Novartis Ag Tim-3 inhibitors and uses thereof
WO2021079188A1 (en) 2019-10-21 2021-04-29 Novartis Ag Combination therapies with venetoclax and tim-3 inhibitors
WO2021081353A1 (en) 2019-10-23 2021-04-29 Checkmate Pharmaceuticals, Inc. Synthetic rig-i-like receptor agonists
WO2021083959A1 (en) 2019-10-29 2021-05-06 INSERM (Institut National de la Santé et de la Recherche Médicale) Methods and compositions for treating uveal melanoma
US11000548B2 (en) 2015-02-18 2021-05-11 Enlivex Therapeutics Ltd Combination immune therapy and cytokine control therapy for cancer treatment
WO2021092221A1 (en) 2019-11-06 2021-05-14 Bristol-Myers Squibb Company Methods of identifying a subject with a tumor suitable for a checkpoint inhibitor therapy
WO2021092380A1 (en) 2019-11-08 2021-05-14 Bristol-Myers Squibb Company Lag-3 antagonist therapy for melanoma
WO2021091885A2 (en) 2019-11-04 2021-05-14 Alector Llc Siglec-9 ecd fusion molecules and methods of use thereof
WO2021092220A1 (en) 2019-11-06 2021-05-14 Bristol-Myers Squibb Company Methods of identifying a subject with a tumor suitable for a checkpoint inhibitor therapy
WO2021097256A1 (en) 2019-11-14 2021-05-20 Cohbar, Inc. Cxcr4 antagonist peptides
WO2021102343A1 (en) 2019-11-22 2021-05-27 Sumitomo Dainippon Pharma Oncology, Inc. Solid dose pharmaceutical composition
WO2021101919A1 (en) 2019-11-19 2021-05-27 Bristol-Myers Squibb Company Compounds useful as inhibitors of helios protein
US11021481B2 (en) 2019-09-13 2021-06-01 Nimbus Saturn, Inc. Substituted isoindolin-1-ones and 2,3-dihydro-1h-pyrrolo[3,4-c]pyridin-1-ones as HPK1 antagonists
WO2021106978A1 (en) 2019-11-27 2021-06-03 サイトリミック株式会社 Pharmaceutical composition
WO2021108528A1 (en) 2019-11-26 2021-06-03 Ikena Oncology, Inc. Polymorphic carbazole derivatives and uses thereof
WO2021108288A1 (en) 2019-11-26 2021-06-03 Bristol-Myers Squibb Company Salts/cocrystals of (r)-n-(4-chlorophenyl)-2-((1s,4s)-4-(6-fluoroquinolin-4-yl)cyclohexyl)propanamide
US11034771B2 (en) 2018-07-25 2021-06-15 I-Mab Biopharma Us Limited Anti-CD73 anti-PD-L1 bispecific antibodies
WO2021123243A1 (en) 2019-12-19 2021-06-24 INSERM (Institut National de la Santé et de la Recherche Médicale) Methods and vaccine compositions to treat cancers
WO2021123996A1 (en) 2019-12-20 2021-06-24 Novartis Ag Uses of anti-tgf-beta antibodies and checkpoint inhibitors for the treatment of proliferative diseases
WO2021127554A1 (en) 2019-12-19 2021-06-24 Bristol-Myers Squibb Company Combinations of dgk inhibitors and checkpoint antagonists
WO2021133750A1 (en) 2019-12-23 2021-07-01 Bristol-Myers Squibb Company Substituted bicyclic piperidine derivatives useful as t cell activators
WO2021133748A1 (en) 2019-12-23 2021-07-01 Bristol-Myers Squibb Company Substituted quinolinonyl piperazine compounds useful as t cell activators
WO2021133751A1 (en) 2019-12-23 2021-07-01 Bristol-Myers Squibb Company Substituted quinazolinyl compounds useful as t cell activators
WO2021133752A1 (en) 2019-12-23 2021-07-01 Bristol-Myers Squibb Company Substituted heteroaryl compounds useful as t cell activators
WO2021133749A1 (en) 2019-12-23 2021-07-01 Bristol-Myers Squibb Company Substituted piperazine derivatives useful as t cell activators
EP3587453A4 (en) * 2017-02-21 2021-07-07 Shanghai Junshi Bioscience Co., Ltd. Anti-pd-l1 antibody and application thereof
WO2021138407A2 (en) 2020-01-03 2021-07-08 Marengo Therapeutics, Inc. Multifunctional molecules that bind to cd33 and uses thereof
WO2021142203A1 (en) 2020-01-10 2021-07-15 Innate Tumor Immunity, Inc. Nlrp3 modulators
WO2021141907A1 (en) 2020-01-06 2021-07-15 Hifibio (Hong Kong) Limited Anti-tnfr2 antibody and uses thereof
WO2021139682A1 (en) 2020-01-07 2021-07-15 Hifibio (Hk) Limited Anti-galectin-9 antibody and uses thereof
US11066478B2 (en) 2015-12-17 2021-07-20 Photocure Asa Intravesical therapy for bladder cancer
US11066383B2 (en) 2016-05-04 2021-07-20 Bristol-Myers Squibb Company Inhibitors of indoleamine 2,3-dioxygenase and methods of their use
WO2021146370A1 (en) 2020-01-15 2021-07-22 Blueprint Medicines Corporation Map4k1 inhibitors
WO2021144657A1 (en) 2020-01-17 2021-07-22 Novartis Ag Combination comprising a tim-3 inhibitor and a hypomethylating agent for use in treating myelodysplastic syndrome or chronic myelomonocytic leukemia
WO2021144426A1 (en) 2020-01-17 2021-07-22 INSERM (Institut National de la Santé et de la Recherche Médicale) Methods and compositions for treating melanoma
WO2021154073A1 (en) 2020-01-29 2021-08-05 Merus N.V. Means and method for modulating immune cell engaging effects.
WO2021152548A1 (en) 2020-01-30 2021-08-05 Benitah Salvador Aznar Combination therapy for treatment of cancer and cancer metastasis
WO2021152005A1 (en) 2020-01-28 2021-08-05 Universite De Strasbourg Antisense oligonucleotide targeting linc00518 for treating melanoma
WO2021158938A1 (en) 2020-02-06 2021-08-12 Bristol-Myers Squibb Company Il-10 and uses thereof
WO2021156360A1 (en) 2020-02-05 2021-08-12 INSERM (Institut National de la Santé et de la Recherche Médicale) Methods for discontinuing a treatment with a tyrosine kinase inhibitor (tki)
US11090367B2 (en) 2016-11-09 2021-08-17 The Brigham And Women's Hospital, Inc. Restoration of tumor suppression using mRNA-based delivery system
US11098077B2 (en) 2016-07-05 2021-08-24 Chinook Therapeutics, Inc. Locked nucleic acid cyclic dinucleotide compounds and uses thereof
WO2021167964A1 (en) 2020-02-18 2021-08-26 Alector Llc Pilra antibodies and methods of use thereof
US11104712B2 (en) 2017-03-15 2021-08-31 Cue Biopharma, Inc. Methods for modulating an immune response
WO2021174045A1 (en) 2020-02-28 2021-09-02 Bristol-Myers Squibb Company Radiolabeled fibronectin based scaffolds and antibodies and theranostic uses thereof
WO2021170777A1 (en) 2020-02-28 2021-09-02 INSERM (Institut National de la Santé et de la Recherche Médicale) Methods for diagnosing, prognosing and managing treatment of breast cancer
WO2021171264A1 (en) 2020-02-28 2021-09-02 Novartis Ag Dosing of a bispecific antibody that binds cd123 and cd3
WO2021178807A1 (en) 2020-03-06 2021-09-10 Celgene Quanticel Research, Inc. Combination of an lsd-1 inhibitor and nivolumab for use in treating sclc or sqnsclc
WO2021176424A1 (en) 2020-03-06 2021-09-10 Ona Therapeutics, S.L. Anti-cd36 antibodies and their use to treat cancer
WO2021178488A1 (en) 2020-03-03 2021-09-10 PIC Therapeutics, Inc. Eif4e inhibitors and uses thereof
US11117889B1 (en) 2018-11-30 2021-09-14 Kymera Therapeutics, Inc. IRAK degraders and uses thereof
US11117945B2 (en) 2016-12-22 2021-09-14 Cue Biopharma, Inc. T-cell modulatory multimeric polypeptides and methods of use thereof
EP3878446A1 (en) 2020-03-09 2021-09-15 Universite De Geneve Hsd11b1 inhibitors for use in immunotherapy and uses thereof
WO2021183428A1 (en) 2020-03-09 2021-09-16 Bristol-Myers Squibb Company Antibodies to cd40 with enhanced agonist activity
WO2021188769A1 (en) 2020-03-19 2021-09-23 Arcus Biosciences, Inc. Tetralin and tetrahydroquinoline compounds as inhibitors of hif-2alpha
WO2021194914A1 (en) 2020-03-23 2021-09-30 Bristol-Myers Squibb Company Substituted oxoisoindoline compounds for the treatment of cancer
US11142800B2 (en) 2010-10-07 2021-10-12 The General Hospital Corporation Biomarkers of cancer
WO2021207449A1 (en) 2020-04-09 2021-10-14 Merck Sharp & Dohme Corp. Affinity matured anti-lap antibodies and uses thereof
WO2021209358A1 (en) 2020-04-14 2021-10-21 Glaxosmithkline Intellectual Property Development Limited Combination treatment for cancer based upon an icos antibody and a pd-l1 antibody tgf-beta-receptor fusion protein
US11154616B2 (en) 2015-06-17 2021-10-26 Genentech, Inc. Methods of treating locally advanced or metastatic breast cancers using PD-1 axis binding antagonists and taxanes
US11168144B2 (en) 2017-06-01 2021-11-09 Cytomx Therapeutics, Inc. Activatable anti-PDL1 antibodies, and methods of use thereof
WO2021224215A1 (en) 2020-05-05 2021-11-11 F. Hoffmann-La Roche Ag Predicting response to pd-1 axis inhibitors
US11174316B2 (en) 2015-03-13 2021-11-16 Cytomx Therapeutics, Inc. Anti-PDL1 antibodies, activatable anti-PDL1 antibodies, and methods of use thereof
WO2021231732A1 (en) 2020-05-15 2021-11-18 Bristol-Myers Squibb Company Antibodies to garp
US11186637B2 (en) 2013-09-13 2021-11-30 Beigene Switzerland Gmbh Anti-PD1 antibodies and their use as therapeutics and diagnostics
EP3694545A4 (en) * 2017-10-11 2021-12-01 Board Of Regents, The University Of Texas System Human pd-l1 antibodies and methods of use therefor
WO2021247591A1 (en) 2020-06-02 2021-12-09 Arcus Biosciences, Inc. Antibodies to tigit
WO2021249969A1 (en) 2020-06-10 2021-12-16 Merck Patent Gmbh Combination product for the treatment of cancer diseases
WO2021258010A1 (en) 2020-06-19 2021-12-23 Gossamer Bio Services, Inc. Oxime compounds useful as t cell activators
WO2021255223A1 (en) 2020-06-19 2021-12-23 Onxeo New conjugated nucleic acid molecules and their uses
WO2021260528A1 (en) 2020-06-23 2021-12-30 Novartis Ag Dosing regimen comprising 3-(1-oxoisoindolin-2-yl)piperidine-2,6-dione derivatives
US11214619B2 (en) 2018-07-20 2022-01-04 Surface Oncology, Inc. Anti-CD112R compositions and methods
WO2022003554A1 (en) 2020-07-01 2022-01-06 Pfizer Inc. Biomarkers for pd-1 axis binding antagonist therapy
US11226339B2 (en) * 2012-12-11 2022-01-18 Albert Einstein College Of Medicine Methods for high throughput receptor:ligand identification
WO2022023379A1 (en) 2020-07-28 2022-02-03 INSERM (Institut National de la Santé et de la Recherche Médicale) Methods and compositions for preventing and treating a cancer
US11242319B2 (en) 2014-11-05 2022-02-08 Flexus Biosciences, Inc. Immunoregulatory agents
US11242393B2 (en) 2018-03-23 2022-02-08 Bristol-Myers Squibb Company Antibodies against MICA and/or MICB and uses thereof
WO2022029573A1 (en) 2020-08-03 2022-02-10 Novartis Ag Heteroaryl substituted 3-(1-oxoisoindolin-2-yl)piperidine-2,6-dione derivatives and uses thereof
WO2022033419A2 (en) 2020-08-10 2022-02-17 Shanghai Xbh Biotechnology Co., Ltd. Compositions and methods for treating autoimmune diseases and cancers by targeting igsf8
US11253525B2 (en) 2018-08-29 2022-02-22 Bristol-Myers Squibb Company Inhibitors of indoleamine 2,3-dioxygenase and methods of their use
WO2022038158A1 (en) 2020-08-17 2022-02-24 Bicycletx Limited Bicycle conjugates specific for nectin-4 and uses thereof
WO2022047189A1 (en) 2020-08-28 2022-03-03 Bristol-Myers Squibb Company Lag-3 antagonist therapy for hepatocellular carcinoma
WO2022047046A1 (en) 2020-08-26 2022-03-03 Marengo Therapeutics, Inc. Methods of detecting trbc1 or trbc2
WO2022047412A1 (en) 2020-08-31 2022-03-03 Bristol-Myers Squibb Company Cell localization signature and immunotherapy
WO2022053703A1 (en) 2020-09-14 2022-03-17 Boehringer Ingelheim International Gmbh Heterologous prime boost vaccine
US11279694B2 (en) 2016-11-18 2022-03-22 Sumitomo Dainippon Pharma Oncology, Inc. Alvocidib prodrugs and their use as protein kinase inhibitors
US11279766B2 (en) 2016-04-14 2022-03-22 Ose Immunotherapeutics Anti-SIRPa antibodies and their therapeutic applications
US11291718B2 (en) 2016-10-11 2022-04-05 Cytlimic Inc. Method for treating cancer by administering a toll-like receptor agonist and LAG-3 IgG fusion protein
US11299708B2 (en) 2016-05-12 2022-04-12 Adicet Bio, Inc. Methods for selective expansion of γδ T-cell populations and compositions thereof
US11299544B2 (en) 2013-03-15 2022-04-12 Genentech, Inc. Biomarkers and methods of treating PD-1 and PD-L1 related conditions
WO2022076318A1 (en) 2020-10-05 2022-04-14 Bristol-Myers Squibb Company Methods for concentrating proteins
WO2022076596A1 (en) 2020-10-06 2022-04-14 Codiak Biosciences, Inc. Extracellular vesicle-aso constructs targeting stat6
US11304976B2 (en) 2015-02-18 2022-04-19 Enlivex Therapeutics Ltd Combination immune therapy and cytokine control therapy for cancer treatment
EP3768719A4 (en) * 2018-03-19 2022-04-27 Abeome Corporation High affinity neutralizing monoclonal antibodies to programmed death ligand 1 (pd-l1) and uses thereof
WO2022084531A1 (en) 2020-10-23 2022-04-28 INSERM (Institut National de la Santé et de la Recherche Médicale) Methods and compositions for treating glioma
WO2022087402A1 (en) 2020-10-23 2022-04-28 Bristol-Myers Squibb Company Lag-3 antagonist therapy for lung cancer
US11318163B2 (en) 2015-02-18 2022-05-03 Enlivex Therapeutics Ltd Combination immune therapy and cytokine control therapy for cancer treatment
EP3992208A1 (en) * 2020-11-03 2022-05-04 Randox Laboratories Ltd Anti-pd-l1 vhh antibodies
WO2022094567A1 (en) 2020-10-28 2022-05-05 Ikena Oncology, Inc. Combination of an ahr inhibitor with a pdx inhibitor or doxorubicine
US11326170B2 (en) 2017-04-18 2022-05-10 Changchun Huapu Biotechnology Co. Ltd. Immunomodulatory polynucleotides and uses thereof
WO2022097060A1 (en) 2020-11-06 2022-05-12 Novartis Ag Cd19 binding molecules and uses thereof
US11332524B2 (en) 2018-03-22 2022-05-17 Surface Oncology, Inc. Anti-IL-27 antibodies and uses thereof
WO2022101484A1 (en) 2020-11-16 2022-05-19 INSERM (Institut National de la Santé et de la Recherche Médicale) Methods and compositions for predicting and treating uveal melanoma
WO2022101481A1 (en) 2020-11-16 2022-05-19 INSERM (Institut National de la Santé et de la Recherche Médicale) Methods and compositions for predicting and treating uveal melanoma
US11351164B2 (en) 2016-08-26 2022-06-07 Bristol-Myers Squibb Company Inhibitors of indoleamine 2,3-dioxygenase and methods of their use
WO2022120353A1 (en) 2020-12-02 2022-06-09 Ikena Oncology, Inc. Tead inhibitors and uses thereof
WO2022120179A1 (en) 2020-12-03 2022-06-09 Bristol-Myers Squibb Company Multi-tumor gene signatures and uses thereof
WO2022120354A1 (en) 2020-12-02 2022-06-09 Ikena Oncology, Inc. Tead inhibitors and uses thereof
US11358948B2 (en) 2017-09-22 2022-06-14 Kymera Therapeutics, Inc. CRBN ligands and uses thereof
EP3929215A4 (en) * 2019-06-10 2022-06-22 Shandong Boan Biotechnology Co., Ltd. Bifunctional fusion protein against pdl1 and tgf? and use thereof
WO2022133083A1 (en) 2020-12-16 2022-06-23 Gossamer Bio Services, Inc. Compounds useful as t cell activators
WO2022146948A1 (en) 2020-12-28 2022-07-07 Bristol-Myers Squibb Company Subcutaneous administration of pd1/pd-l1 antibodies
WO2022146947A1 (en) 2020-12-28 2022-07-07 Bristol-Myers Squibb Company Antibody compositions and methods of use thereof
US11384131B2 (en) 2014-04-24 2022-07-12 The Board Of Trustees Of The Leland Stanford Junior University Superagonists, partial agonists and antagonists of interleukin-2
WO2022148979A1 (en) 2021-01-11 2022-07-14 Bicycletx Limited Methods for treating cancer
WO2022148736A1 (en) 2021-01-05 2022-07-14 Transgene Vectorization of muc1 t cell engager
EP4029508A1 (en) 2014-10-10 2022-07-20 Idera Pharmaceuticals, Inc. Treatment of cancer using tlr9 agonists and checkpoint inhibitors
WO2022162569A1 (en) 2021-01-29 2022-08-04 Novartis Ag Dosage regimes for anti-cd73 and anti-entpd2 antibodies and uses thereof
EP3841126A4 (en) * 2018-08-20 2022-08-10 1Globe Biomedical Co., Ltd. Novel cancer immunotherapy antibody compositions
WO2022167445A1 (en) 2021-02-02 2022-08-11 Liminal Biosciences Limited Gpr84 antagonists and uses thereof
WO2022167457A1 (en) 2021-02-02 2022-08-11 Liminal Biosciences Limited Gpr84 antagonists and uses thereof
WO2022171121A1 (en) 2021-02-10 2022-08-18 同润生物医药(上海)有限公司 Method and combination for treating tumors
WO2022171745A1 (en) 2021-02-12 2022-08-18 F. Hoffmann-La Roche Ag Bicyclic tetrahydroazepine derivatives for the treatment of cancer
WO2022184937A1 (en) 2021-03-05 2022-09-09 Leadartis, S.L. Trimeric polypeptides and uses thereof in the treatment of cancer
WO2022185160A1 (en) 2021-03-02 2022-09-09 Glaxosmithkline Intellectual Property Development Limited Substituted pyridines as dnmt1 inhibitors
US11440960B2 (en) 2017-06-20 2022-09-13 Kymab Limited TIGIT antibodies, encoding nucleic acids and methods of using said antibodies in vivo
WO2022192145A1 (en) 2021-03-08 2022-09-15 Blueprint Medicines Corporation Map4k1 inhibitors
WO2022195551A1 (en) 2021-03-18 2022-09-22 Novartis Ag Biomarkers for cancer and methods of use thereof
WO2022194908A1 (en) 2021-03-17 2022-09-22 INSERM (Institut National de la Santé et de la Recherche Médicale) Methods and compositions for treating melanoma
WO2022197641A1 (en) 2021-03-15 2022-09-22 Rapt Therapeutics, Inc. 1h-pyrazolo[3,4-d]pyrimidin-6-yl-amine derivatives as hematopoietic progenitor kinase 1 (hpk1) modulators and/or inhibitors for the treatment of cancer and other diseases
US11459394B2 (en) 2017-02-24 2022-10-04 Macrogenics, Inc. Bispecific binding molecules that are capable of binding CD137 and tumor antigens, and uses thereof
WO2022212876A1 (en) 2021-04-02 2022-10-06 The Regents Of The University Of California Antibodies against cleaved cdcp1 and uses thereof
WO2022212400A1 (en) 2021-03-29 2022-10-06 Juno Therapeutics, Inc. Methods for dosing and treatment with a combination of a checkpoint inhibitor therapy and a car t cell therapy
WO2022208353A1 (en) 2021-03-31 2022-10-06 Glaxosmithkline Intellectual Property Development Limited Antigen binding proteins and combinations thereof
WO2022216993A2 (en) 2021-04-08 2022-10-13 Marengo Therapeutics, Inc. Multifuntional molecules binding to tcr and uses thereof
WO2022216644A1 (en) 2021-04-06 2022-10-13 Bristol-Myers Squibb Company Pyridinyl substituted oxoisoindoline compounds
WO2022214653A1 (en) 2021-04-09 2022-10-13 Ose Immunotherapeutics New scaffold for bifunctional molecules with improved properties
WO2022214652A1 (en) 2021-04-09 2022-10-13 Ose Immunotherapeutics Scaffold for bifunctioanl molecules comprising pd-1 or cd28 and sirp binding domains
WO2022216573A1 (en) 2021-04-05 2022-10-13 Bristol-Myers Squibb Company Pyridinyl substituted oxoisoindoline compounds for the treatment of cancer
WO2022215011A1 (en) 2021-04-07 2022-10-13 Novartis Ag USES OF ANTI-TGFβ ANTIBODIES AND OTHER THERAPEUTIC AGENTS FOR THE TREATMENT OF PROLIFERATIVE DISEASES
US11471456B2 (en) 2019-02-12 2022-10-18 Sumitomo Pharma Oncology, Inc. Formulations comprising heterocyclic protein kinase inhibitors
WO2022219080A1 (en) 2021-04-14 2022-10-20 INSERM (Institut National de la Santé et de la Recherche Médicale) New method to improve nk cells cytotoxicity
WO2022221227A1 (en) 2021-04-13 2022-10-20 Nuvalent, Inc. Amino-substituted heterocycles for treating cancers with egfr mutations
WO2022221866A1 (en) 2021-04-16 2022-10-20 Ikena Oncology, Inc. Mek inhibitors and uses thereof
WO2022223791A1 (en) 2021-04-23 2022-10-27 INSERM (Institut National de la Santé et de la Recherche Médicale) Methods and compositions for treating cell senescence accumulation related disease
US11485750B1 (en) 2019-04-05 2022-11-01 Kymera Therapeutics, Inc. STAT degraders and uses thereof
US11485743B2 (en) 2018-01-12 2022-11-01 Kymera Therapeutics, Inc. Protein degraders and uses thereof
US11491204B2 (en) 2015-04-07 2022-11-08 Cytlimic Inc. Composition comprising poly I:C and LAG-3-IGG fusion protein
WO2022236134A1 (en) 2021-05-07 2022-11-10 Surface Oncology, Inc. Anti-il-27 antibodies and uses thereof
US11497756B2 (en) 2017-09-12 2022-11-15 Sumitomo Pharma Oncology, Inc. Treatment regimen for cancers that are insensitive to BCL-2 inhibitors using the MCL-1 inhibitor alvocidib
US11498968B2 (en) 2016-12-22 2022-11-15 Hoffmann-La Roche Inc. Treatment of tumors with an anti-CSF-1R antibody in combination with an anti-PD-L1 antibody after failure of anti-PD-L1/PD1 treatment
US11497767B2 (en) 2015-02-18 2022-11-15 Enlivex Therapeutics R&D Ltd Combination immune therapy and cytokine control therapy for cancer treatment
US11505591B2 (en) 2016-05-18 2022-11-22 Cue Biopharma, Inc. T-cell modulatory multimeric polypeptides and methods of use thereof
WO2022246179A1 (en) 2021-05-21 2022-11-24 Arcus Biosciences, Inc. Axl inhibitor compounds
WO2022243378A1 (en) 2021-05-18 2022-11-24 Kymab Limited Uses of anti-icos antibodies
WO2022243846A1 (en) 2021-05-18 2022-11-24 Novartis Ag Combination therapies
WO2022246177A1 (en) 2021-05-21 2022-11-24 Arcus Biosciences, Inc. Axl compounds
US11512289B2 (en) 2015-02-18 2022-11-29 Enlivex Therapeutics Rdo Ltd Combination immune therapy and cytokine control therapy for cancer treatment
US11512080B2 (en) 2018-01-12 2022-11-29 Kymera Therapeutics, Inc. CRBN ligands and uses thereof
WO2022254227A1 (en) 2021-06-04 2022-12-08 Kymab Limited Treatment of pd-l1 negative or low expressing cancer with anti-icos antibodies
US11530269B2 (en) 2014-07-11 2022-12-20 Ventana Medical Systems, Inc. Anti-PD-L1 antibodies and diagnostic uses thereof
US11542335B2 (en) 2016-08-25 2023-01-03 Hoffmann-La Roche Inc. Method of treating cancer in a patient by administering an antibody which binds colony stimulating factor-1 receptor (CSF-1R)
US11542312B2 (en) 2017-06-19 2023-01-03 Medicenna Therapeutics, Inc. IL-2 superagonists in combination with anti-PD-1 antibodies
US11555038B2 (en) 2017-01-25 2023-01-17 Beigene, Ltd. Crystalline forms of (S)-7-(1-(but-2-ynoyl)piperidin-4-yl)-2-(4-phenoxyphenyl)-4,5,6,7-tetrahydropyrazolo[1,5-a]pyrimidine-3-carboxamide, preparation, and uses thereof
WO2023288264A1 (en) 2021-07-15 2023-01-19 Blueprint Medicines Corporation Map4k1 inhibitors
WO2023288254A1 (en) 2021-07-14 2023-01-19 Blueprint Medicines Corporation Heterocyclic compounds as map4k1 inhibitors
US11560425B2 (en) 2017-06-27 2023-01-24 Neuracle Science Co., Ltd. Use of anti-FAM19A5 antibodies for treating cancers
WO2023007472A1 (en) 2021-07-30 2023-02-02 ONA Therapeutics S.L. Anti-cd36 antibodies and their use to treat cancer
US11572412B2 (en) 2021-06-04 2023-02-07 Boehringer Ingelheim International Gmbh Anti-SIRP-alpha antibodies
EP3999534A4 (en) * 2019-07-19 2023-02-08 Beijing Sinotau Bio-Pharmaceuticals Technology Co., Ltd. A novel anti-pd-l1 antibody and use thereof
US11584793B2 (en) 2015-06-24 2023-02-21 Hoffmann-La Roche Inc. Anti-transferrin receptor antibodies with tailored affinity
US11591332B2 (en) 2019-12-17 2023-02-28 Kymera Therapeutics, Inc. IRAK degraders and uses thereof
WO2023028238A1 (en) 2021-08-25 2023-03-02 PIC Therapeutics, Inc. Eif4e inhibitors and uses thereof
WO2023028235A1 (en) 2021-08-25 2023-03-02 PIC Therapeutics, Inc. Eif4e inhibitors and uses thereof
US11597768B2 (en) 2017-06-26 2023-03-07 Beigene, Ltd. Immunotherapy for hepatocellular carcinoma
US11596652B2 (en) 2015-02-18 2023-03-07 Enlivex Therapeutics R&D Ltd Early apoptotic cells for use in treating sepsis
EP3929213A4 (en) * 2019-02-21 2023-03-08 Eucure (Beijing) Biopharma Co., Ltd Anti-pd-l1 antibody and use thereof
US11603411B2 (en) 2015-10-02 2023-03-14 Hoffmann-La Roche Inc. Bispecific anti-human CD20/human transferrin receptor antibodies and methods of use
US11603407B2 (en) 2017-04-06 2023-03-14 Regeneron Pharmaceuticals, Inc. Stable antibody formulation
WO2023039089A1 (en) 2021-09-08 2023-03-16 Twentyeight-Seven, Inc. Papd5 and/or papd7 inhibiting 4-oxo-1,4-dihydroquinoline-3-carboxylic acid derivatives
US11607453B2 (en) 2017-05-12 2023-03-21 Harpoon Therapeutics, Inc. Mesothelin binding proteins
US11623932B2 (en) 2017-09-22 2023-04-11 Kymera Therapeutics, Inc. Protein degraders and uses thereof
US11623958B2 (en) 2016-05-20 2023-04-11 Harpoon Therapeutics, Inc. Single chain variable fragment CD3 binding proteins
US11629189B2 (en) 2017-12-19 2023-04-18 Kymab Limited Bispecific antibody for ICOS and PD-L1
WO2023077090A1 (en) 2021-10-29 2023-05-04 Bristol-Myers Squibb Company Lag-3 antagonist therapy for hematological cancer
WO2023079430A1 (en) 2021-11-02 2023-05-11 Pfizer Inc. Methods of treating mitochondrial myopathies using anti-gdf15 antibodies
WO2023078900A1 (en) 2021-11-03 2023-05-11 INSERM (Institut National de la Santé et de la Recherche Médicale) Methods and compositions for treating triple negative breast cancer (tnbc)
US11655303B2 (en) 2019-09-16 2023-05-23 Surface Oncology, Inc. Anti-CD39 antibody compositions and methods
US11660352B2 (en) 2016-03-29 2023-05-30 Stcube, Inc. Dual function antibodies specific to glycosylated PD-L1 and methods of use thereof
US11667613B2 (en) 2019-09-26 2023-06-06 Novartis Ag Antiviral pyrazolopyridinone compounds
US11680090B2 (en) 2013-09-24 2023-06-20 Medicenna Therapeutics, Inc. Interleukin-2 fusion proteins and uses thereof
US11679109B2 (en) 2019-12-23 2023-06-20 Kymera Therapeutics, Inc. SMARCA degraders and uses thereof
WO2023111203A1 (en) 2021-12-16 2023-06-22 Onxeo New conjugated nucleic acid molecules and their uses
WO2023114984A1 (en) 2021-12-17 2023-06-22 Ikena Oncology, Inc. Tead inhibitors and uses thereof
US11685750B2 (en) 2020-06-03 2023-06-27 Kymera Therapeutics, Inc. Crystalline forms of IRAK degraders
WO2023122772A1 (en) 2021-12-22 2023-06-29 Gossamer Bio Services, Inc. Oxime derivatives useful as t cell activators
WO2023122778A1 (en) 2021-12-22 2023-06-29 Gossamer Bio Services, Inc. Pyridazinone derivatives useful as t cell activators
WO2023118165A1 (en) 2021-12-21 2023-06-29 INSERM (Institut National de la Santé et de la Recherche Médicale) Methods and compositions for treating melanoma
WO2023122777A1 (en) 2021-12-22 2023-06-29 Gossamer Bio Services, Inc. Oxime derivatives useful as t cell activators
US11702461B2 (en) 2018-01-09 2023-07-18 Cue Biopharma, Inc. T-cell modulatory multimeric polypeptides comprising reduced-affinity immunomodulatory polypeptides
US11701357B2 (en) 2016-08-19 2023-07-18 Beigene Switzerland Gmbh Treatment of B cell cancers using a combination comprising Btk inhibitors
US11707457B2 (en) 2019-12-17 2023-07-25 Kymera Therapeutics, Inc. IRAK degraders and uses thereof
US11713356B2 (en) 2017-10-13 2023-08-01 Ose Immunotherapeutics Modified bifunctional anti-human signal regulatory protein alpha (SIRPa) antibody and method of use thereof for treating cancer
WO2023147371A1 (en) 2022-01-26 2023-08-03 Bristol-Myers Squibb Company Combination therapy for hepatocellular carcinoma
WO2023150186A1 (en) 2022-02-01 2023-08-10 Arvinas Operations, Inc. Dgk targeting compounds and uses thereof
WO2023154799A1 (en) 2022-02-14 2023-08-17 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Combination immunotherapy for treating cancer
WO2023154905A1 (en) 2022-02-14 2023-08-17 Gilead Sciences, Inc. Antiviral pyrazolopyridinone compounds
US11730761B2 (en) 2016-02-18 2023-08-22 Enlivex Therapeutics Rdo Ltd Combination immune therapy and cytokine control therapy for cancer treatment
WO2023164638A1 (en) 2022-02-25 2023-08-31 Bristol-Myers Squibb Company Combination therapy for colorectal carcinoma
US11746103B2 (en) 2020-12-10 2023-09-05 Sumitomo Pharma Oncology, Inc. ALK-5 inhibitors and uses thereof
US11746152B2 (en) 2016-07-20 2023-09-05 Stcube, Inc. Methods of cancer treatment and therapy using a combination of antibodies that bind glycosylated PD-L1
WO2023168404A1 (en) 2022-03-04 2023-09-07 Bristol-Myers Squibb Company Methods of treating a tumor
WO2023166418A2 (en) 2022-03-03 2023-09-07 Pfizer Inc. Multispecific antibodies and uses thereof
US11753479B2 (en) 2014-03-04 2023-09-12 Kymab Limited Nucleic acids encoding anti-OX40L antibodies
WO2023173053A1 (en) 2022-03-10 2023-09-14 Ikena Oncology, Inc. Mek inhibitors and uses thereof
WO2023170606A1 (en) 2022-03-08 2023-09-14 Alentis Therapeutics Ag Use of anti-claudin-1 antibodies to increase t cell availability
WO2023173057A1 (en) 2022-03-10 2023-09-14 Ikena Oncology, Inc. Mek inhibitors and uses thereof
WO2023174210A1 (en) 2022-03-14 2023-09-21 Laekna Limited Combination treatment for cancer
WO2023178329A1 (en) 2022-03-18 2023-09-21 Bristol-Myers Squibb Company Methods of isolating polypeptides
WO2023178192A1 (en) 2022-03-15 2023-09-21 Compugen Ltd. Il-18bp antagonist antibodies and their use in monotherapy and combination therapy in the treatment of cancer
EP4249066A2 (en) 2014-12-23 2023-09-27 Bristol-Myers Squibb Company Antibodies to tigit
US11773103B2 (en) 2021-02-15 2023-10-03 Kymera Therapeutics, Inc. IRAK4 degraders and uses thereof
WO2023192478A1 (en) 2022-04-01 2023-10-05 Bristol-Myers Squibb Company Combination therapy with anti-il-8 antibodies and anti-pd-1 antibodies for treating cancer
US11779604B2 (en) 2016-11-03 2023-10-10 Kymab Limited Antibodies, combinations comprising antibodies, biomarkers, uses and methods
WO2023196964A1 (en) 2022-04-08 2023-10-12 Bristol-Myers Squibb Company Machine learning identification, classification, and quantification of tertiary lymphoid structures
WO2023196987A1 (en) 2022-04-07 2023-10-12 Bristol-Myers Squibb Company Methods of treating tumor
US11786529B2 (en) 2017-11-29 2023-10-17 Beigene Switzerland Gmbh Treatment of indolent or aggressive B-cell lymphomas using a combination comprising BTK inhibitors
US11787868B2 (en) 2015-10-02 2023-10-17 Hoffmann-La Roche Inc. Bispecific anti-human A-beta/human transferrin receptor antibodies and methods of use
US11793802B2 (en) 2019-03-20 2023-10-24 Sumitomo Pharma Oncology, Inc. Treatment of acute myeloid leukemia (AML) with venetoclax failure
WO2023211889A1 (en) 2022-04-25 2023-11-02 Ikena Oncology, Inc. Polymorphic compounds and uses thereof
US11807692B2 (en) 2018-09-25 2023-11-07 Harpoon Therapeutics, Inc. DLL3 binding proteins and methods of use
WO2023213763A1 (en) * 2022-05-02 2023-11-09 Transgene Poxvirus encoding a binding agent comprising an anti- pd-l1 sdab
WO2023213764A1 (en) * 2022-05-02 2023-11-09 Transgene Fusion polypeptide comprising an anti-pd-l1 sdab and a member of the tnfsf
WO2023214325A1 (en) 2022-05-05 2023-11-09 Novartis Ag Pyrazolopyrimidine derivatives and uses thereof as tet2 inhibitors
US11815435B2 (en) 2017-02-24 2023-11-14 Hibercell, Inc. Beta glucan immunopharmacodynamics
WO2023222854A1 (en) 2022-05-18 2023-11-23 Kymab Limited Uses of anti-icos antibodies
WO2023228095A1 (en) 2022-05-24 2023-11-30 Daiichi Sankyo Company, Limited Dosage regimen of an anti-cdh6 antibody-drug conjugate
WO2023230205A1 (en) 2022-05-25 2023-11-30 Ikena Oncology, Inc. Mek inhibitors and uses thereof
WO2023235847A1 (en) 2022-06-02 2023-12-07 Bristol-Myers Squibb Company Antibody compositions and methods of use thereof
US11851471B2 (en) 2017-01-09 2023-12-26 Cue Biopharma, Inc. T-cell modulatory multimeric polypeptides and methods of use thereof
US11857535B2 (en) 2020-07-30 2024-01-02 Kymera Therapeutics, Inc. Methods of treating mutant lymphomas
US11858996B2 (en) 2016-08-09 2024-01-02 Kymab Limited Anti-ICOS antibodies
US11865081B2 (en) 2017-12-29 2024-01-09 Virogin Biotech Canada Ltd. Oncolytic viral delivery of therapeutic polypeptides
US11878062B2 (en) 2020-05-12 2024-01-23 Cue Biopharma, Inc. Multimeric T-cell modulatory polypeptides and methods of use thereof
US11884723B2 (en) 2018-03-13 2024-01-30 Ose Immunotherapeutics Use of anti-human SIRPa v1 antibodies and method for producing anti-SIRPa v1 antibodies
WO2024023750A1 (en) 2022-07-28 2024-02-01 Astrazeneca Uk Limited Combination of antibody-drug conjugate and bispecific checkpoint inhibitor
WO2024023740A1 (en) 2022-07-27 2024-02-01 Astrazeneca Ab Combinations of recombinant virus expressing interleukin-12 with pd-1/pd-l1 inhibitors
EP4317972A2 (en) 2018-02-06 2024-02-07 The General Hospital Corporation Repeat rna as biomarkers of tumor immune response
WO2024028363A1 (en) 2022-08-02 2024-02-08 Liminal Biosciences Limited Heteroaryl carboxamide and related gpr84 antagonists and uses thereof
WO2024028365A1 (en) 2022-08-02 2024-02-08 Liminal Biosciences Limited Substituted pyridone gpr84 antagonists and uses thereof
WO2024028364A1 (en) 2022-08-02 2024-02-08 Liminal Biosciences Limited Aryl-triazolyl and related gpr84 antagonists and uses thereof
WO2024033388A1 (en) 2022-08-11 2024-02-15 F. Hoffmann-La Roche Ag Bicyclic tetrahydrothiazepine derivatives
WO2024033400A1 (en) 2022-08-10 2024-02-15 Institut National de la Santé et de la Recherche Médicale Sk2 inhibitor for the treatment of pancreatic cancer
WO2024033458A1 (en) 2022-08-11 2024-02-15 F. Hoffmann-La Roche Ag Bicyclic tetrahydroazepine derivatives
WO2024033457A1 (en) 2022-08-11 2024-02-15 F. Hoffmann-La Roche Ag Bicyclic tetrahydrothiazepine derivatives
WO2024036101A1 (en) 2022-08-09 2024-02-15 Bristol-Myers Squibb Company Tertiary amine substituted bicyclic compounds useful as t cell activators
WO2024036100A1 (en) 2022-08-08 2024-02-15 Bristol-Myers Squibb Company Substituted tetrazolyl compounds useful as t cell activators
WO2024033399A1 (en) 2022-08-10 2024-02-15 Institut National de la Santé et de la Recherche Médicale Sigmar1 ligand for the treatment of pancreatic cancer
US11926625B2 (en) 2021-03-05 2024-03-12 Nimbus Saturn, Inc. HPK1 antagonists and uses thereof
WO2024054992A1 (en) 2022-09-09 2024-03-14 Bristol-Myers Squibb Company Methods of separating chelator
US11932624B2 (en) 2020-03-19 2024-03-19 Kymera Therapeutics, Inc. MDM2 degraders and uses thereof
US11933786B2 (en) 2015-03-30 2024-03-19 Stcube, Inc. Antibodies specific to glycosylated PD-L1 and methods of use thereof
WO2024056716A1 (en) 2022-09-14 2024-03-21 Institut National de la Santé et de la Recherche Médicale Methods and pharmaceutical compositions for the treatment of dilated cardiomyopathy
US11939383B2 (en) 2018-03-02 2024-03-26 Five Prime Therapeutics, Inc. B7-H4 antibodies and methods and use thereof
WO2024069009A1 (en) 2022-09-30 2024-04-04 Alentis Therapeutics Ag Treatment of drug-resistant hepatocellular carcinoma
US11964015B2 (en) 2016-04-01 2024-04-23 Deutsches Krebsforschungszentrum Cancer therapy with an oncolytic virus combined with a checkpoint inhibitor
WO2024084034A1 (en) 2022-10-21 2024-04-25 Institut National de la Santé et de la Recherche Médicale Methods and pharmaceutical compositions for the treatment of osteoarthritis
US11976128B2 (en) 2018-03-23 2024-05-07 Board Of Regents, The University Of Texas System Human PD-L2 antibodies and methods of use therefor
US11976125B2 (en) 2017-10-13 2024-05-07 Harpoon Therapeutics, Inc. B cell maturation antigen binding proteins
US11981736B2 (en) 2020-11-13 2024-05-14 St Cube Inc. Antibodies specific to glycosylated PD-1 and methods of use thereof

Families Citing this family (196)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US8741591B2 (en) 2009-10-09 2014-06-03 The Research Foundation For The State University Of New York pH-insensitive glucose indicator protein
AU2012344260B2 (en) * 2011-11-28 2017-09-07 Merck Patent Gmbh Anti-PD-L1 antibodies and uses thereof
KR102196366B1 (en) 2012-12-07 2020-12-30 케모센트릭스, 인크. Diazole lactams
RU2695332C2 (en) 2014-05-15 2019-07-23 Бристол-Маерс Сквибб Компани Treating lung cancer by combination of anti-pd-1 and other anti-cancer agents
WO2016015095A1 (en) * 2014-07-31 2016-02-04 The University Of Western Australia A method for the identification of immunotherapy-drug combinations using a network approach
TW201618775A (en) 2014-08-11 2016-06-01 艾森塔製藥公司 Therapeutic combinations of a BTK inhibitor, a PI3K inhibitor, a JAK-2 inhibitor, a PD-1 inhibitor and/or a PD-L1 inhibitor
KR101619862B1 (en) * 2014-09-30 2016-05-12 주식회사 녹십자 Kit and Method of Measuring Titers of Protein Comprising Human Fc Using Indirect Enzyme-linked Immunosorbent Assay
CA3204990A1 (en) 2014-12-05 2016-06-09 Xyphos Biosciences Inc. Insertable variable fragments of antibodies and modified a1-a2 domains of nkg2d ligands
CN105777906B (en) * 2014-12-19 2019-04-23 苏州丁孚靶点生物技术有限公司 Anti- PD-L1 human antibody and its application
GB201500319D0 (en) * 2015-01-09 2015-02-25 Agency Science Tech & Res Anti-PD-L1 antibodies
WO2016128912A1 (en) 2015-02-12 2016-08-18 Acerta Pharma B.V. Therapeutic combinations of a btk inhibitor, a pi3k inhibitor, a jak-2 inhibitor, a pd-1 inhibitor, and/or a pd-l1 inhibitor
EP3067062A1 (en) * 2015-03-13 2016-09-14 Ipsen Pharma S.A.S. Combination of tasquinimod or a pharmaceutically acceptable salt thereof and a pd1 and/or pdl1 inhibitor, for use as a medicament
WO2016150899A2 (en) 2015-03-23 2016-09-29 Bayer Pharma Aktiengesellschaft Anti-ceacam6 antibodies and uses thereof
RS60753B1 (en) 2015-04-17 2020-10-30 Bristol Myers Squibb Co Compositions comprising a combination of ipilimumab and nivolumab
US20180155429A1 (en) 2015-05-28 2018-06-07 Bristol-Myers Squibb Company Treatment of pd-l1 positive lung cancer using an anti-pd-1 antibody
US11078278B2 (en) 2015-05-29 2021-08-03 Bristol-Myers Squibb Company Treatment of renal cell carcinoma
MA53355A (en) 2015-05-29 2022-03-16 Agenus Inc ANTI-CTLA-4 ANTIBODIES AND METHODS OF USE THEREOF
CA3219538A1 (en) * 2015-06-09 2016-12-15 Rexahn Pharmaceuticals, Inc. Fluorocyclopentenylcytosine uses and processes of preparation
EP3307777A4 (en) 2015-06-11 2019-02-13 Wuxi Biologics (Shanghai) Co. Ltd. Novel anti-pd-l1 antibodies
CN106243225B (en) * 2015-06-11 2021-01-19 智翔(上海)医药科技有限公司 Novel anti-PD-L1 antibodies
RS61532B1 (en) 2015-07-14 2021-04-29 Bristol Myers Squibb Co Method of treating cancer using immune checkpoint inhibitor; antibody that binds to programmed death-1 receptor (pd-1) or programmed death ligand 1 (pd-l1)
BR112018000917A2 (en) 2015-07-16 2018-09-11 Bioxcel Therapeutics Inc innovative approach to cancer treatment through immunomodulation
CN106397592A (en) * 2015-07-31 2017-02-15 苏州康宁杰瑞生物科技有限公司 Single-domain antibody directed at programmed death ligand (PD-L1) and derived protein thereof
WO2017020291A1 (en) * 2015-08-06 2017-02-09 Wuxi Biologics (Shanghai) Co. Ltd. Novel anti-pd-l1 antibodies
CA2994184A1 (en) 2015-09-04 2017-03-09 Rexahn Pharmaceuticals, Inc. Quinoxalinyl-piperazinamide methods of use
MA44909A (en) 2015-09-15 2018-07-25 Acerta Pharma Bv THERAPEUTIC ASSOCIATION OF A CD19 INHIBITOR AND A BTK INHIBITOR
CN106540255A (en) * 2015-09-18 2017-03-29 聊城市奥润生物医药科技有限公司 Ring dinucleotide cGAMP combines application of the Avastin in antitumor
CN106565836B (en) * 2015-10-10 2020-08-18 中国科学院广州生物医药与健康研究院 High affinity soluble PDL-1 molecules
EP3365062A4 (en) 2015-10-19 2019-07-17 Cold Genesys, Inc. Methods of treating solid or lymphatic tumors by combination therapy
EP3370733B1 (en) 2015-11-02 2021-07-14 Board of Regents, The University of Texas System Methods of cd40 activation and immune checkpoint blockade
MX2018005720A (en) * 2015-11-17 2018-11-09 Suzhou Suncadia Biopharmaceuticals Co Ltd Pd-l1 antibody, antigen fragment binding thereof and pharmaceutical use thereof.
US11072657B2 (en) 2015-11-18 2021-07-27 Bristol-Myers Squibb Company Treatment of lung cancer using a combination of an anti-PD-1 antibody and an anti-CTLA-4 antibody
PL3394093T3 (en) 2015-12-23 2022-05-16 Modernatx, Inc. Methods of using ox40 ligand encoding polynucleotides
CN105461808B (en) * 2015-12-24 2019-03-19 长春金赛药业股份有限公司 Monoclonal antibody and its application
CN106939047B (en) * 2016-01-04 2021-08-31 江苏怀瑜药业有限公司 PD-L1 antibody and preparation method thereof
PL3402503T3 (en) 2016-01-13 2021-04-19 Acerta Pharma B.V. Therapeutic combinations of an antifolate and a btk inhibitor
JP2019506863A (en) * 2016-02-02 2019-03-14 カドモン コーポレイション,リミティド ライアビリティ カンパニー Double-binding protein for PD-L1 and KDR
EP3426271A4 (en) 2016-03-10 2019-10-16 Cold Genesys, Inc. Methods of treating solid or lymphatic tumors by combination therapy
CN107216389B (en) 2016-03-18 2022-03-29 和迈生物科技有限公司 anti-PD-L1 nano antibody and coding sequence and application thereof
US11209441B2 (en) 2016-04-05 2021-12-28 Bristol-Myers Squibb Company Cytokine profiling analysis
IL261998B2 (en) 2016-04-07 2023-03-01 Chemocentryx Inc Reducing tumor burden by administering ccr1 antagonists in combination with pd-1 inhibitors or pd-l1 inhibitors
KR102548385B1 (en) * 2016-04-14 2023-06-28 크리에티브이 마이크로테크, 인크. Methods of using pd-l1 expression in treatment decisions for cancer therapy
DK3458083T3 (en) 2016-05-18 2023-01-30 Modernatx Inc POLYNUCLEOTIDES ENCODING INTERLEUKIN-12 (IL12) AND USES THEREOF
KR102482867B1 (en) 2016-05-18 2023-01-02 모더나티엑스, 인크. Combinations of mRNAs encoding immune modulatory polypeptides and uses thereof
SG11201810023QA (en) 2016-05-27 2018-12-28 Agenus Inc Anti-tim-3 antibodies and methods of use thereof
JP2019517505A (en) 2016-06-02 2019-06-24 ブリストル−マイヤーズ スクイブ カンパニーBristol−Myers Squibb Company Use of anti-PD-1 antibody in combination with anti-CD30 antibody in lymphoma treatment
US11083790B2 (en) 2016-06-02 2021-08-10 Bristol-Myers Squibb Company Treatment of Hodgkin lymphoma using an anti-PD-1 antibody
US20190292260A1 (en) 2016-06-03 2019-09-26 Bristol-Myers Squibb Company Anti-pd-1 antibody for use in a method of treatment of recurrent small cell lung cancer
KR20230118713A (en) 2016-06-03 2023-08-11 브리스톨-마이어스 스큅 컴퍼니 Anti-pd-1 antibody for use in a method of treating a tumor
US11332529B2 (en) 2016-06-03 2022-05-17 Bristol-Myers Squibb Company Methods of treating colorectal cancer
WO2017218435A1 (en) * 2016-06-13 2017-12-21 Askgene Pharma Inc. PD-L1 Specific Monoclonal Antibodies for Disease Treatment and Diagnosis
JP2019523016A (en) 2016-06-24 2019-08-22 サイフォス、バイオサイエンシズ、インコーポレイテッドXyphos Biosciences Inc. Variable fragment of antibody insert and modified A1-A2 domain of NKG2D ligand
GB201612520D0 (en) 2016-07-19 2016-08-31 F-Star Beta Ltd Binding molecules
WO2018024237A1 (en) * 2016-08-04 2018-02-08 信达生物制药(苏州)有限公司 Anti-pd-l1 nanobody and use thereof
WO2018031507A1 (en) * 2016-08-09 2018-02-15 Angimmune, Llc Treatment of cancer using a combination of immunomodulation and check point inhibitors
CN106248955A (en) * 2016-09-03 2016-12-21 长春工业大学 A kind of test kit detecting humanization PD L1 antibody
US20190218294A1 (en) 2016-09-09 2019-07-18 Bristol-Myers Squibb Company Use of an anti-pd-1 antibody in combination with an anti-mesothelin antibody in cancer treatment
MX2019002728A (en) 2016-09-09 2019-08-16 Tg Therapeutics Inc Combination of an anti-cd20 antibody, pi3 kinase-delta inhibitor, and anti-pd-1 or anti-pd-l1 antibody for treating hematological cancers.
TWI773694B (en) 2016-10-11 2022-08-11 美商艾吉納斯公司 Anti-lag-3 antibodies and methods of use thereof
TWI788307B (en) 2016-10-31 2023-01-01 美商艾歐凡斯生物治療公司 Engineered artificial antigen presenting cells for tumor infiltrating lymphocyte expansion
CA3043124A1 (en) * 2016-11-09 2018-05-17 Engene, Inc. Intestinal expression of programmed death ligand 1
CN106496327B (en) * 2016-11-18 2019-01-15 昆山百尔泰生物科技有限公司 Human antibody or antibody fragment and purposes, nucleotide sequence and carrier for PD-L1 extracellular fragment
JOP20190100A1 (en) 2016-11-19 2019-05-01 Potenza Therapeutics Inc Anti-gitr antigen-binding proteins and methods of use thereof
EP3548083A1 (en) 2016-12-03 2019-10-09 Juno Therapeutics, Inc. Methods for modulation of car-t cells
PE20190921A1 (en) 2016-12-07 2019-06-26 Agenus Inc ANTIBODIES AND METHODS OF THEIR USE
JP6992068B2 (en) 2016-12-07 2022-02-03 アジェナス インコーポレイテッド Anti-CTLA-4 antibodies and how to use them
US10611823B2 (en) 2016-12-14 2020-04-07 Hanssen Biotech, Inc CD137 binding fibronectin type III domains
US10597438B2 (en) 2016-12-14 2020-03-24 Janssen Biotech, Inc. PD-L1 binding fibronectin type III domains
KR102568559B1 (en) 2016-12-14 2023-08-18 얀센 바이오테크 인코포레이티드 CD8A-binding fibronectin type III domain
WO2018112360A1 (en) 2016-12-16 2018-06-21 Evelo Biosciences, Inc. Combination therapies for treating cancer
WO2018112364A1 (en) 2016-12-16 2018-06-21 Evelo Biosciences, Inc. Combination therapies for treating melanoma
US11130931B2 (en) 2016-12-22 2021-09-28 The University Of Hong Kong Compositions and methods for clearing tissue
US11584733B2 (en) 2017-01-09 2023-02-21 Shuttle Pharmaceuticals, Inc. Selective histone deacetylase inhibitors for the treatment of human disease
EP4046989A1 (en) 2017-01-09 2022-08-24 Shuttle Pharmaceuticals, Inc. Selective histone deacetylase inhibitors for the treatment of human disease
MA47215A (en) 2017-01-09 2019-11-13 Bioxcel Therapeutics Inc PREDICTIVE AND DIAGNOSTIC PROCEDURES FOR PROSTATE CANCER
JP2020503883A (en) 2017-01-13 2020-02-06 アジェナス インコーポレイテッド T-cell receptor binding to NY-ESO-1 and method of using same
EP3573657A4 (en) * 2017-01-29 2021-04-14 Zequn Tang Methods of immune modulation against foreign and/or auto antigens
FI3596116T3 (en) * 2017-03-16 2023-11-09 Alpine Immune Sciences Inc Pd-l1 variant immunomodulatory proteins and uses thereof
JP2020512382A (en) * 2017-03-29 2020-04-23 グリコトープ ゲーエムベーハー PD-L1 antibody and TA-MUC1 antibody
WO2018191502A2 (en) 2017-04-13 2018-10-18 Agenus Inc. Anti-cd137 antibodies and methods of use thereof
SI3618863T1 (en) 2017-05-01 2023-12-29 Agenus Inc. Anti-tigit antibodies and methods of use thereof
BR112019023184A2 (en) 2017-05-12 2020-05-19 Jiangsu Hengrui Medicine Co fusion protein containing the tgf-¿receptor and its pharmaceutical use
JP7285220B2 (en) 2017-05-18 2023-06-01 モデルナティエックス インコーポレイテッド Lipid nanoparticles comprising linked interleukin-12 (IL12) polypeptide-encoding polynucleotides
JP2020520921A (en) 2017-05-18 2020-07-16 テサロ, インコーポレイテッド Combination therapy to treat cancer
EP3645738A4 (en) * 2017-06-25 2021-08-18 Systimmune, Inc. Anti-pd-l1 antibodies and methods of making and using thereof
CN111148996A (en) 2017-07-28 2020-05-12 百时美施贵宝公司 Predictive peripheral blood biomarkers for checkpoint inhibitors
CN111356477A (en) * 2017-08-01 2020-06-30 Ab工作室有限公司 Bispecific antibodies and uses thereof
AU2018317865B2 (en) 2017-08-18 2023-03-16 Cothera Bioscience, Inc. Polymorphic form of TG02
CA3078605A1 (en) 2017-08-28 2019-03-07 Bristol-Myers Squibb Company Tim-3 antagonists for the treatment and diagnosis of cancers
SG11202001319QA (en) 2017-09-04 2020-03-30 Agenus Inc T cell receptors that bind to mixed lineage leukemia (mll)-specific phosphopeptides and methods of use thereof
CA3075638A1 (en) 2017-09-25 2019-03-28 Chemocentryx, Inc. Combination therapy using a chemokine receptor 2 (ccr2) antagonist and a pd-1/pd-l1 inhibitor
US20230140802A1 (en) * 2017-09-27 2023-05-04 University Of Southern California Novel platforms for co-stimulation, novel car designs and other enhancements for adoptive cellular therapy
MX2020003770A (en) 2017-09-30 2020-07-29 Tesaro Inc Combination therapies for treating cancer.
MX2020003799A (en) 2017-10-06 2020-11-06 Tesaro Inc Combination therapies and uses thereof.
US11685782B2 (en) 2017-10-23 2023-06-27 Children's Medical Center Corporation Methods of treating cancer using LSD1 inhibitors in combination with immunotherapy
MA50423A (en) 2018-01-08 2020-08-26 Chemocentryx Inc SOLID TUMOR TREATMENT METHODS USING CCR2 ANTAGONISTS
US11407723B2 (en) 2018-01-09 2022-08-09 Shuttle Pharmaceuticals, Inc. Selective histone deacetylase inhibitors for the treatment of human disease
CN111278861B (en) 2018-01-10 2022-05-27 江苏恒瑞医药股份有限公司 PD-L1 antibody, antigen binding fragment thereof and medical application
US20200405806A1 (en) 2018-02-08 2020-12-31 Bristol-Myers Squibb Company Combination of a tetanus toxoid, anti-ox40 antibody and/or anti-pd-1 antibody to treat tumors
AU2019236402A1 (en) 2018-03-12 2020-10-01 Assistance Publique-Hôpitaux De Paris (Aphp) Use of caloric restriction mimetics for potentiating chemo-immunotherapy for the treatment of cancers
US20210155703A1 (en) 2018-04-04 2021-05-27 Bristol-Myers Squibb Company Anti-cd27 antibodies and uses thereof
JP7466459B2 (en) 2018-04-17 2024-04-12 セルデックス セラピューティクス インコーポレイテッド Anti-CD27 and Anti-PD-L1 Antibodies and Bispecific Constructs
US11065317B2 (en) 2018-04-26 2021-07-20 Agenus Inc. Heat shock protein-binding peptide compositions and methods of use thereof
WO2019232533A1 (en) 2018-06-01 2019-12-05 Massachusetts Institute Of Technology Combination treatments of hsp90 inhibitors for enhancing tumor immunogenicity and methods of use thereof
KR102216576B1 (en) * 2018-06-29 2021-02-17 국민대학교 산학협력단 PD-L1 Variants with Enhanced PD-1 Binding Affinity
AU2019299935A1 (en) * 2018-07-11 2021-02-18 Inc. Momenta Pharmaceuticals Compositions and methods related to engineered Fc-antigen binding domain constructs targeted to PD-L1
US20210277135A1 (en) 2018-07-13 2021-09-09 Bristol-Myers Squibb Company Ox-40 agonist, pd-1 pathway inhibitor and ctla-4 inhibitor combination for use in a method of treating a cancer or a solid tumor
TW202031273A (en) 2018-08-31 2020-09-01 美商艾歐凡斯生物治療公司 Treatment of nsclc patients refractory for anti-pd-1 antibody
WO2020048942A1 (en) 2018-09-04 2020-03-12 INSERM (Institut National de la Santé et de la Recherche Médicale) Methods and pharmaceutical compositions for enhancing cytotoxic t lymphocyte-dependent immune responses
US11331269B2 (en) 2018-09-06 2022-05-17 Massachusetts Institute Of Technology Methods and compositions targeting lung microbiota and its responding immune pathways for lung cancer treatment
AU2019349817A1 (en) * 2018-09-07 2021-03-25 The General Hospital Corporation Compositions and methods for immune checkpoint inhibition
CN109053891B (en) * 2018-09-17 2021-12-21 苏州泓迅生物科技股份有限公司 anti-PD-L1 antibody, and preparation method and application thereof
EP3853251A1 (en) 2018-09-19 2021-07-28 INSERM (Institut National de la Santé et de la Recherche Médicale) Methods and pharmaceutical composition for the treatment of cancers resistant to immune checkpoint therapy
EP3852524B1 (en) 2018-09-20 2023-06-28 Iovance Biotherapeutics, Inc. Expansion of tils from cryopreserved tumor samples
WO2020070053A1 (en) 2018-10-01 2020-04-09 INSERM (Institut National de la Santé et de la Recherche Médicale) Use of inhibitors of stress granule formation for targeting the regulation of immune responses
EP3864046A1 (en) 2018-10-09 2021-08-18 Bristol-Myers Squibb Company Anti-mertk antibodies for treating cancer
WO2020081493A1 (en) 2018-10-16 2020-04-23 Molecular Templates, Inc. Pd-l1 binding proteins
US20220001026A1 (en) 2018-11-08 2022-01-06 Modernatx, Inc. Use of mrna encoding ox40l to treat cancer in human patients
TWI829799B (en) 2018-11-09 2024-01-21 大陸商江蘇恆瑞醫藥股份有限公司 A PHARMACEUTICAL COMPOSITION COMPRISING TGF-β RECEPTOR FUSION PROTEIN AND THE USE THEREOF
US20210388091A1 (en) 2018-11-14 2021-12-16 Regeneron Pharmaceuticals, Inc. Intralesional administration of pd-1 inhibitors for treating skin cancer
BR112021007448A2 (en) 2018-11-14 2021-10-26 Bayer Aktiengesellschaft PHARMACEUTICAL COMBINATION OF ANTI-CEACAM6 AND ANTI-PD-1 OR ANTI-PD-L1 ANTIBODIES FOR THE TREATMENT OF CANCER
CA3119341A1 (en) 2018-11-16 2020-05-22 Neoimmunetech, Inc. Method of treating a tumor with a combination of il-7 protein and an immune checkpoint inhibitor
SG11202104900SA (en) 2018-11-20 2021-06-29 Univ Cornell Macrocyclic complexes of radionuclides and their use in radiotherapy of cancer
EP3887823B1 (en) 2018-11-28 2024-01-17 Institut National de la Santé et de la Recherche Médicale (INSERM) Methods and kit for assaying lytic potential of immune effector cells
EP3891270A1 (en) 2018-12-07 2021-10-13 Institut National de la Santé et de la Recherche Médicale (INSERM) Use of cd26 and cd39 as new phenotypic markers for assessing maturation of foxp3+ t cells and uses thereof for diagnostic purposes
US20220047556A1 (en) 2018-12-17 2022-02-17 INSERM (Institut National de la Santé et de la Recherche Médicale) Use of sulconazole as a furin inhibitor
EP3911670A1 (en) 2019-01-15 2021-11-24 INSERM (Institut National de la Santé et de la Recherche Médicale) Mutated interleukin-34 (il-34) polypeptides and uses thereof in therapy
CN113365659B (en) * 2019-01-31 2023-08-18 正大天晴药业集团股份有限公司 Use of anti-PD-L1 antibodies for the treatment of head and neck cancer
WO2020169472A2 (en) 2019-02-18 2020-08-27 INSERM (Institut National de la Santé et de la Recherche Médicale) Methods of inducing phenotypic changes in macrophages
CN113710270A (en) 2019-02-19 2021-11-26 迈斯特治疗公司 Methods of generating autologous T cells useful for treating cancer and compositions thereof
MA55084A (en) 2019-02-28 2022-01-05 Regeneron Pharma ADMINISTRATION OF PD-1 INHIBITORS FOR THE TREATMENT OF SKIN CANCER
EP3935085A1 (en) 2019-03-06 2022-01-12 Regeneron Pharmaceuticals, Inc. Il-4/il-13 pathway inhibitors for enhanced efficacy in treating cancer
JP2022527298A (en) 2019-03-26 2022-06-01 ザ リージェンツ オブ ザ ユニヴァシティ オブ ミシガン STAT3 small molecule decomposition inducer
US20220185831A1 (en) 2019-03-29 2022-06-16 The Regents Of The University Of Michigan Stat3 protein degraders
EP3946437A1 (en) 2019-03-29 2022-02-09 Myst Therapeutics, LLC Ex vivo methods for producing a t cell therapeutic and related compositions and methods
WO2020201362A2 (en) 2019-04-02 2020-10-08 INSERM (Institut National de la Santé et de la Recherche Médicale) Methods of predicting and preventing cancer in patients having premalignant lesions
EP3952850A1 (en) 2019-04-09 2022-02-16 Institut National de la Santé et de la Recherche Médicale (INSERM) Use of sk2 inhibitors in combination with immune checkpoint blockade therapy for the treatment of cancer
SG11202109441UA (en) 2019-04-12 2021-09-29 Vascular Biogenics Ltd Methods of anti-tumor therapy
EP3956446A1 (en) 2019-04-17 2022-02-23 INSERM (Institut National de la Santé et de la Recherche Médicale) Methods and compositions for treatment of nlrp3 inflammasome mediated il-1beta dependent disorders
WO2020227431A1 (en) * 2019-05-06 2020-11-12 Brown University Bispecific antibodies against chi3l1 and pd1 with enhanced t cell-mediated cytotoxic effects on tumor cells
EP3983377A1 (en) 2019-06-12 2022-04-20 Vanderbilt University Dibenzylamines as amino acid transport inhibitors
CA3141405A1 (en) 2019-06-12 2020-12-17 H. Charles Manning Amino acid transport inhibitors and the uses thereof
EP3999510A1 (en) 2019-07-16 2022-05-25 The Regents Of The University Of Michigan Imidazopyrimidines as eed inhibitors and the use thereof
WO2021024020A1 (en) 2019-08-06 2021-02-11 Astellas Pharma Inc. Combination therapy involving antibodies against claudin 18.2 and immune checkpoint inhibitors for treatment of cancer
AU2020336381A1 (en) 2019-08-27 2022-03-03 The Regents Of The University Of Michigan Cereblon E3 ligase inhibitors
WO2021042019A1 (en) 2019-08-30 2021-03-04 Agenus Inc. Anti-cd96 antibodies and methods of use thereof
CN114423793A (en) 2019-09-18 2022-04-29 分子模板公司 PD-L1 binding molecules comprising Shiga toxin A subunit scaffolds
WO2021055816A1 (en) 2019-09-18 2021-03-25 Molecular Templates, Inc. Pd-l1 binding molecules comprising shiga toxin a subunit scaffolds
CN115023267A (en) 2019-09-19 2022-09-06 密歇根大学董事会 Spirocyclic androgen receptor protein degrading agents
EP3800201A1 (en) 2019-10-01 2021-04-07 INSERM (Institut National de la Santé et de la Recherche Médicale) Cd28h stimulation enhances nk cell killing activities
US20220363776A1 (en) 2019-10-04 2022-11-17 INSERM (Institut National de la Santé et de la Recherche Médicale) Methods and pharmaceutical composition for the treatment of ovarian cancer, breast cancer or pancreatic cancer
US11781138B2 (en) 2019-10-14 2023-10-10 Aro Biotherapeutics Company FN3 domain-siRNA conjugates and uses thereof
EP4045061A4 (en) 2019-10-14 2024-04-17 Aro Biotherapeutics Company Cd71 binding fibronectin type iii domains
JP2023504042A (en) 2019-11-27 2023-02-01 ミスト セラピューティクス リミテッド ライアビリティ カンパニー Methods of generating tumor-reactive T-cell compositions using modulators
JP2023516636A (en) 2020-02-27 2023-04-20 ミスト セラピューティクス リミテッド ライアビリティ カンパニー Methods for ex vivo enrichment and expansion of tumor-reactive T cells and related compositions thereof
PE20230821A1 (en) 2020-03-23 2023-05-19 Bristol Myers Squibb Co ANTI-CCR8 ANTIBODIES FOR THE TREATMENT OF CANCER
WO2021195481A1 (en) 2020-03-26 2021-09-30 The Regents Of The University Of Michigan Small molecule stat protein degraders
MX2022013065A (en) 2020-04-22 2022-12-08 Iovance Biotherapeutics Inc Systems and methods for coordinating manufacturing of cells for patient-specific immunotherapy.
BR112022024063A2 (en) 2020-05-26 2023-01-31 Inst Nat Sante Rech Med CORONAVIRUS 2 POLYPEPTIDES OF SEVERE ACUTE RESPIRATORY SYNDROME (SARS-COV-2) AND USES THEREOF FOR VACCINE PURPOSES
JP7240512B2 (en) 2020-05-26 2023-03-15 リジェネロン・ファーマシューティカルズ・インコーポレイテッド Methods of treating cervical cancer by administering a PD-1 inhibitor
EP4157319A1 (en) 2020-05-28 2023-04-05 Modernatx, Inc. Use of mrnas encoding ox40l, il-23 and il-36gamma for treating cancer
CA3182579A1 (en) 2020-07-07 2022-01-13 Ugur Sahin Therapeutic rna for hpv-positive cancer
WO2022011205A1 (en) 2020-07-10 2022-01-13 The Regents Of The University Of Michigan Androgen receptor protein degraders
WO2022011204A1 (en) 2020-07-10 2022-01-13 The Regents Of The University Of Michigan Small molecule androgen receptor protein degraders
AU2021332246A1 (en) 2020-08-26 2023-04-20 Regeneron Pharmaceuticals, Inc. Methods of treating cancer by administering a pd-1 inhibitor
CN111808196B (en) * 2020-08-31 2020-12-29 北京百奥赛图基因生物技术有限公司 anti-PD-1 antibodies and uses thereof
US11932692B2 (en) 2020-09-03 2024-03-19 Regeneron Pharmaceuticals, Inc. Methods of treating cancer pain by administering a PD-1 inhibitor
CN111920948B (en) * 2020-09-25 2021-02-02 安可瑞(山西)生物细胞有限公司 Pharmaceutical composition comprising immune cells for treating cancer
MX2023005570A (en) 2020-11-12 2023-05-29 Inst Nat Sante Rech Med Antibodies conjugated or fused to the receptor-binding domain of the sars-cov-2 spike protein and uses thereof for vaccine purposes.
WO2022101463A1 (en) 2020-11-16 2022-05-19 INSERM (Institut National de la Santé et de la Recherche Médicale) Use of the last c-terminal residues m31/41 of zikv m ectodomain for triggering apoptotic cell death
TW202245808A (en) 2020-12-21 2022-12-01 德商拜恩迪克公司 Therapeutic rna for treating cancer
WO2022135667A1 (en) 2020-12-21 2022-06-30 BioNTech SE Therapeutic rna for treating cancer
WO2022135666A1 (en) 2020-12-21 2022-06-30 BioNTech SE Treatment schedule for cytokine proteins
WO2022156727A1 (en) 2021-01-21 2022-07-28 浙江养生堂天然药物研究所有限公司 Composition and method for treating tumors
WO2022187419A1 (en) 2021-03-03 2022-09-09 The Regents Of The University Of Michigan Small molecule degraders of androgen receptor
WO2022187423A1 (en) 2021-03-03 2022-09-09 The Regents Of The University Of Michigan Cereblon ligands
WO2022204672A1 (en) 2021-03-23 2022-09-29 Regeneron Pharmaceuticals, Inc. Methods of treating cancer in immunosuppressed or immunocompromised patients by administering a pd-1 inhibitor
TW202304506A (en) 2021-03-25 2023-02-01 日商安斯泰來製藥公司 Combination therapy involving antibodies against claudin 18.2 for treatment of cancer
CN117396222A (en) 2021-05-21 2024-01-12 天津立博美华基因科技有限责任公司 Pharmaceutical combination and use thereof
WO2022251853A1 (en) 2021-05-25 2022-12-01 Edelweiss Immune Inc C-x-c motif chemokine receptor 6 (cxcr6) binding molecules, and methods of using the same
AU2022280921A1 (en) 2021-05-26 2023-12-07 Centro De Inmunologia Molecular Use of therapeutic compositions for the treatment of patients with tumours of epithelial origin
EP4367269A1 (en) 2021-07-05 2024-05-15 Inserm (Institut National De La Sante Et De La Recherche Medicale) Gene signatures for predicting survival time in patients suffering from renal cell carcinoma
AU2022312698A1 (en) 2021-07-13 2024-01-25 BioNTech SE Multispecific binding agents against cd40 and cd137 in combination therapy for cancer
US20230139492A1 (en) 2021-07-19 2023-05-04 Regeneron Pharmaceuticals, Inc. Combination of checkpoint inhibitors and an oncolytic virus for treating cancer
CA3230117A1 (en) 2021-09-02 2023-03-09 Mark Trautwein Anti-cecam6 antibodies with reduced side-effects
WO2023051926A1 (en) 2021-09-30 2023-04-06 BioNTech SE Treatment involving non-immunogenic rna for antigen vaccination and pd-1 axis binding antagonists
TW202333802A (en) 2021-10-11 2023-09-01 德商拜恩迪克公司 Therapeutic rna for lung cancer
AU2022377637A1 (en) 2021-10-28 2024-05-02 Lyell Immunopharma, Inc. Methods for culturing immune cells
WO2023083439A1 (en) 2021-11-09 2023-05-19 BioNTech SE Tlr7 agonist and combinations for cancer treatment
WO2023088968A1 (en) 2021-11-17 2023-05-25 INSERM (Institut National de la Santé et de la Recherche Médicale) Universal sarbecovirus vaccines
WO2023130081A1 (en) 2021-12-30 2023-07-06 Neoimmunetech, Inc. Method of treating a tumor with a combination of il-7 protein and vegf antagonist
WO2023159102A1 (en) 2022-02-17 2023-08-24 Regeneron Pharmaceuticals, Inc. Combinations of checkpoint inhibitors and oncolytic virus for treating cancer
KR20230130911A (en) 2022-03-04 2023-09-12 주식회사 온코인사이트 Pharmaceutical composition for combination therapy for cancer prevention or treatment
WO2023196988A1 (en) 2022-04-07 2023-10-12 Modernatx, Inc. Methods of use of mrnas encoding il-12
WO2024052356A1 (en) 2022-09-06 2024-03-14 Institut National de la Santé et de la Recherche Médicale Inhibitors of the ceramide metabolic pathway for overcoming immunotherapy resistance in cancer
CN116077645A (en) * 2022-12-28 2023-05-09 广州誉衡生物科技有限公司 anti-PD-1 antibodies and their use in the preparation of a medicament for treating non-small cell lung cancer patients

Citations (30)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
EP0404097A2 (en) 1989-06-22 1990-12-27 BEHRINGWERKE Aktiengesellschaft Bispecific and oligospecific, mono- and oligovalent receptors, production and applications thereof
WO1991010741A1 (en) 1990-01-12 1991-07-25 Cell Genesys, Inc. Generation of xenogeneic antibodies
WO1993011161A1 (en) 1991-11-25 1993-06-10 Enzon, Inc. Multivalent antigen-binding proteins
US5500362A (en) 1987-01-08 1996-03-19 Xoma Corporation Chimeric antibody with specificity to human B cell surface antigen
US5545806A (en) 1990-08-29 1996-08-13 Genpharm International, Inc. Ransgenic non-human animals for producing heterologous antibodies
US5545807A (en) 1988-10-12 1996-08-13 The Babraham Institute Production of antibodies from transgenic animals
US5569825A (en) 1990-08-29 1996-10-29 Genpharm International Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
WO1996033735A1 (en) 1995-04-27 1996-10-31 Abgenix, Inc. Human antibodies derived from immunized xenomice
WO1996034096A1 (en) 1995-04-28 1996-10-31 Abgenix, Inc. Human antibodies derived from immunized xenomice
US5625126A (en) 1990-08-29 1997-04-29 Genpharm International, Inc. Transgenic non-human animals for producing heterologous antibodies
US5633425A (en) 1990-08-29 1997-05-27 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
US5641870A (en) 1995-04-20 1997-06-24 Genentech, Inc. Low pH hydrophobic interaction chromatography for antibody purification
US5661016A (en) 1990-08-29 1997-08-26 Genpharm International Inc. Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
WO1998024893A2 (en) 1996-12-03 1998-06-11 Abgenix, Inc. TRANSGENIC MAMMALS HAVING HUMAN IG LOCI INCLUDING PLURAL VH AND Vλ REGIONS AND ANTIBODIES PRODUCED THEREFROM
US5821337A (en) 1991-06-14 1998-10-13 Genentech, Inc. Immunoglobulin variants
US6075181A (en) 1990-01-12 2000-06-13 Abgenix, Inc. Human antibodies derived from immunized xenomice
US6150584A (en) 1990-01-12 2000-11-21 Abgenix, Inc. Human antibodies derived from immunized xenomice
WO2001014557A1 (en) 1999-08-23 2001-03-01 Dana-Farber Cancer Institute, Inc. Pd-1, a receptor for b7-4, and uses therefor
WO2002086083A2 (en) 2001-04-20 2002-10-31 Mayo Foundation For Medical Education And Research Methods of enhancing cell responsiveness
WO2004042072A2 (en) 2002-11-01 2004-05-21 The Regents Of The University Of Colorado, A Body Corporate Quantitative analysis of protein isoforms using matrix-assisted laser desorption/ionization time of flight mass spectrometry
WO2004092219A2 (en) 2003-04-10 2004-10-28 Protein Design Labs, Inc Alteration of fcrn binding affinities or serum half-lives of antibodies by mutagenesis
EP1537878A1 (en) * 2002-07-03 2005-06-08 Ono Pharmaceutical Co., Ltd. Immunopotentiating compositions
US6982321B2 (en) 1986-03-27 2006-01-03 Medical Research Council Altered antibodies
US7087409B2 (en) 1997-12-05 2006-08-08 The Scripps Research Institute Humanization of murine antibody
WO2007005874A2 (en) 2005-07-01 2007-01-11 Medarex, Inc. Human monoclonal antibodies to programmed death ligand 1 (pd-l1)
WO2008083174A2 (en) * 2006-12-27 2008-07-10 Emory University Compositions and methods for the treatment of infections and tumors
WO2010036959A2 (en) 2008-09-26 2010-04-01 Dana-Farber Cancer Institute Human anti-pd-1, pd-l1, and pd-l2 antibodies and uses therefor
WO2010077634A1 (en) 2008-12-09 2010-07-08 Genentech, Inc. Anti-pd-l1 antibodies and their use to enhance t-cell function
WO2011066389A1 (en) 2009-11-24 2011-06-03 Medimmmune, Limited Targeted binding agents against b7-h1

Family Cites Families (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JP2008515774A (en) * 2004-08-03 2008-05-15 ダイアックス コーポレイション hK1 binding protein
KR101050829B1 (en) * 2008-10-02 2011-07-20 서울대학교산학협력단 Anticancer agents comprising an anti-PD-1 antibody or an anti-PD-L1 antibody
US9115388B2 (en) * 2011-11-01 2015-08-25 H. Lee Moffitt Cancer Center And Research Institute, Inc. Gene signature for the prediction of NF-kappaB activity
AU2012344260B2 (en) 2011-11-28 2017-09-07 Merck Patent Gmbh Anti-PD-L1 antibodies and uses thereof
KR20170132171A (en) * 2015-02-26 2017-12-01 메르크 파텐트 게엠베하 Pd-1 / pd-l1 inhibitors for the treatment of cancer
KR20180018762A (en) * 2015-06-16 2018-02-21 메르크 파텐트 게엠베하 Pd-l1 antagonist combination treatments
US20180282415A1 (en) * 2015-09-30 2018-10-04 Merck Patent Gmbh Combination of a PD-1 Axis Binding Antagonist and an ALK Inhibitor for Treating ALK-Negative Cancer
MX2018006875A (en) * 2015-12-07 2018-11-09 Merck Patent Gmbh Aqueous pharmaceutical formulation comprising anti-pd-1 antibody avelumab.
SG11201810423XA (en) * 2016-05-26 2018-12-28 Merck Patent Gmbh Pd-1 / pd-l1 inhibitors for cancer treatment

Patent Citations (30)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
US6982321B2 (en) 1986-03-27 2006-01-03 Medical Research Council Altered antibodies
US5500362A (en) 1987-01-08 1996-03-19 Xoma Corporation Chimeric antibody with specificity to human B cell surface antigen
US5545807A (en) 1988-10-12 1996-08-13 The Babraham Institute Production of antibodies from transgenic animals
EP0404097A2 (en) 1989-06-22 1990-12-27 BEHRINGWERKE Aktiengesellschaft Bispecific and oligospecific, mono- and oligovalent receptors, production and applications thereof
US6075181A (en) 1990-01-12 2000-06-13 Abgenix, Inc. Human antibodies derived from immunized xenomice
US6150584A (en) 1990-01-12 2000-11-21 Abgenix, Inc. Human antibodies derived from immunized xenomice
WO1991010741A1 (en) 1990-01-12 1991-07-25 Cell Genesys, Inc. Generation of xenogeneic antibodies
US5545806A (en) 1990-08-29 1996-08-13 Genpharm International, Inc. Ransgenic non-human animals for producing heterologous antibodies
US5569825A (en) 1990-08-29 1996-10-29 Genpharm International Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
US5625126A (en) 1990-08-29 1997-04-29 Genpharm International, Inc. Transgenic non-human animals for producing heterologous antibodies
US5633425A (en) 1990-08-29 1997-05-27 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
US5661016A (en) 1990-08-29 1997-08-26 Genpharm International Inc. Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
US5821337A (en) 1991-06-14 1998-10-13 Genentech, Inc. Immunoglobulin variants
WO1993011161A1 (en) 1991-11-25 1993-06-10 Enzon, Inc. Multivalent antigen-binding proteins
US5641870A (en) 1995-04-20 1997-06-24 Genentech, Inc. Low pH hydrophobic interaction chromatography for antibody purification
WO1996033735A1 (en) 1995-04-27 1996-10-31 Abgenix, Inc. Human antibodies derived from immunized xenomice
WO1996034096A1 (en) 1995-04-28 1996-10-31 Abgenix, Inc. Human antibodies derived from immunized xenomice
WO1998024893A2 (en) 1996-12-03 1998-06-11 Abgenix, Inc. TRANSGENIC MAMMALS HAVING HUMAN IG LOCI INCLUDING PLURAL VH AND Vλ REGIONS AND ANTIBODIES PRODUCED THEREFROM
US7087409B2 (en) 1997-12-05 2006-08-08 The Scripps Research Institute Humanization of murine antibody
WO2001014557A1 (en) 1999-08-23 2001-03-01 Dana-Farber Cancer Institute, Inc. Pd-1, a receptor for b7-4, and uses therefor
WO2002086083A2 (en) 2001-04-20 2002-10-31 Mayo Foundation For Medical Education And Research Methods of enhancing cell responsiveness
EP1537878A1 (en) * 2002-07-03 2005-06-08 Ono Pharmaceutical Co., Ltd. Immunopotentiating compositions
WO2004042072A2 (en) 2002-11-01 2004-05-21 The Regents Of The University Of Colorado, A Body Corporate Quantitative analysis of protein isoforms using matrix-assisted laser desorption/ionization time of flight mass spectrometry
WO2004092219A2 (en) 2003-04-10 2004-10-28 Protein Design Labs, Inc Alteration of fcrn binding affinities or serum half-lives of antibodies by mutagenesis
WO2007005874A2 (en) 2005-07-01 2007-01-11 Medarex, Inc. Human monoclonal antibodies to programmed death ligand 1 (pd-l1)
WO2008083174A2 (en) * 2006-12-27 2008-07-10 Emory University Compositions and methods for the treatment of infections and tumors
WO2010036959A2 (en) 2008-09-26 2010-04-01 Dana-Farber Cancer Institute Human anti-pd-1, pd-l1, and pd-l2 antibodies and uses therefor
WO2010077634A1 (en) 2008-12-09 2010-07-08 Genentech, Inc. Anti-pd-l1 antibodies and their use to enhance t-cell function
WO2011066389A1 (en) 2009-11-24 2011-06-03 Medimmmune, Limited Targeted binding agents against b7-h1

Non-Patent Citations (114)

* Cited by examiner, † Cited by third party
Title
"Basic and Clinical Immunology", 1994, APPLETON & LANGE, pages: 71
"Peptide and Protein Drug Delivery", 1991, MARCEL DEKKER, INC., pages: 247 - 301
BARBAS ET AL., PROC NAT. ACAD. SCL USA, vol. 91, 1994, pages 3809 - 3813
BLANK CHRISTIAN ET AL: "Blockade of PD-L1 (B7-H1) augments human tumor-specific T cell responses in vitro", INTERNATIONAL JOURNAL OF CANCER, JOHN WILEY & SONS, INC, NEW YORK, NY; US, vol. 119, no. 2, 1 July 2006 (2006-07-01), pages 317 - 327, XP002557386, ISSN: 0020-7136, DOI: 10.1002/IJC.21775 *
BOERNER, J. IMMUNOL, vol. 147, no. 1, 1991, pages 86 - 95
BOETTLER ET AL., J. VIROL., vol. 80, 2006, pages 3532 - 40
BRUGGEMANN ET AL., YEAR IN IMMUNOL., vol. 7, 1993, pages 33
BULLOCK, A. N. ET AL.: "Thermodynamic stability of wild-type and mutant p53 core domain", PNAS, vol. 94, 1997, pages 14338 - 14342
BUTTE ET AL., IMMUNITY, vol. 27, 2007, pages 111 - 22
CAPEL ET AL., IMMUNOMETHODS, vol. 4, 1994, pages 25 - 34
CARTER ET AL., EUR. J. IMMUNOL., vol. 32, 2002, pages 634 - 43
CHEN ET AL., J. MOL BIOL, vol. 293, 1999, pages 865 - 881
CHEN ET AL., J. MOL. BIOL., vol. 293, 1999, pages 865 - 881
CHEN, Y. ET AL., J. MOL BIOL, vol. 293, 1999, pages 865 - 881
CHOTHIA; LESK, J. MOL. BIOL., vol. 196, 1987, pages 901 - 917
CLACKSON ET AL., NATURE, vol. 352, 1991, pages 624 - 628
CLYNES, PNAS USA, vol. 95, 1998, pages 652 - 656
COLE: "Monoclonal Antibodies and Cancer Therapy", 1985, ALAN R. LISS, pages: 77
DE HAAS, J. LAB. CLIN. MED., vol. 126, 1995, pages 330 - 41
DONG HAIDONG ET AL: "Tumor-associated B7-H1 promotes T-cell apoptosis: a potential mechanism of immune evasion", NATURE MEDICINE, NATURE PUBLISHING GROUP, NEW YORK, NY, US, vol. 8, no. 8, 24 June 2002 (2002-06-24), pages 793 - 800, XP002397368, ISSN: 1078-8956 *
DONG, NATURE MED., vol. 5, 1999, pages 1365 - 1369
EPPIHIMER ET AL., MICROCIRCULATION, vol. 9, 2002, pages 133 - 45
FELLOUSE, PROC. NATL. ACAD. SCL USA, vol. 101, no. 34, 2004, pages 12467 - 12472
FISHWILD ET AL., NATURE BIOTECHNOL, vol. 14, 1996, pages 845 - 851
FREEMAN ET AL., J. EXP. MED., vol. 192, 2000, pages 1 - 9
FREEMAN ET AL., J. EXP. MED., vol. 192, 2000, pages 1027 - 34
GHETIE ET AL., NATURE BIOTECHNOLOGY, vol. 15, no. 7, 1997, pages 637 - 40
GHETIE; WARD, IMMUNOL. TODAY, vol. 18, no. 12, 1997, pages 592 - 8
GIBBS, W. WAYT: "Nanobodies", SCIENTIFIC AMERICAN MAGAZINE, August 2005 (2005-08-01)
GUYER ET AL., J. IMMUNOL., vol. 117, 1976, pages 587
HAMERS-CASTERMAN ET AL., NATURE, vol. 363, 1993, pages 446 - 448
HAMMERLING: "Monoclonal Antibodies and T-Cell Hybridomas", 1981, ELSEVIER, pages: 563 - 681
HARLOW ET AL.: "Antibodies: A Laboratory Manual", 1988, COLD SPRING HARBOR LABORATORY PRESS
HARRIS, BIOCHEM. SOC. TRANSACTIONS, vol. 23, 1995, pages 1035 - 1038
HAWKINS ET AL., J. MOL. BIOL., vol. 226, 1992, pages 889 - 896
HECKMAN ET AL., EUR. J. IMMUNOL., vol. 37, 2007, pages 1827 - 35
HINTON, J. BIOL. CHEM., vol. TJI, no. 8, 2004, pages 6213 - 6
HOLLINGER ET AL., PROC. NATL. ACAD. SCL USA, vol. 90, 1993, pages 6444 - 6448
HOLT L J ET AL: "Domain antibodies: proteins for therapy", TRENDS IN BIOTECHNOLOGY, ELSEVIER PUBLICATIONS, CAMBRIDGE, GB, vol. 21, no. 11, 1 November 2003 (2003-11-01), pages 484 - 490, XP004467495, ISSN: 0167-7799, DOI: 10.1016/J.TIBTECH.2003.08.007 *
HONGO, HYBRIDOMA, vol. 14, no. 3, 1995, pages 253 - 260
HOOGENBOOM; WINTER, J. MOL. BIOL, vol. 227, 1991, pages 381
HURLE; GROSS, CURR. OP. BIOTECH., vol. 5, 1994, pages 428 - 433
IWAI YOSHIKO ET AL: "Involvement of PD-L1 on tumor cells in the escape from host immune system and tumor immunotherapy by PD-L1 blockade", PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES, NATIONAL ACADEMY OF SCIENCES, US, vol. 99, no. 19, 17 September 2002 (2002-09-17), pages 12293 - 12297, XP002398159, ISSN: 0027-8424, DOI: 10.1073/PNAS.192461099 *
JACKSON ET AL., J. IMMUNOL., vol. 154, no. 7, 1995, pages 3310 - 9
JAKOBOVITS ET AL., NATURE, vol. 362, 1993, pages 255 - 258
JAKOBOVITS ET AL., PROC. NATL. ACAD. SCL USA, vol. 90, 1993, pages 2551
JOHNSON; WU: "Methods in Molecular Biology", vol. 248, 2003, HUMAN PRESS, pages: 1 - 25
JONES ET AL., NATURE, vol. 321, 1986, pages 522 - 525
JONES, A., ADV. DRUG DELIVERY REV., vol. 10, 1993, pages 29 - 90
KABAT ET AL.: "Sequences of Proteins of Immunological Interest", 1991
KABAT ET AL.: "Sequences of Proteins of Immunological Interest", 1991, NATIONAL INSTITUTES OF HEALTH
KABAT: "Sequences of Immunological Interest", 1991, NATIONAL INSTITUTE OF HEALTH
KEIR, ANNU. REV. IMMUNOL., vol. 26, 2008, pages 677 - 704
KIM ET AL., J. IMMUNOL., vol. 24, 1994, pages 249
KOHLER; MILSTEIN, NATURE, vol. 256, 1975, pages 495 - 97
KUIPERS ET AL., EUR. J. IMMUNOL., vol. 36, 2006, pages 2472 - 82
L. ZHANG ET AL: "PD-1/PD-L1 interactions inhibit antitumor immune responses in a murine acute myeloid leukemia model", BLOOD, vol. 114, no. 8, 20 August 2009 (2009-08-20), pages 1545 - 1552, XP055053821, ISSN: 0006-4971, DOI: 10.1182/blood-2009-03-206672 *
LATCHMAN ET AL., NATURE IMMUNOL, vol. 2, 2001, pages 261 - 268
LATCHMAN ET AL., PROC. NATL. ACAD. SCI. USA, vol. 101, 2004, pages 10691 - 96
LEE ET AL., FEBS LETT, vol. 580, 2006, pages 755 - 62
LEE ET AL., J. IMMUNOL. METHODS, vol. 284, no. 1-2, 2004, pages 119 - 132
LEE ET AL., J. MOL BIOL., vol. 340, no. 5, 2004, pages 1073 - 1093
LI, PROC. NATL. ACAD. SCI. USA, vol. 103, 2006, pages 3557 - 3562
LIANG, EUR. J. IMMUNOL., vol. 33, 2003, pages 2706 - 16
LIN, D.Y.-W. ET AL., PNAS, vol. 105, 2008, pages 3011 - 6
LIU ET AL., BLOOD, vol. HO, 2007, pages 296 - 304
LIU, BLOOD, vol. HO, 2007, pages 296 - 304
LOKE ET AL., PNAS, vol. 100, 2003, pages 5336 - 41
LONBERG ET AL., NATURE, vol. 368, 1994, pages 856 - 859
LONBERG; HUSZAR, INTERN. REV. IMMUNOL., vol. 13, 1995, pages 65 - 93
M. DAERON, ANNU. REV. IMMUNOL., vol. 15, 1997, pages 203 - 234
M. V. GOLDBERG ET AL: "Role of PD-1 and its ligand, B7-H1, in early fate decisions of CD8 T cells", BLOOD, vol. 110, no. 1, 1 July 2007 (2007-07-01), pages 186 - 192, XP055053809, ISSN: 0006-4971, DOI: 10.1182/blood-2006-12-062422 *
MARKS ET AL., BIOFTECHNOLOGY, vol. 10, 1992, pages 779 - 783
MARKS ET AL., BIORRECHNOLOGY, vol. 10, 1992, pages 779 - 783
MARKS, J. MOL BIOL., vol. 222, 1992, pages 581 - 597
MARKS, J. MOL. BIOL, vol. 222, 1991, pages 581
MORRISON ET AL., PROC. NATL. ACAD. SCL USA, vol. 81, 1984, pages 6851 - 6855
MORRISON, NATURE, vol. 368, 1994, pages 812 - 813
NEUBERGER, NATURE BIOTECHNOL., vol. 14, 1996, pages 826
NGUYEN ET AL., J. EXP. MED., vol. 196, 2002, pages 1393 - 98
NICOLAOU, ANGEW. CHEM INTL. ED. ENGL., vol. 33, 1994, pages 183 - 186
NIELSEN ET AL., CELL. LMMUNOL., vol. 235, 2005, pages 109 - 16
NISHIMURA ET AL., IMMUNITY JJ., 1999, pages 141 - 51
NISHIMURA ET AL., INT. IMMUNOL., vol. 8, 1996, pages 773 - 80
NISHIMURA ET AL., SCIENCE, vol. 291, 2001, pages 319 - 22
NOMI TAKEO ET AL: "Clinical significance and therapeutic potential of the programmed death-1 ligand/programmed death-1 pathway in human pancreatic cancer", CLINICAL CANCER RESEARCH, THE AMERICAN ASSOCIATION FOR CANCER RESEARCH, US, vol. 13, no. 7, 1 April 2007 (2007-04-01), pages 2151 - 2157, XP002533527, ISSN: 1078-0432, DOI: 10.1158/1078-0432.CCR-06-2746 *
OKUDAIRA: "Blockade of B7-H1 or B7-DC induces an anti-tumor effect in a mouse pancreatic cancer model", INTERNATIONAL JOURNAL OF ONCOLOGY, vol. 35, no. 4, 1 September 2009 (2009-09-01), XP055052567, ISSN: 1019-6439, DOI: 10.3892/ijo_00000387 *
PARSA, NAT. MED., vol. 13, 2007, pages 84 - 88
PLUCKTHUN: "The Pharmacology of Monoclonal Antibodies", vol. 113, 1994, SPRINGER- VERLAG, pages: 269 - 315
PRESTA ET AL., CANCER RES., vol. 57, 1997, pages 4593 - 4599
PRESTA, CURR. OP. STRUCT. BIOL., vol. 2, 1992, pages 593 - 596
RADHAKRISHNAN ET AL., CANCER RES., vol. 64, 2004, pages 4965 - 72
RADHAKRISHNAN ET AL., J. ALLERGY CLIN. IMMUNOL., 2005, pages 668 - 74
RADHAKRISHNAN ET AL., J. IMMUNOL., vol. 170, 2003, pages 1830 - 38
RADHAKRISHNAN, J. LMMUNOL., vol. 173, 2004, pages 1360 - 65
RAVETCH; KINET, ANNU. REV. IMMUNOL., vol. 9, 1991, pages 457 - 92
RIECHMANN ET AL., NATURE, vol. 332, 1988, pages 323 - 329
SCHIER ET AL., GENE, vol. 169, 1995, pages 147 - 155
SCHREINER ET AL., J. NEUROIMMUNOL, vol. 155, 2004, pages 172 - 82
SHERIFF ET AL., NATURE STRUCT. BIOL., vol. 3, 1996, pages 733 - 736
SHIELDS ET AL., J. BIOL. CHEM., vol. 9, no. 2, 2001, pages 6591 - 6604
SIDHU ET AL., J. MOL BIOL., vol. 338, no. 2, 2004, pages 299 - 310
SOPHIE R. SIERRO ET AL: "Combination of lentivector immunization and low-dose chemotherapy or PD-1/PD-L1 blocking primes self-reactive T cells and induces anti-tumor immunity", EUROPEAN JOURNAL OF IMMUNOLOGY, vol. 41, no. 8, 1 August 2011 (2011-08-01), pages 2217 - 2228, XP055053701, ISSN: 0014-2980, DOI: 10.1002/eji.201041235 *
TSENG, J. EXP. MED., vol. 193, 2001, pages 839 - 846
UEDA ET AL., NATURE, vol. 423, 2003, pages 506 - 11
VAN DIJK; VAN DE WINKEL, CURR. OPIN. PHARMACOL, vol. 5, 2001, pages 368 - 74
VASWANI; HAMILTON, ANN. ALLERGY, ASTHMA & IMMUNOL., vol. 1, 1998, pages 105 - 115
WAN ET AL., J. IMMUNOL., vol. 177, 2006, pages 8844 - 50
WELLS. J.A., PNAS, vol. 93, 1996, pages 1 - 6
XU ET AL., IMMUNITY, vol. 13, 2000, pages 37 - 45
YAMAZAKI ET AL., J. IMMUNOL., vol. 169, 2002, pages 5538 - 45
YDXON ET AL., J. IMMUNOL., vol. 155, 1995, pages 1994 - 2004
ZAPATA ET AL., PROTEIN ENG., 1995, pages 1057 - 1062
ZHONG ET AL., EUR. J. IMMUNOL., vol. 37, 2007, pages 2405 - 10

Cited By (919)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US9920123B2 (en) 2008-12-09 2018-03-20 Genentech, Inc. Anti-PD-L1 antibodies, compositions and articles of manufacture
US11142800B2 (en) 2010-10-07 2021-10-12 The General Hospital Corporation Biomarkers of cancer
US11753454B2 (en) 2011-06-24 2023-09-12 Cytune Pharma IL-15 and IL-15R\alpha sushi domain based immunocytokines
US10626155B2 (en) 2011-06-24 2020-04-21 Cytune Pharma IL-15 and IL-15R\alpha sushi domain based immunocytokines
US10899816B2 (en) 2011-06-24 2021-01-26 Inserm (Institut National De La Santé Et De La Recherche Medicale) IL-15 and IL-15Rα sushi domain based immunocytokines
US10875864B2 (en) 2011-07-21 2020-12-29 Sumitomo Dainippon Pharma Oncology, Inc. Substituted imidazo[1,2-B]pyridazines as protein kinase inhibitors
US9895441B2 (en) 2012-05-31 2018-02-20 Genentech, Inc. Methods of treating cancer using PD-L1 axis binding antagonists and VEGF antagonists
US11226339B2 (en) * 2012-12-11 2022-01-18 Albert Einstein College Of Medicine Methods for high throughput receptor:ligand identification
EP2944323B1 (en) 2013-01-11 2019-03-27 Dingfu Biotarget Co., Ltd Agents for treating tumours, use and method thereof
US11299544B2 (en) 2013-03-15 2022-04-12 Genentech, Inc. Biomarkers and methods of treating PD-1 and PD-L1 related conditions
US9192667B2 (en) 2013-04-22 2015-11-24 Hoffmann-La Roche Inc. Method of treating cancer by administering CSF-1R antibodies and a TLR9 agonist
WO2014195852A1 (en) 2013-06-03 2014-12-11 Glaxosmithkline Intellectual Property (No.2) Limited Combinations of an anti-pd-l1 antibody and a mek inhibitor and/or a braf inhibitor
US10829557B2 (en) 2013-09-11 2020-11-10 Medimmune Limited Anti-B7-H1 antibodies for treating tumors
WO2015036499A1 (en) * 2013-09-11 2015-03-19 Medimmune Limited Anti-b7-h1 antibodies for treating tumors
CN105873606A (en) * 2013-09-11 2016-08-17 米迪缪尼有限公司 Anti-b7-h1 antibodies for treating tumors
RU2701327C2 (en) * 2013-09-11 2019-09-25 Медиммьюн Лимитед Antibodies to b7-h1 for treating tumours
KR20160044030A (en) * 2013-09-11 2016-04-22 메디뮨 리미티드 Anti-b7-h1 antibodies for treating tumors
KR102329584B1 (en) 2013-09-11 2021-11-22 메디뮨 리미티드 Anti-b7-h1 antibodies for treating tumors
IL274462A (en) * 2013-09-11 2020-06-30 Medimmune Ltd Anti-b7-h1 antibodies for treating tumors
EP3656398A1 (en) * 2013-09-11 2020-05-27 MedImmune Limited Anti-b7-h1 antibodies for treating tumors
CN105873606B (en) * 2013-09-11 2020-12-29 米迪缪尼有限公司 anti-B7-H1 antibodies for the treatment of tumors
US11827706B2 (en) 2013-09-11 2023-11-28 Medimmune Limited Anti-B7-H1 antibodies for treating tumors
US10336823B2 (en) 2013-09-11 2019-07-02 Medimmune Limited Anti-B7-H1 antibodies for treating tumors
US11512133B2 (en) 2013-09-12 2022-11-29 Hoffmann-La Roche Inc. Methods for treating colon cancer or inhibiting cell proliferation by administering a combination of antibodies against human CSF-1R and antibodies against human PD-L1
WO2015036511A1 (en) * 2013-09-12 2015-03-19 F. Hoffmann-La Roche Ag Combination therapy of antibodies against human csf-1r and antibodies against human pd-l1
JP2016531150A (en) * 2013-09-12 2016-10-06 エフ・ホフマン−ラ・ロシュ・アクチェンゲゼルシャフト Combination therapy of antibody against human CSF-1R and antibody against human PD-L1
US11673951B2 (en) 2013-09-13 2023-06-13 Beigene Switzerland Gmbh Anti-PD1 antibodies and their use as therapeutics and diagnostics
US11186637B2 (en) 2013-09-13 2021-11-30 Beigene Switzerland Gmbh Anti-PD1 antibodies and their use as therapeutics and diagnostics
US11680090B2 (en) 2013-09-24 2023-06-20 Medicenna Therapeutics, Inc. Interleukin-2 fusion proteins and uses thereof
US11708412B2 (en) 2013-09-26 2023-07-25 Novartis Ag Methods for treating hematologic cancers
US10570204B2 (en) 2013-09-26 2020-02-25 The Medical College Of Wisconsin, Inc. Methods for treating hematologic cancers
US10875922B2 (en) 2013-09-27 2020-12-29 Genentech, Inc. Anti-PDL1 antibody formulations
EA033817B1 (en) * 2013-09-27 2019-11-28 Genentech Inc Anti-pdl1 antibody formulations
WO2015048520A1 (en) * 2013-09-27 2015-04-02 Genentech, Inc. Anti-pdl1 antibody formulations
US10202454B2 (en) 2013-10-25 2019-02-12 Dana-Farber Cancer Institute, Inc. Anti-PD-L1 monoclonal antibodies and fragments thereof
AU2014339900B2 (en) * 2013-10-25 2019-10-24 Dana-Farber Cancer Institute, Inc. Anti-PD-L1 monoclonal antibodies and fragments thereof
WO2015061668A1 (en) * 2013-10-25 2015-04-30 Dana-Farber Cancer Institute, Inc. Anti-pd-l1 monoclonal antibodies and fragments thereof
WO2015066413A1 (en) 2013-11-01 2015-05-07 Novartis Ag Oxazolidinone hydroxamic acid compounds for the treatment of bacterial infections
EP3083686B1 (en) 2013-12-17 2019-10-23 F.Hoffmann-La Roche Ag Methods of treating cancers using pd-1 axis binding antagonists and taxanes
WO2015100282A1 (en) 2013-12-24 2015-07-02 Bristol-Myers Squibb Company Tricyclic compounds as anticancer agents
EP3466949A1 (en) 2013-12-24 2019-04-10 Bristol-Myers Squibb Company Tricyclic compound as anticancer agents
US11584788B2 (en) 2014-01-14 2023-02-21 Dana-Farber Cancer Institute, Inc. Compositions and methods for identification, assessment, prevention, and treatment of melanoma using PD-L1 isoforms
AU2015206603B9 (en) * 2014-01-14 2019-07-18 Dana-Farber Cancer Institute, Inc. Compositions and methods for identification, assessment, prevention, and treatment of melanoma using PD-L1 isoforms
EP3094736A4 (en) * 2014-01-14 2017-10-25 Dana-Farber Cancer Institute, Inc. Compositions and methods for identification, assessment, prevention, and treatment of melanoma using pd-l1 isoforms
AU2015206603B2 (en) * 2014-01-14 2019-07-11 Dana-Farber Cancer Institute, Inc. Compositions and methods for identification, assessment, prevention, and treatment of melanoma using PD-L1 isoforms
WO2015109124A3 (en) * 2014-01-15 2015-09-24 Kadmon Corporation, Llc Immunomodulatory agents
JP2017509319A (en) * 2014-01-15 2017-04-06 カドモン コーポレイション,リミティド ライアビリティ カンパニー Immunomodulator
EP3094351A4 (en) * 2014-01-15 2017-06-28 Kadmon Corporation, LLC Immunomodulatory agents
CN105263521B (en) * 2014-01-15 2021-06-29 卡德门企业有限公司 Immunomodulator
EP4079321A1 (en) * 2014-01-15 2022-10-26 Kadmon Corporation, LLC Immunomodulatory agents
CN113603788A (en) * 2014-01-15 2021-11-05 卡德门企业有限公司 Immunomodulator
US10407502B2 (en) 2014-01-15 2019-09-10 Kadmon Corporation, Llc Immunomodulatory agents
CN113637692A (en) * 2014-01-15 2021-11-12 卡德门企业有限公司 Immunomodulator
CN105263521A (en) * 2014-01-15 2016-01-20 卡德门企业有限公司 Immunomodulatory agents
WO2015107495A1 (en) 2014-01-17 2015-07-23 Novartis Ag N-azaspirocycloalkane substituted n-heteroaryl compounds and compositions for inhibiting the activity of shp2
US10737113B2 (en) 2014-01-23 2020-08-11 Regeneron Pharmaceuticals, Inc. Human antibodies to PD-1
US9938345B2 (en) 2014-01-23 2018-04-10 Regeneron Pharmaceuticals, Inc. Human antibodies to PD-L1
US9987500B2 (en) 2014-01-23 2018-06-05 Regeneron Pharmaceuticals, Inc. Human antibodies to PD-1
US11117970B2 (en) 2014-01-23 2021-09-14 Regeneron Pharmaceuticals, Inc. Human antibodies to PD-L1
US9815898B2 (en) 2014-01-24 2017-11-14 Novartis Ag Antibody molecules to PD-1 and uses thereof
US10441654B2 (en) 2014-01-24 2019-10-15 Children's Hospital Of Eastern Ontario Research Institute Inc. SMC combination therapy for the treatment of cancer
US10752687B2 (en) 2014-01-24 2020-08-25 Novartis Ag Antibody molecules to PD-1 and uses thereof
US9683048B2 (en) 2014-01-24 2017-06-20 Novartis Ag Antibody molecules to PD-1 and uses thereof
US11827704B2 (en) 2014-01-24 2023-11-28 Novartis Ag Antibody molecules to PD-1 and uses thereof
US9605070B2 (en) 2014-01-31 2017-03-28 Novartis Ag Antibody molecules to TIM-3 and uses thereof
US11155620B2 (en) 2014-01-31 2021-10-26 Novartis Ag Method of detecting TIM-3 using antibody molecules to TIM-3
US10472419B2 (en) 2014-01-31 2019-11-12 Novartis Ag Antibody molecules to TIM-3 and uses thereof
US10981990B2 (en) 2014-01-31 2021-04-20 Novartis Ag Antibody molecules to TIM-3 and uses thereof
US9884913B2 (en) 2014-01-31 2018-02-06 Novartis Ag Antibody molecules to TIM-3 and uses thereof
CN113549159A (en) * 2014-02-10 2021-10-26 默克专利有限公司 Targeted TGF-beta inhibition
KR20160119197A (en) * 2014-02-10 2016-10-12 메르크 파텐트 게엠베하 Tgf targeted tgf inhibition
KR102363008B1 (en) 2014-02-10 2022-02-16 메르크 파텐트 게엠베하 TARGETED TGFβ INHIBITION
US9676863B2 (en) 2014-02-10 2017-06-13 Merck Patent Gmbh Targeted TGFβ inhibitors
WO2015118175A3 (en) * 2014-02-10 2015-10-08 Merck Patent Gmbh TARGETED TGFβ INHIBITION
CN106103488A (en) * 2014-02-10 2016-11-09 默克专利有限公司 Targeting TGF β suppresses
JP2017506217A (en) * 2014-02-10 2017-03-02 メルク パテント ゲーエムベーハー Target TGFβ inhibition
EP3889172A1 (en) 2014-02-10 2021-10-06 Merck Patent GmbH Targeted tgf beta inhibition
WO2015118175A2 (en) 2014-02-10 2015-08-13 Merck Patent Gmbh TARGETED TGFβ INHIBITION
US11370819B2 (en) 2014-02-10 2022-06-28 Merck Patent Gmbh Targeted TGFβ inhibition
JP2020174674A (en) * 2014-02-10 2020-10-29 メルク パテント ゲーエムベーハー TARGETED TGFβ INHIBITION
US11773175B2 (en) 2014-03-04 2023-10-03 Kymab Limited Antibodies, uses and methods
US11753479B2 (en) 2014-03-04 2023-09-12 Kymab Limited Nucleic acids encoding anti-OX40L antibodies
EP3660050A1 (en) 2014-03-14 2020-06-03 Novartis AG Antibody molecules to lag-3 and uses thereof
WO2015138920A1 (en) 2014-03-14 2015-09-17 Novartis Ag Antibody molecules to lag-3 and uses thereof
EP3511328A1 (en) 2014-03-24 2019-07-17 Novartis AG Monobactam organic compounds for the treatment of bacterial infections
WO2015148379A1 (en) 2014-03-24 2015-10-01 Novartis Ag Monobactam organic compounds for the treatment of bacterial infections
US11384131B2 (en) 2014-04-24 2022-07-12 The Board Of Trustees Of The Leland Stanford Junior University Superagonists, partial agonists and antagonists of interleukin-2
US10775383B2 (en) 2014-05-29 2020-09-15 Ventana Medical Systems, Inc. PD-L1 antibodies and uses thereof
US9885721B2 (en) 2014-05-29 2018-02-06 Spring Bioscience Corporation PD-L1 antibodies and uses thereof
WO2015187835A2 (en) 2014-06-06 2015-12-10 Bristol-Myers Squibb Company Antibodies against glucocorticoid-induced tumor necrosis factor receptor (gitr) and uses thereof
US10987322B2 (en) 2014-06-06 2021-04-27 Flexus Biosciences, Inc. Immunoregulatory agents
EP3998079A1 (en) 2014-06-06 2022-05-18 Bristol-Myers Squibb Company Antibodies against glucocorticoid-induced tumor necrosis factor receptor (gitr) and uses thereof
EP3610924A1 (en) 2014-06-06 2020-02-19 Bristol-Myers Squibb Company Antibodies against glucocorticoid-induced tumor necrosis factor receptor (gitr) and uses thereof
EP3157629B1 (en) * 2014-06-17 2022-10-05 MedImmune Limited Methods of cancer treatment with antagonists against pd-1 and pd-l1 in combination with radiation therapy
CN107073107A (en) * 2014-06-17 2017-08-18 免疫医疗有限公司 Use the cancer treatment method of the combination of antagonist and radiotherapy for PD 1 and PD L1
EP4144412A1 (en) * 2014-06-17 2023-03-08 MedImmune Limited Methods of cancer treatment with antagonists against pd-1 and pd-l1 in combination with radiation therapy
EP3157629A1 (en) * 2014-06-17 2017-04-26 Medimmune Limited Methods of cancer treatment with antagonists against pd-1 and pd-l1 in combination with radiation therapy
WO2015193352A1 (en) 2014-06-17 2015-12-23 Medimmune Limited Methods of cancer treatment with antagonists against pd-1 and pd-l1 in combination with radiation therapy
JP2019172677A (en) * 2014-07-03 2019-10-10 ベイジーン リミテッド Anti-pd-l1 antibodies and their use for treatment and diagnosis
US11512132B2 (en) 2014-07-03 2022-11-29 Beigene, Ltd. Anti-PD-L1 antibodies and their use as therapeutics and diagnostics
JP2017522905A (en) * 2014-07-03 2017-08-17 ベイジーン リミテッド Anti-PD-L1 antibodies and their use for therapy and diagnosis
EP4001311A1 (en) 2014-07-09 2022-05-25 Birdie Biopharmaceuticals Inc. Anti-pd-l1 combinations for treating tumors
WO2016004876A1 (en) 2014-07-09 2016-01-14 Shanghai Birdie Biotech, Inc. Anti-pd-l1 combinations for treating tumors
US20170100425A1 (en) * 2014-07-10 2017-04-13 Biothera, Inc. Beta-glucan in combination with anti-cancer agents affecting the tumor microenvironment
US10111901B2 (en) * 2014-07-10 2018-10-30 Biothera, Inc. Beta-glucan in combination with anti-cancer agents affecting the tumor microenvironment
US11530269B2 (en) 2014-07-11 2022-12-20 Ventana Medical Systems, Inc. Anti-PD-L1 antibodies and diagnostic uses thereof
US10981994B2 (en) 2014-07-22 2021-04-20 Apollomics Inc. Anti PD-1 antibodies
US11560429B2 (en) 2014-07-22 2023-01-24 Apollomics Inc. Anti PD-1 antibodies
US10428146B2 (en) 2014-07-22 2019-10-01 Cb Therapeutics, Inc. Anti PD-1 antibodies
KR20170039706A (en) * 2014-08-05 2017-04-11 씨비 테라퓨틱스, 인코포레이티드 Anti-pd-l1 antibodies
EP3177649A4 (en) * 2014-08-05 2018-04-25 CB Therapeutics, Inc. Anti-pd-l1 antibodies
JP2017523786A (en) * 2014-08-05 2017-08-24 シービー セラピューティックス インコーポレイテッド Anti-PD-L1 antibody
JP7144477B2 (en) 2014-08-05 2022-09-29 アポロミクス インコーポレイテッド Anti-PD-L1 antibody
KR102476226B1 (en) 2014-08-05 2022-12-12 아폴로믹스 인코포레이티드 Anti-pd-l1 antibodies
JP2020141672A (en) * 2014-08-05 2020-09-10 シービー セラピューティックス インコーポレイテッド Anti-pd-l1 antibodies
US10435470B2 (en) 2014-08-05 2019-10-08 Cb Therapeutics, Inc. Anti-PD-L1 antibodies
US11111300B2 (en) 2014-08-05 2021-09-07 Apollomics Inc. Anti PD-L1 antibodies
US11827707B2 (en) 2014-08-05 2023-11-28 Apollomics Inc. Anti PD-L1 antibodies
WO2016020836A1 (en) 2014-08-06 2016-02-11 Novartis Ag Quinolone derivatives as antibacterials
US11021694B2 (en) 2014-08-15 2021-06-01 Merck Patent Gmbh SIRP-α immunoglobulin fusion proteins
EP3643727A1 (en) 2014-08-15 2020-04-29 Merck Patent GmbH Sirp-alpha immunoglobulin fusion proteins
EP3763742A1 (en) 2014-09-01 2021-01-13 Birdie Biopharmaceuticals Inc. Anti-pd-l1 conjugates for treating tumors
EP4148069A1 (en) 2014-09-01 2023-03-15 Birdie Biopharmaceuticals Inc. Anti-pd-l1 conjugates for treating tumors
EP3925622A1 (en) 2014-09-13 2021-12-22 Novartis AG Combination therapies
WO2016040880A1 (en) 2014-09-13 2016-03-17 Novartis Ag Combination therapies of alk inhibitors
WO2016040892A1 (en) 2014-09-13 2016-03-17 Novartis Ag Combination therapies
US11344620B2 (en) 2014-09-13 2022-05-31 Novartis Ag Combination therapies
EP3659621A1 (en) 2014-09-13 2020-06-03 Novartis AG Combination therapies for cancer
US11447561B2 (en) 2014-09-30 2022-09-20 Intervet, Inc. PD-L1 antibodies binding canine PD-L1
AU2021218094B2 (en) * 2014-09-30 2023-04-20 Intervet International B.V. PD-L1 antibodies binding canine PD-L1
US10550194B2 (en) 2014-09-30 2020-02-04 Intervet Inc. PD-L1 antibodies binding canine PD-L1
WO2016050721A1 (en) * 2014-09-30 2016-04-07 Intervet International B.V. Pd-l1 antibodies binding canine pd-l1
CN112851816A (en) * 2014-09-30 2021-05-28 英特维特国际股份有限公司 PD-L1 antibodies that bind canine PD-L1
CN112851816B (en) * 2014-09-30 2024-03-08 英特维特国际股份有限公司 PD-L1 antibodies that bind canine PD-L1
AU2015326996B2 (en) * 2014-09-30 2021-05-20 Intervet International B.V. PD-L1 antibodies binding canine PD-L1
EP3662903A2 (en) 2014-10-03 2020-06-10 Novartis AG Combination therapies
WO2016054555A2 (en) 2014-10-03 2016-04-07 Novartis Ag Combination therapies
WO2016057841A1 (en) 2014-10-08 2016-04-14 Novartis Ag Compositions and methods of use for augmented immune response and cancer therapy
WO2016057846A1 (en) 2014-10-08 2016-04-14 Novartis Ag Compositions and methods of use for augmented immune response and cancer therapy
EP4029508A1 (en) 2014-10-10 2022-07-20 Idera Pharmaceuticals, Inc. Treatment of cancer using tlr9 agonists and checkpoint inhibitors
EP4245376A2 (en) 2014-10-14 2023-09-20 Novartis AG Antibody molecules to pd-l1 and uses thereof
WO2016061142A1 (en) 2014-10-14 2016-04-21 Novartis Ag Antibody molecules to pd-l1 and uses thereof
US9988452B2 (en) 2014-10-14 2018-06-05 Novartis Ag Antibody molecules to PD-L1 and uses thereof
US10851165B2 (en) 2014-10-14 2020-12-01 Novartis Ag Antibody molecules to PD-L1 and methods of treating cancer
US10533014B2 (en) 2014-11-05 2020-01-14 Flexus Biosciences, Inc. Immunoregulatory agents
US9643972B2 (en) 2014-11-05 2017-05-09 Flexus Biosciences, Inc. Immunoregulatory agents
EP3854394A1 (en) 2014-11-05 2021-07-28 Flexus Biosciences, Inc. Immunoregulatory agents
US10106546B2 (en) 2014-11-05 2018-10-23 Flexus Biosciences, Inc. Immunoregulatory agents
US10206893B2 (en) 2014-11-05 2019-02-19 Flexus Biosciences, Inc. Immunoregulatory agents
US9598422B2 (en) 2014-11-05 2017-03-21 Flexus Biosciences, Inc. Immunoregulatory agents
US11932601B2 (en) 2014-11-05 2024-03-19 Flexus Biosciences, Inc. Immunoregulatory agents
US11242319B2 (en) 2014-11-05 2022-02-08 Flexus Biosciences, Inc. Immunoregulatory agents
US11135245B2 (en) 2014-11-17 2021-10-05 Adicet Bio, Inc. Engineered γδ T-cells
WO2016081518A3 (en) * 2014-11-17 2016-08-18 Adicet Bio, Inc. Engineered gamma delta t-cells
US9913461B2 (en) 2014-12-09 2018-03-13 Regeneron Pharmaceuticals, Inc. Genetically modified mouse whose genome comprises a humanized CD274 gene
US10881086B2 (en) 2014-12-09 2021-01-05 Regeneron Pharmaceuticals, Inc. Genetically modified mouse whose genome comprises a humanized CD274 gene
WO2016097995A1 (en) 2014-12-16 2016-06-23 Novartis Ag Isoxazole hydroxamic acid compounds as lpxc inhibitors
WO2016100882A1 (en) 2014-12-19 2016-06-23 Novartis Ag Combination therapies
WO2016106266A1 (en) 2014-12-22 2016-06-30 Bristol-Myers Squibb Company TGFβ RECEPTOR ANTAGONISTS
EP4249066A2 (en) 2014-12-23 2023-09-27 Bristol-Myers Squibb Company Antibodies to tigit
WO2016123454A1 (en) 2015-01-29 2016-08-04 Board Of Trustees Of Miching State University Cryptic polypeptides and uses thereof
US10620211B2 (en) 2015-02-03 2020-04-14 Ventana Medical Systems, Inc. Histochemical assay for evaluating expression of programmed death ligand 1 (PD-L1)
WO2016127052A1 (en) 2015-02-05 2016-08-11 Bristol-Myers Squibb Company Cxcl11 and smica as predictive biomarkers for efficacy of anti-ctla4 immunotherapy
US11304976B2 (en) 2015-02-18 2022-04-19 Enlivex Therapeutics Ltd Combination immune therapy and cytokine control therapy for cancer treatment
US11512289B2 (en) 2015-02-18 2022-11-29 Enlivex Therapeutics Rdo Ltd Combination immune therapy and cytokine control therapy for cancer treatment
US11596652B2 (en) 2015-02-18 2023-03-07 Enlivex Therapeutics R&D Ltd Early apoptotic cells for use in treating sepsis
US11717539B2 (en) 2015-02-18 2023-08-08 Enlivex Therapeutics RDO Ltd. Combination immune therapy and cytokine control therapy for cancer treatment
US11000548B2 (en) 2015-02-18 2021-05-11 Enlivex Therapeutics Ltd Combination immune therapy and cytokine control therapy for cancer treatment
US11497767B2 (en) 2015-02-18 2022-11-15 Enlivex Therapeutics R&D Ltd Combination immune therapy and cytokine control therapy for cancer treatment
US11318163B2 (en) 2015-02-18 2022-05-03 Enlivex Therapeutics Ltd Combination immune therapy and cytokine control therapy for cancer treatment
RU2714233C2 (en) * 2015-02-26 2020-02-13 Мерк Патент Гмбх Pd-1/pd-l1 inhibitors for treating cancer
US10800846B2 (en) 2015-02-26 2020-10-13 Merck Patent Gmbh PD-1/PD-L1 inhibitors for the treatment of cancer
EP4279087A2 (en) 2015-02-26 2023-11-22 Merck Patent GmbH Pd-1 / pd-l1 inhibitors for the treatment of cancer
RU2742312C1 (en) * 2015-02-26 2021-02-04 Мерк Патент Гмбх Pd-1/pd-l1 inhibitors for treating cancer
WO2016137985A1 (en) 2015-02-26 2016-09-01 Merck Patent Gmbh Pd-1 / pd-l1 inhibitors for the treatment of cancer
WO2016140884A1 (en) 2015-03-02 2016-09-09 Rigel Pharmaceuticals, Inc. TGF-β INHIBITORS
WO2016145085A2 (en) 2015-03-09 2016-09-15 Celldex Therapeutics, Inc. Cd27 agonists
US10449211B2 (en) 2015-03-10 2019-10-22 Aduro Biotech, Inc. Compositions and methods for activating “stimulator of interferon gene”—dependent signalling
US11040053B2 (en) 2015-03-10 2021-06-22 Chinook Therapeutics, Inc. Compositions and methods for activating “stimulator of interferon gene”13 dependent signalling
WO2016145102A1 (en) 2015-03-10 2016-09-15 Aduro Biotech, Inc. Compositions and methods for activating "stimulator of interferon gene" -dependent signalling
US11174316B2 (en) 2015-03-13 2021-11-16 Cytomx Therapeutics, Inc. Anti-PDL1 antibodies, activatable anti-PDL1 antibodies, and methods of use thereof
US10836827B2 (en) 2015-03-30 2020-11-17 Stcube, Inc. Antibodies specific to glycosylated PD-L1 and methods of use thereof
US11933786B2 (en) 2015-03-30 2024-03-19 Stcube, Inc. Antibodies specific to glycosylated PD-L1 and methods of use thereof
EP3277320A4 (en) * 2015-03-30 2018-08-01 Stcube, Inc. Antibodies specific to glycosylated pd-l1 and methods of use thereof
US9790169B2 (en) 2015-04-03 2017-10-17 Bristol-Myers Squibb Company IDO inhibitors
WO2016161269A1 (en) 2015-04-03 2016-10-06 Bristol-Myers Squibb Company Inhibitors of indoleamine 2,3-dioxygenase for the treatment of cancer
US10399933B2 (en) 2015-04-03 2019-09-03 Bristol-Myers Squibb Company Inhibitors of indoleamine-2,3-dioxygenase for the treatment of cancer
WO2016161279A1 (en) 2015-04-03 2016-10-06 Bristol-Myers Squibb Company Inhibitors of indoleamine 2,3-dioxygenase for the treatment of cancer
US10399932B2 (en) 2015-04-03 2019-09-03 Bristol-Myers Squibb Company Inhibitors of indoleamine-2,3-dioxygenase for the treatment of cancer
US10167254B2 (en) 2015-04-03 2019-01-01 Bristol-Myers Squibb Company IDO inhibitors
US11491204B2 (en) 2015-04-07 2022-11-08 Cytlimic Inc. Composition comprising poly I:C and LAG-3-IGG fusion protein
WO2016162505A1 (en) 2015-04-08 2016-10-13 F-Star Biotechnology Limited Her2 binding agent therapies
US11883429B2 (en) 2015-04-21 2024-01-30 Enlivex Therapeutics Rdo Ltd Therapeutic pooled blood apoptotic cell preparations and uses thereof
US10857181B2 (en) 2015-04-21 2020-12-08 Enlivex Therapeutics Ltd Therapeutic pooled blood apoptotic cell preparations and uses thereof
EP3736287A1 (en) 2015-05-11 2020-11-11 The Johns Hopkins University Autoimmune antibodies for use in inhibiting cancer cell growth
WO2016183114A1 (en) 2015-05-11 2016-11-17 Bristol-Myers Squibb Company Tricyclic compounds as anticancer agents
US11938183B2 (en) 2015-05-11 2024-03-26 The Johns Hopkins University Autoimmune antibodies for use in inhibiting cancer cell growth
WO2016183115A1 (en) 2015-05-12 2016-11-17 Bristol-Myers Squibb Company 5h-pyrido[3,2-b]indole compounds as anticancer agents
WO2016183118A1 (en) 2015-05-12 2016-11-17 Bristol-Myers Squibb Company Tricyclic compounds as anticancer agents
US10945994B2 (en) 2015-05-14 2021-03-16 Pfizer Inc. Combinations comprising a pyrrolidine-2,5-dione IDO1 inhibitor and an anti-body
WO2016181348A1 (en) 2015-05-14 2016-11-17 Pfizer Inc. Combinations comprising a pyrrolidine-2,5-dione ido1 inhibitor and an anti-body
WO2016196228A1 (en) 2015-05-29 2016-12-08 Bristol-Myers Squibb Company Antibodies against ox40 and uses thereof
WO2016196218A1 (en) 2015-05-31 2016-12-08 Curegenix Corporation Combination compositions for immunotherapy
WO2016201425A1 (en) 2015-06-12 2016-12-15 Bristol-Myers Squibb Company Treatment of cancer by combined blockade of the pd-1 and cxcr4 signaling pathways
AU2016280003B2 (en) * 2015-06-16 2021-09-16 Merck Patent Gmbh PD-L1 antagonist combination treatments
WO2016205277A1 (en) * 2015-06-16 2016-12-22 Merck Patent Gmbh Pd-l1 antagonist combination treatments
TWI772261B (en) * 2015-06-16 2022-08-01 德商馬克專利公司 Pd-l1 antagonist combination treatments
IL256245B (en) * 2015-06-16 2022-09-01 Merck Patent Gmbh Pd-l1 antagonist combination treatments
US11154616B2 (en) 2015-06-17 2021-10-26 Genentech, Inc. Methods of treating locally advanced or metastatic breast cancers using PD-1 axis binding antagonists and taxanes
US11584793B2 (en) 2015-06-24 2023-02-21 Hoffmann-La Roche Inc. Anti-transferrin receptor antibodies with tailored affinity
WO2017004016A1 (en) 2015-06-29 2017-01-05 The Rockefeller University Antibodies to cd40 with enhanced agonist activity
WO2017000983A1 (en) 2015-06-29 2017-01-05 Ose Immunotherapeutics Method for inducing early t memory response with short peptides anti-tumor vaccine
WO2017019757A1 (en) 2015-07-28 2017-02-02 Bristol-Myers Squibb Company Tgf beta receptor antagonists
EP3878465A1 (en) 2015-07-29 2021-09-15 Novartis AG Combination therapies comprising antibody molecules to tim-3
WO2017019897A1 (en) 2015-07-29 2017-02-02 Novartis Ag Combination therapies comprising antibody molecules to tim-3
WO2017019894A1 (en) 2015-07-29 2017-02-02 Novartis Ag Combination therapies comprising antibody molecules to lag-3
EP3964528A1 (en) 2015-07-29 2022-03-09 Novartis AG Combination therapies comprising antibody molecules to lag-3
US10214586B2 (en) 2015-08-24 2019-02-26 Eli Lilly And Company PD-L1 antibodies
WO2017035118A1 (en) 2015-08-25 2017-03-02 Bristol-Myers Squibb Company Tgf beta receptor antagonists
WO2017055484A1 (en) 2015-09-29 2017-04-06 INSERM (Institut National de la Santé et de la Recherche Médicale) Methods for determining the metabolic status of lymphomas
WO2017058780A1 (en) 2015-09-30 2017-04-06 Merck Patent Gmbh Combination of a pd-1 axis binding antagonist and an alk inhibitor for treating alk-negative cancer
US11603411B2 (en) 2015-10-02 2023-03-14 Hoffmann-La Roche Inc. Bispecific anti-human CD20/human transferrin receptor antibodies and methods of use
US11787868B2 (en) 2015-10-02 2023-10-17 Hoffmann-La Roche Inc. Bispecific anti-human A-beta/human transferrin receptor antibodies and methods of use
WO2017069291A1 (en) 2015-10-23 2017-04-27 Canbas Co., Ltd. Peptides and peptidomimetics in combination with t cell activating and/or checkpoint inhibiting agents for cancer treatment
WO2017087678A2 (en) 2015-11-19 2017-05-26 Bristol-Myers Squibb Company Antibodies against glucocorticoid-induced tumor necrosis factor receptor (gitr) and uses thereof
US10858432B2 (en) 2015-12-02 2020-12-08 Stcube, Inc. Antibodies specific to glycosylated PD-1 and methods of use thereof
EP3366691A1 (en) 2015-12-03 2018-08-29 GlaxoSmithKline Intellectual Property Development Limited Cyclic purine dinucleotides as modulators of sting
WO2017093933A1 (en) 2015-12-03 2017-06-08 Glaxosmithkline Intellectual Property Development Limited Cyclic purine dinucleotides as modulators of sting
AU2016368099B2 (en) * 2015-12-07 2023-03-09 Merck Patent Gmbh Aqueous Pharmaceutical Formulation Comprising anti-PD-L1 Antibody Avelumab
EP3747466A1 (en) 2015-12-07 2020-12-09 Merck Patent GmbH Aqueous pharmaceutical formulation
WO2017097407A1 (en) * 2015-12-07 2017-06-15 Merck Patent Gmbh Aqueous pharmaceutical formulation comprising anti-pd-1 antibody avelumab
TWI630917B (en) * 2015-12-07 2018-08-01 馬克專利公司 Aqueous pharmaceutical formulation
AU2016368099C1 (en) * 2015-12-07 2023-10-12 Merck Patent Gmbh Aqueous Pharmaceutical Formulation Comprising anti-PD-L1 Antibody Avelumab
US11058769B2 (en) 2015-12-07 2021-07-13 Merck Patent Gmbh Aqueous pharmaceutical formulation comprising anti-PD-L1 antibody Avelumab
WO2017098421A1 (en) 2015-12-08 2017-06-15 Glaxosmithkline Intellectual Property Development Limited Benzothiadiazine compounds
WO2017106291A1 (en) 2015-12-15 2017-06-22 Bristol-Myers Squibb Company Cxcr4 receptor antagonists
US11066478B2 (en) 2015-12-17 2021-07-20 Photocure Asa Intravesical therapy for bladder cancer
US10556010B2 (en) 2015-12-17 2020-02-11 Photocure Asa Neoadjuvant therapy for bladder cancer
WO2017106656A1 (en) 2015-12-17 2017-06-22 Novartis Ag Antibody molecules to pd-1 and uses thereof
US11311620B2 (en) 2015-12-17 2022-04-26 Photocure Asa Neoadjuvant therapy for bladder cancer
WO2017103283A1 (en) 2015-12-17 2017-06-22 Photocure Asa Neoadjuvant therapy for bladder cancer
WO2017103895A1 (en) 2015-12-18 2017-06-22 Novartis Ag Antibodies targeting cd32b and methods of use thereof
WO2017112741A1 (en) 2015-12-22 2017-06-29 Novartis Ag Mesothelin chimeric antigen receptor (car) and antibody against pd-l1 inhibitor for combined use in anticancer therapy
WO2017118634A1 (en) 2016-01-04 2017-07-13 INSERM (Institut National de la Santé et de la Recherche Médicale) Use of pd-1 and tim-3 as a measure for cd8+ cells in predicting and treating renal cell carcinoma
US11730761B2 (en) 2016-02-18 2023-08-22 Enlivex Therapeutics Rdo Ltd Combination immune therapy and cytokine control therapy for cancer treatment
WO2017140821A1 (en) 2016-02-19 2017-08-24 Novartis Ag Tetracyclic pyridone compounds as antivirals
WO2017144681A1 (en) 2016-02-25 2017-08-31 Cell Medica Switzerland Ag Binding members to pd-l1
US11434294B2 (en) 2016-02-25 2022-09-06 Cell Medica, Inc. Binding members to PD-L1
EP4086285A1 (en) 2016-02-25 2022-11-09 Cell Medica Switzerland AG Binding members to pd-l1
KR20180004277A (en) * 2016-03-04 2018-01-10 쓰촨 케룬-바이오테크 바이오파마수티컬 컴퍼니 리미티드 PDL-1 antibody, pharmaceutical composition thereof and uses thereof
US10465014B2 (en) 2016-03-04 2019-11-05 Sichuan Kelun-Biotech Biopharmaceutical Co., Ltd. PDL-1 antibody, pharmaceutical composition thereof, and uses thereof
EP3309177A4 (en) * 2016-03-04 2018-10-10 Sichuan Kelun-Biotech Biopharmaceutical Co., Ltd. Pdl-1 antibody, pharmaceutical composition thereof, and uses thereof
KR102068600B1 (en) 2016-03-04 2020-01-21 쓰촨 케룬-바이오테크 바이오파마수티컬 컴퍼니 리미티드 PDL-1 antibody, pharmaceutical composition thereof and use thereof
US11136413B2 (en) 2016-03-04 2021-10-05 Sichuan Kelun-Biotech Biopharmaceutical Co., Ltd. PDL-1 antibody, pharmaceutical composition thereof, and uses thereof
WO2017153952A1 (en) 2016-03-10 2017-09-14 Glaxosmithkline Intellectual Property Development Limited 5-sulfamoyl-2-hydroxybenzamide derivatives
EP4112641A1 (en) 2016-03-15 2023-01-04 Chugai Seiyaku Kabushiki Kaisha Methods of treating cancers using pd-1 axis binding antagonists and anti-gpc3 antibodies
WO2017159699A1 (en) 2016-03-15 2017-09-21 Chugai Seiyaku Kabushiki Kaisha Methods of treating cancers using pd-1 axis binding antagonists and anti-gpc3 antibodies
EP4302782A2 (en) 2016-03-15 2024-01-10 Mersana Therapeutics, Inc. Napi2b-targeted antibody-drug conjugates and methods of use thereof
WO2017160754A1 (en) 2016-03-15 2017-09-21 Mersana Therapeutics,Inc. Napi2b-targeted antibody-drug conjugates and methods of use thereof
CN108779180A (en) * 2016-03-23 2018-11-09 迈博斯生物医药(苏州)有限公司 Novel anti-PD-L1 antibody
US11753473B2 (en) 2016-03-23 2023-09-12 Suzhou Transcenta Therapeutics Co., Ltd. Anti-PD-L1 antibodies
CN111363041B (en) * 2016-03-23 2022-02-22 苏州创胜医药集团有限公司 Novel anti-PD-L1 antibodies
CN111363041A (en) * 2016-03-23 2020-07-03 迈博斯生物医药(苏州)有限公司 Novel anti-PD-L1 antibodies
CN108779180B (en) * 2016-03-23 2020-10-16 迈博斯生物医药(苏州)有限公司 Novel anti-PD-L1 antibodies
WO2017163186A1 (en) 2016-03-24 2017-09-28 Novartis Ag Alkynyl nucleoside analogs as inhibitors of human rhinovirus
EP4292658A2 (en) 2016-03-24 2023-12-20 Novartis AG Alkynyl nucleoside analogs as inhibitors of human rhinovirus
US11660352B2 (en) 2016-03-29 2023-05-30 Stcube, Inc. Dual function antibodies specific to glycosylated PD-L1 and methods of use thereof
US11964015B2 (en) 2016-04-01 2024-04-23 Deutsches Krebsforschungszentrum Cancer therapy with an oncolytic virus combined with a checkpoint inhibitor
WO2017178572A1 (en) 2016-04-13 2017-10-19 Vivia Biotech, S.L Ex vivo bite-activated t cells
US11279766B2 (en) 2016-04-14 2022-03-22 Ose Immunotherapeutics Anti-SIRPa antibodies and their therapeutic applications
WO2017184619A2 (en) 2016-04-18 2017-10-26 Celldex Therapeutics, Inc. Agonistic antibodies that bind human cd40 and uses thereof
CN105695406A (en) * 2016-04-27 2016-06-22 天津普瑞赛尔生物科技有限公司 Method for preparing DC-CIK immune cells with high-efficiency tumor killing property and prepared DC-CIK immune cells
US11066383B2 (en) 2016-05-04 2021-07-20 Bristol-Myers Squibb Company Inhibitors of indoleamine 2,3-dioxygenase and methods of their use
US10323004B2 (en) 2016-05-04 2019-06-18 Bristol-Myers Squibb Company Inhibitors of indoleamine 2,3-dioxygenase and methods of their use
US10696648B2 (en) 2016-05-04 2020-06-30 Bristol-Myers Squibb Company Inhibitors of indoleamine 2,3-dioxygenase and methods of their use
US10544099B2 (en) 2016-05-04 2020-01-28 Bristol-Myers Squibb Company Inhibitors of indoleamine 2,3-dioxygenase and methods of their use
US10633342B2 (en) 2016-05-04 2020-04-28 Bristol-Myers Squibb Company Inhibitors of indoleamine 2,3-dioxygenase and methods of their use
WO2017191545A1 (en) 2016-05-05 2017-11-09 Glaxosmithkline Intellectual Property (No.2) Limited Enhancer of zeste homolog 2 inhibitors
IL262295B2 (en) * 2016-05-09 2023-09-01 Igm Biosciences Inc Anti-pd-l1 antibodies
WO2017196867A1 (en) * 2016-05-09 2017-11-16 Igm Biosciences, Inc. Anti-pd-l1 antibodies
IL262295B1 (en) * 2016-05-09 2023-05-01 Igm Biosciences Inc Anti-pd-l1 antibodies
US10954302B2 (en) 2016-05-09 2021-03-23 Igm Biosciences, Inc. Anti-PD-L1 antibodies
US11299708B2 (en) 2016-05-12 2022-04-12 Adicet Bio, Inc. Methods for selective expansion of γδ T-cell populations and compositions thereof
US10457725B2 (en) 2016-05-13 2019-10-29 Regeneron Pharmaceuticals, Inc. Methods of treating skin cancer by administering a PD-1 inhibitor
US11505600B2 (en) 2016-05-13 2022-11-22 Regeneron Pharmaceuticals, Inc. Methods of treating skin cancer by administering a PD-1 inhibitor
US11505591B2 (en) 2016-05-18 2022-11-22 Cue Biopharma, Inc. T-cell modulatory multimeric polypeptides and methods of use thereof
US11826317B2 (en) 2016-05-20 2023-11-28 Eli Lilly And Company Combination therapy with notch and PD-1 or PD-L1 inhibitors
US10688104B2 (en) 2016-05-20 2020-06-23 Eli Lilly And Company Combination therapy with Notch and PD-1 or PD-L1 inhibitors
WO2017200969A1 (en) 2016-05-20 2017-11-23 Eli Lilly And Company Combination therapy with notch and pd-1 or pd-l1 inhibitors
US11623958B2 (en) 2016-05-20 2023-04-11 Harpoon Therapeutics, Inc. Single chain variable fragment CD3 binding proteins
WO2017202744A1 (en) 2016-05-26 2017-11-30 Merck Patent Gmbh Pd-1 / pd-l1 inhibitors for cancer treatment
CN109195989A (en) * 2016-05-26 2019-01-11 默克专利股份有限公司 PD-1/PD-L1 inhibitor use for cancer treatment
WO2017212425A1 (en) 2016-06-08 2017-12-14 Glaxosmithkline Intellectual Property Development Limited Chemical compounds as atf4 pathway inhibitors
US10723799B2 (en) 2016-06-13 2020-07-28 I-Mab Biopharma Us Limited Anti-PD-L1 antibodies and uses thereof
WO2017218533A1 (en) 2016-06-13 2017-12-21 Torque Therapeutics, Inc. Methods and compositions for promoting immune cell function
US10071973B2 (en) 2016-06-14 2018-09-11 Novartis Ag Crystalline isoxazole hydroxamic acid compounds
WO2017216705A1 (en) 2016-06-14 2017-12-21 Novartis Ag Crystalline form of (r)-4-(5-(cyclopropylethynyl)isoxazol-3-yl)-n-hydroxy-2-methyl-2-(methylsulfonyl)butanamide as an antibacterial agent
WO2017216686A1 (en) 2016-06-16 2017-12-21 Novartis Ag 8,9-fused 2-oxo-6,7-dihydropyrido-isoquinoline compounds as antivirals
WO2017216685A1 (en) 2016-06-16 2017-12-21 Novartis Ag Pentacyclic pyridone compounds as antivirals
US9957323B2 (en) 2016-06-20 2018-05-01 Kymab Limited Anti-ICOS antibodies
US11965026B2 (en) 2016-06-20 2024-04-23 Kymab Limited Anti-PD-L1 and IL-2 cytokines
KR102531889B1 (en) 2016-06-20 2023-05-17 키맵 리미티드 Anti-PD-L1 and IL-2 cytokines
WO2017220989A1 (en) 2016-06-20 2017-12-28 Kymab Limited Anti-pd-l1 and il-2 cytokines
WO2017220990A1 (en) 2016-06-20 2017-12-28 Kymab Limited Anti-pd-l1 antibodies
KR20190032355A (en) * 2016-06-20 2019-03-27 키맵 리미티드 Anti-PD-L1 and IL-2 cytokines
WO2017220988A1 (en) 2016-06-20 2017-12-28 Kymab Limited Multispecific antibodies for immuno-oncology
US10604576B2 (en) 2016-06-20 2020-03-31 Kymab Limited Antibodies and immunocytokines
WO2017223422A1 (en) 2016-06-24 2017-12-28 Infinity Pharmaceuticals, Inc. Combination therapies
EP3478723A4 (en) * 2016-06-29 2020-07-29 Checkpoint Therapeutics, Inc. Pd-l1-specific antibodies and methods of using the same
US11834505B2 (en) 2016-06-29 2023-12-05 Checkpoint Therapeutics, Inc. PD-L1-specific antibodies and methods of using the same
RU2749109C2 (en) * 2016-06-29 2021-06-04 Чекпойнт Терапьютикс, Инк. Specific antibodies to pd-l1 and methods for their application
US10604574B2 (en) 2016-06-30 2020-03-31 Oncorus, Inc. Oncolytic viral delivery of therapeutic polypeptides
US11078280B2 (en) 2016-06-30 2021-08-03 Oncorus, Inc. Oncolytic viral delivery of therapeutic polypeptides
US11534431B2 (en) 2016-07-05 2022-12-27 Beigene Switzerland Gmbh Combination of a PD-1 antagonist and a RAF inhibitor for treating cancer
US10864203B2 (en) 2016-07-05 2020-12-15 Beigene, Ltd. Combination of a PD-1 antagonist and a RAF inhibitor for treating cancer
US11098077B2 (en) 2016-07-05 2021-08-24 Chinook Therapeutics, Inc. Locked nucleic acid cyclic dinucleotide compounds and uses thereof
US10533052B2 (en) 2016-07-14 2020-01-14 Bristol-Myers Squibb Company Antibodies against TIM3 and uses thereof
US11591392B2 (en) 2016-07-14 2023-02-28 Bristol-Myers Squibb Company Antibodies against TIM3 and uses thereof
US10077306B2 (en) 2016-07-14 2018-09-18 Bristol-Myers Squibb Company Antibodies against TIM3 and uses thereof
WO2018013818A2 (en) 2016-07-14 2018-01-18 Bristol-Myers Squibb Company Antibodies against tim3 and uses thereof
WO2018015879A1 (en) 2016-07-20 2018-01-25 Glaxosmithkline Intellectual Property Development Limited Isoquinoline derivatives as perk inhibitors
US11746152B2 (en) 2016-07-20 2023-09-05 Stcube, Inc. Methods of cancer treatment and therapy using a combination of antibodies that bind glycosylated PD-L1
WO2018017633A1 (en) 2016-07-21 2018-01-25 Bristol-Myers Squibb Company TGF Beta RECEPTOR ANTAGONISTS
WO2018029474A2 (en) 2016-08-09 2018-02-15 Kymab Limited Anti-icos antibodies
US11858996B2 (en) 2016-08-09 2024-01-02 Kymab Limited Anti-ICOS antibodies
WO2018029367A1 (en) 2016-08-12 2018-02-15 Merck Patent Gmbh Combination therapy for cancer
US11701357B2 (en) 2016-08-19 2023-07-18 Beigene Switzerland Gmbh Treatment of B cell cancers using a combination comprising Btk inhibitors
US11542335B2 (en) 2016-08-25 2023-01-03 Hoffmann-La Roche Inc. Method of treating cancer in a patient by administering an antibody which binds colony stimulating factor-1 receptor (CSF-1R)
US11351164B2 (en) 2016-08-26 2022-06-07 Bristol-Myers Squibb Company Inhibitors of indoleamine 2,3-dioxygenase and methods of their use
WO2018047109A1 (en) 2016-09-09 2018-03-15 Novartis Ag Polycyclic pyridone compounds as antivirals
WO2018057955A1 (en) 2016-09-23 2018-03-29 Elstar Therapeutics, Inc. Multispecific antibody molecules comprising lambda and kappa light chains
US11673971B2 (en) 2016-09-23 2023-06-13 Marengo Therapeutics, Inc. Multispecific antibody molecules comprising lambda and kappa light chains
EP3698796A1 (en) 2016-09-28 2020-08-26 Novartis AG Pharmaceutical combination of a tricyclic beta-lactamase inhibitor with specific beta-lactam antibiotics
WO2018060926A1 (en) 2016-09-28 2018-04-05 Novartis Ag Beta-lactamase inhibitors
US11274154B2 (en) 2016-10-06 2022-03-15 Pfizer Inc. Dosing regimen of avelumab for the treatment of cancer
WO2018065938A1 (en) 2016-10-06 2018-04-12 Pfizer Inc. Dosing regimen of avelumab for the treatment of cancer
US11759518B2 (en) 2016-10-11 2023-09-19 Nec Corporation Medicine for treating cancer by administering a toll-like receptor agonist and LAG-3 IgG fusion protein
US11291718B2 (en) 2016-10-11 2022-04-05 Cytlimic Inc. Method for treating cancer by administering a toll-like receptor agonist and LAG-3 IgG fusion protein
WO2018068336A1 (en) * 2016-10-15 2018-04-19 Innovent Biologics (Suzhou) Co., Ltd Pd-1 antibodies
CN107955072A (en) * 2016-10-15 2018-04-24 信达生物制药(苏州)有限公司 Pd-1 antibody
CN107955072B (en) * 2016-10-15 2022-10-18 信达生物制药(苏州)有限公司 PD-1 antibodies
US10597454B2 (en) 2016-10-15 2020-03-24 Innovent Biologics (Suzhou) Co., Ltd PD-1 antibodies
WO2018073753A1 (en) 2016-10-18 2018-04-26 Novartis Ag Fused tetracyclic pyridone compounds as antivirals
WO2018081621A1 (en) 2016-10-28 2018-05-03 Bristol-Myers Squibb Company Methods of treating urothelial carcinoma using an anti-pd-1 antibody
US11274155B2 (en) 2016-10-30 2022-03-15 Shanghai Henlius Biotech Inc. Anti-PD-L1 antibodies and variants
TWI812600B (en) * 2016-10-30 2023-08-21 中國商上海復宏漢霖生物技術股份有限公司 Anti-pd-l1 antibodies and variants
CN109963589B (en) * 2016-10-30 2023-05-05 上海复宏汉霖生物技术股份有限公司 anti-PD-L1 antibodies and variants
EP3532100A4 (en) * 2016-10-30 2020-11-25 Shanghai Henlius Biotech, Inc. Anti-pd-l1 antibodies and variants
CN109963589A (en) * 2016-10-30 2019-07-02 上海复宏汉霖生物技术股份有限公司 Anti- PD-L1 antibody and variant
US11618786B2 (en) 2016-10-30 2023-04-04 Shanghai Henlius Biotech Inc. Anti-PD-L1 antibodies and variants
US11779604B2 (en) 2016-11-03 2023-10-10 Kymab Limited Antibodies, combinations comprising antibodies, biomarkers, uses and methods
WO2018085555A1 (en) 2016-11-03 2018-05-11 Bristol-Myers Squibb Company Activatable anti-ctla-4 antibodies and uses thereof
US11117968B2 (en) 2016-11-03 2021-09-14 Bristol-Myers Squibb Company Activatable anti-CTLA-4 antibodies and uses thereof
US11090367B2 (en) 2016-11-09 2021-08-17 The Brigham And Women's Hospital, Inc. Restoration of tumor suppression using mRNA-based delivery system
US11471515B2 (en) 2016-11-09 2022-10-18 The Brigham And Women's Hospital, Inc. Restoration of tumor suppression using MRNA-based delivery system
US10660909B2 (en) 2016-11-17 2020-05-26 Syntrix Biosystems Inc. Method for treating cancer using chemokine antagonists
US11279694B2 (en) 2016-11-18 2022-03-22 Sumitomo Dainippon Pharma Oncology, Inc. Alvocidib prodrugs and their use as protein kinase inhibitors
WO2018098352A2 (en) 2016-11-22 2018-05-31 Jun Oishi Targeting kras induced immune checkpoint expression
WO2018098269A2 (en) 2016-11-23 2018-05-31 Mersana Therapeutics, Inc. Peptide-containing linkers for antibody-drug conjugates
WO2018100534A1 (en) 2016-12-01 2018-06-07 Glaxosmithkline Intellectual Property Development Limited Combination therapy
WO2018100535A1 (en) 2016-12-01 2018-06-07 Glaxosmithkline Intellectual Property Development Limited Combination therapy
KR20190095280A (en) 2016-12-12 2019-08-14 다이이찌 산쿄 가부시키가이샤 Combination of Antibody-Drug Conjugates and Immune Checkpoint Inhibitors
US11273155B2 (en) 2016-12-12 2022-03-15 Daiichi Sankyo Company, Limited Combination of antibody-drug conjugate and immune checkpoint inhibitor
WO2018110515A1 (en) 2016-12-12 2018-06-21 第一三共株式会社 Combination of antibody-drug conjugate and immune checkpoint inhibitor
US11401314B2 (en) 2016-12-22 2022-08-02 Cue Biopharma, Inc. T-cell modulatory multimeric polypeptides and methods of use thereof
US11739133B2 (en) 2016-12-22 2023-08-29 Cue Biopharma, Inc. T-cell modulatory multimeric polypeptides and methods of use thereof
US11117945B2 (en) 2016-12-22 2021-09-14 Cue Biopharma, Inc. T-cell modulatory multimeric polypeptides and methods of use thereof
US11530248B2 (en) 2016-12-22 2022-12-20 Cue Biopharma, Inc. T-cell modulatory multimeric polypeptides and methods of use thereof
US11505588B2 (en) 2016-12-22 2022-11-22 Cue Biopharma, Inc. T-cell modulatory multimeric polypeptides and methods of use thereof
US11708400B2 (en) 2016-12-22 2023-07-25 Cue Biopharma, Inc. T-cell modulatory multimeric polypeptides and methods of use thereof
US11377478B2 (en) 2016-12-22 2022-07-05 Cue Biopharma, Inc. T-cell modulatory multimeric polypeptides and methods of use thereof
US11498968B2 (en) 2016-12-22 2022-11-15 Hoffmann-La Roche Inc. Treatment of tumors with an anti-CSF-1R antibody in combination with an anti-PD-L1 antibody after failure of anti-PD-L1/PD1 treatment
US11905320B2 (en) 2016-12-22 2024-02-20 Cue Biopharma, Inc. T-cell modulatory multimeric polypeptides and methods of use thereof
US11370821B2 (en) 2016-12-22 2022-06-28 Cue Biopharma, Inc. T-cell modulatory multimeric polypeptides and methods of use thereof
US11851467B2 (en) 2016-12-22 2023-12-26 Cue Biopharma, Inc. T-cell modulatory multimeric polypeptides and methods of use thereof
RU2766582C2 (en) * 2016-12-23 2022-03-15 Ремд Биотерапьютикс, Инк. Immunotherapy using antibodies binding programmed cell death protein ligand 1 (pd-l1)
EP3559045A4 (en) * 2016-12-23 2020-08-19 REMD Biotherapeutics, Inc. Immunotherapy using antibodies that bind programmed death ligand-1 (pd-l1)
WO2018132279A1 (en) 2017-01-05 2018-07-19 Bristol-Myers Squibb Company Tgf beta receptor antagonists
US11851471B2 (en) 2017-01-09 2023-12-26 Cue Biopharma, Inc. T-cell modulatory multimeric polypeptides and methods of use thereof
WO2018136700A1 (en) 2017-01-20 2018-07-26 Arcus Biosciences, Inc. Azolopyrimidine for the treatment of cancer-related disorders
EP4310082A2 (en) 2017-01-20 2024-01-24 Arcus Biosciences, Inc. Azolopyrimidine for the treatment of cancer-related disorders
WO2018138591A1 (en) 2017-01-24 2018-08-02 Pfizer Inc. Calicheamicin derivatives and antibody drug conjugates thereof
WO2018138110A1 (en) 2017-01-25 2018-08-02 Ose Immunotherapeutics Method for manufacturing a stable emulsion for peptide delivery
EP4029494A1 (en) 2017-01-25 2022-07-20 OSE Immunotherapeutics Method for manufacturing a stable emulsion for peptide delivery
US11555038B2 (en) 2017-01-25 2023-01-17 Beigene, Ltd. Crystalline forms of (S)-7-(1-(but-2-ynoyl)piperidin-4-yl)-2-(4-phenoxyphenyl)-4,5,6,7-tetrahydropyrazolo[1,5-a]pyrimidine-3-carboxamide, preparation, and uses thereof
WO2018146612A1 (en) 2017-02-10 2018-08-16 Novartis Ag 1-(4-amino-5-bromo-6-(1 h-pyrazol-1-yl)pyrimidin-2-yl)-1 h-pyrazol-4-ol and use thereof in the treatment of cancer
WO2018151820A1 (en) 2017-02-16 2018-08-23 Elstar Therapeutics, Inc. Multifunctional molecules comprising a trimeric ligand and uses thereof
WO2018152396A1 (en) 2017-02-17 2018-08-23 Innate Tumor Immunity, Inc. Substituted imidazo-quinolines as nlrp3 modulators
EP3753938A1 (en) 2017-02-17 2020-12-23 Innate Tumor Immunity, Inc. Substituted imidazo-quinolines as nlrp3 modulators
EP3587453A4 (en) * 2017-02-21 2021-07-07 Shanghai Junshi Bioscience Co., Ltd. Anti-pd-l1 antibody and application thereof
US11267890B2 (en) 2017-02-21 2022-03-08 Shanghai Junshi Biosciences Inc. Anti-PD-L1 antibody and application thereof
US11815435B2 (en) 2017-02-24 2023-11-14 Hibercell, Inc. Beta glucan immunopharmacodynamics
US11942149B2 (en) 2017-02-24 2024-03-26 Macrogenics, Inc. Bispecific binding molecules that are capable of binding CD137 and tumor antigens, and uses thereof
US11459394B2 (en) 2017-02-24 2022-10-04 Macrogenics, Inc. Bispecific binding molecules that are capable of binding CD137 and tumor antigens, and uses thereof
WO2018160538A1 (en) 2017-02-28 2018-09-07 Mersana Therapeutics, Inc. Combination therapies of her2-targeted antibody-drug conjugates
WO2018162446A1 (en) 2017-03-06 2018-09-13 Merck Patent Gmbh Aqueous anti-pd-l1 antibody formulation
EP3372615A1 (en) 2017-03-06 2018-09-12 Merck Patent GmbH Composition comprising avelumab
WO2018162430A1 (en) 2017-03-06 2018-09-13 Merck Patent Gmbh Composition comprising avelumab
IL268943B2 (en) * 2017-03-06 2023-06-01 Merck Patent Gmbh Aqueous anti-pd-l1 antibody formulation
WO2018162749A1 (en) 2017-03-09 2018-09-13 Genmab A/S Antibodies against pd-l1
US11104712B2 (en) 2017-03-15 2021-08-31 Cue Biopharma, Inc. Methods for modulating an immune response
US11479595B2 (en) 2017-03-15 2022-10-25 Cue Biopharma, Inc. Methods for modulating an immune response
US11767355B2 (en) 2017-03-15 2023-09-26 Cue Biopharma, Inc. Methods for modulating an immune response
US11958893B2 (en) 2017-03-15 2024-04-16 Cue Biopharma, Inc. Methods for modulating an immune response
WO2018172508A1 (en) 2017-03-24 2018-09-27 INSERM (Institut National de la Santé et de la Recherche Médicale) Methods and compositions for treating melanoma
WO2018178040A1 (en) 2017-03-30 2018-10-04 Merck Patent Gmbh Combination of an anti-pd-l1 antibody and a dna-pk inhibitor for the treatment of cancer
WO2018183928A1 (en) 2017-03-31 2018-10-04 Bristol-Myers Squibb Company Methods of treating tumor
US11603407B2 (en) 2017-04-06 2023-03-14 Regeneron Pharmaceuticals, Inc. Stable antibody formulation
WO2018187613A2 (en) 2017-04-07 2018-10-11 Bristol-Myers Squibb Company Anti-icos agonist antibodies and uses thereof
WO2018194496A2 (en) 2017-04-17 2018-10-25 Закрытое Акционерное Общество "Биокад" Monoclonal antibody to pd-l1
US11236167B2 (en) 2017-04-17 2022-02-01 Joint Stock Company “Biocad” Monoclonal antibody to PD-L1
EP3613770A4 (en) * 2017-04-17 2021-01-27 Joint Stock Company "Biocad" Monoclonal antibody to pd-l1
US11326170B2 (en) 2017-04-18 2022-05-10 Changchun Huapu Biotechnology Co. Ltd. Immunomodulatory polynucleotides and uses thereof
WO2018195283A1 (en) 2017-04-19 2018-10-25 Elstar Therapeutics, Inc. Multispecific molecules and uses thereof
WO2018195397A2 (en) 2017-04-21 2018-10-25 Kyn Therapeutics Indole ahr inhibitors and uses thereof
US11358969B2 (en) 2017-04-21 2022-06-14 Ikena Oncology, Inc. Indole AHR inhibitors and uses thereof
US10689388B1 (en) 2017-04-21 2020-06-23 Ikena Oncology, Inc. Indole AHR inhibitors and uses thereof
US10570138B2 (en) 2017-04-21 2020-02-25 Kyn Therapeutics Indole AHR inhibitors and uses thereof
WO2018200430A1 (en) 2017-04-26 2018-11-01 Bristol-Myers Squibb Company Methods of antibody production that minimize disulfide bond reduction
US10301312B2 (en) 2017-04-27 2019-05-28 Novartis Ag Fused indazole pyridone compounds as antivirals
EP3998269A1 (en) 2017-04-27 2022-05-18 Novartis AG Fused indazole pyridone compounds as antivirals
WO2018198079A1 (en) 2017-04-27 2018-11-01 Novartis Ag Fused indazole pyridone compounds as antivirals
US10975078B2 (en) 2017-04-27 2021-04-13 Novartis Ag Fused indazole pyridone compounds as antivirals
WO2018198091A1 (en) 2017-04-28 2018-11-01 Novartis Ag Antibody conjugates comprising toll-like receptor agonist and combination therapies
WO2018198076A1 (en) 2017-04-28 2018-11-01 Aduro Biotech, Inc. Bis 2'-5'-rr-(3'f-a)(3'f-a) cyclic dinucleotide compound and uses thereof
US10975114B2 (en) 2017-04-28 2021-04-13 Chinook Therapeutics, Inc. Bis 2′-5′-RR-(3′F-A)(3′F-A) cyclic dinucleotide compound and uses thereof
EP4328241A2 (en) 2017-04-28 2024-02-28 Marengo Therapeutics, Inc. Multispecific molecules comprising a non-immunoglobulin heterodimerization domain and uses thereof
WO2018201047A1 (en) 2017-04-28 2018-11-01 Elstar Therapeutics, Inc. Multispecific molecules comprising a non-immunoglobulin heterodimerization domain and uses thereof
WO2018203302A1 (en) 2017-05-05 2018-11-08 Novartis Ag Tricyclic 2-quinolinones as antibacterials
US11607453B2 (en) 2017-05-12 2023-03-21 Harpoon Therapeutics, Inc. Mesothelin binding proteins
US11066392B2 (en) 2017-05-12 2021-07-20 Bristol-Myers Squibb Company Inhibitors of indoleamine 2,3-dioxygenase and methods of their use
WO2018209049A1 (en) 2017-05-12 2018-11-15 Bristol-Myers Squibb Company Inhibitors of indoleamine 2,3-dioxygenase and methods of their use
WO2018213297A1 (en) 2017-05-16 2018-11-22 Bristol-Myers Squibb Company Treatment of cancer with anti-gitr agonist antibodies
WO2018213377A1 (en) 2017-05-17 2018-11-22 Arcus Biosciences, Inc. Quinazoline-pyrazole derivatives for the treatment of cancer-related disorders
US11807686B2 (en) 2017-05-30 2023-11-07 Bristol-Myers Squibb Company Treatment of LAG-3 positive tumors
WO2018222711A2 (en) 2017-05-30 2018-12-06 Bristol-Myers Squibb Company Compositions comprising a combination of an anti-lag-3 antibody, a pd-1 pathway inhibitor, and an immunotherapeutic agent
WO2018222718A1 (en) 2017-05-30 2018-12-06 Bristol-Myers Squibb Company Treatment of lag-3 positive tumors
EP4245375A2 (en) 2017-05-30 2023-09-20 Bristol-Myers Squibb Company Compositions comprising a combination of an anti-lag-3 antibody, a pd-1 pathway inhibitor, and an immunotherapeutic agent
US11723975B2 (en) 2017-05-30 2023-08-15 Bristol-Myers Squibb Company Compositions comprising an anti-LAG-3 antibody or an anti-LAG-3 antibody and an anti-PD-1 or anti-PD-L1 antibody
WO2018222722A2 (en) 2017-05-30 2018-12-06 Bristol-Myers Squibb Company Compositions comprising an anti-lag-3 antibody or an anti-lag-3 antibody and an anti-pd-1 or anti-pd-l1 antibody
EP4306542A2 (en) 2017-05-30 2024-01-17 Bristol-Myers Squibb Company Treatment of lag-3 positive tumors
WO2018220546A1 (en) 2017-05-31 2018-12-06 Novartis Ag Crystalline forms of 5-bromo-2,6-di(1 h-pyrazol-1-yl)pyrimidin-4-amine and new salts
WO2018222901A1 (en) 2017-05-31 2018-12-06 Elstar Therapeutics, Inc. Multispecific molecules that bind to myeloproliferative leukemia (mpl) protein and uses thereof
US11168144B2 (en) 2017-06-01 2021-11-09 Cytomx Therapeutics, Inc. Activatable anti-PDL1 antibodies, and methods of use thereof
WO2018223002A1 (en) 2017-06-01 2018-12-06 Xencor, Inc. Bispecific antibodies that bind cd 123 cd3
US11566073B2 (en) 2017-06-01 2023-01-31 Bristol-Myers Squibb Company Methods of treating a tumor using an anti-PD-1 antibody
WO2018223004A1 (en) 2017-06-01 2018-12-06 Xencor, Inc. Bispecific antibodies that bind cd20 and cd3
WO2018220446A1 (en) 2017-06-01 2018-12-06 Compugen Ltd. Triple combination antibody therapies
WO2018223040A1 (en) 2017-06-01 2018-12-06 Bristol-Myers Squibb Company Methods of treating a tumor using an anti-pd-1 antibody
WO2018225093A1 (en) 2017-06-07 2018-12-13 Glaxosmithkline Intellectual Property Development Limited Chemical compounds as atf4 pathway inhibitors
WO2018225033A1 (en) 2017-06-09 2018-12-13 Glaxosmithkline Intellectual Property Development Limited Combination therapy
WO2018229715A1 (en) 2017-06-16 2018-12-20 Novartis Ag Compositions comprising anti-cd32b antibodies and methods of use thereof
US11542312B2 (en) 2017-06-19 2023-01-03 Medicenna Therapeutics, Inc. IL-2 superagonists in combination with anti-PD-1 antibodies
US11440960B2 (en) 2017-06-20 2022-09-13 Kymab Limited TIGIT antibodies, encoding nucleic acids and methods of using said antibodies in vivo
WO2018237157A1 (en) 2017-06-22 2018-12-27 Novartis Ag Antibody molecules to cd73 and uses thereof
WO2018237173A1 (en) 2017-06-22 2018-12-27 Novartis Ag Antibody molecules to cd73 and uses thereof
WO2018235056A1 (en) 2017-06-22 2018-12-27 Novartis Ag Il-1beta binding antibodies for use in treating cancer
WO2018234879A1 (en) 2017-06-22 2018-12-27 Novartis Ag Il-1beta binding antibodies for use in treating cancer
US11597768B2 (en) 2017-06-26 2023-03-07 Beigene, Ltd. Immunotherapy for hepatocellular carcinoma
US11560425B2 (en) 2017-06-27 2023-01-24 Neuracle Science Co., Ltd. Use of anti-FAM19A5 antibodies for treating cancers
WO2019006007A1 (en) 2017-06-27 2019-01-03 Novartis Ag Dosage regimens for anti-tim-3 antibodies and uses thereof
WO2019006283A1 (en) 2017-06-30 2019-01-03 Bristol-Myers Squibb Company Amorphous and crystalline forms of ido inhibitors
US11236049B2 (en) 2017-06-30 2022-02-01 Bristol-Myers Squibb Company Amorphous and crystalline forms of IDO inhibitors
WO2019008506A1 (en) 2017-07-03 2019-01-10 Glaxosmithkline Intellectual Property Development Limited N-(3-(2-(4-chlorophenoxy)acetamido)bicyclo[1.1.1]pentan-1-yl)-2-cyclobutane-1-carboxamide derivatives and related compounds as atf4 inhibitors for treating cancer and other diseases
WO2019008507A1 (en) 2017-07-03 2019-01-10 Glaxosmithkline Intellectual Property Development Limited 2-(4-chlorophenoxy)-n-((1 -(2-(4-chlorophenoxy)ethynazetidin-3-yl)methyl)acetamide derivatives and related compounds as atf4 inhibitors for treating cancer and other diseases
WO2019014402A1 (en) 2017-07-14 2019-01-17 Innate Tumor Immunity, Inc. Nlrp3 modulators
EP3431088A1 (en) * 2017-07-20 2019-01-23 Paris Sciences et Lettres - Quartier Latin Mntbap for use in inducing a transient immune tolerance
WO2019018730A1 (en) 2017-07-20 2019-01-24 Novartis Ag Dosage regimens of anti-lag-3 antibodies and uses thereof
WO2019021208A1 (en) 2017-07-27 2019-01-31 Glaxosmithkline Intellectual Property Development Limited Indazole derivatives useful as perk inhibitors
WO2019025545A1 (en) 2017-08-04 2019-02-07 Genmab A/S Binding agents binding to pd-l1 and cd137 and use thereof
WO2019035938A1 (en) 2017-08-16 2019-02-21 Elstar Therapeutics, Inc. Multispecific molecules that bind to bcma and uses thereof
US11555026B2 (en) 2017-08-17 2023-01-17 Ikena Oncology, Inc. AHR inhibitors and uses thereof
US10696650B2 (en) 2017-08-17 2020-06-30 Ikena Oncology, Inc. AHR inhibitors and uses thereof
US11814431B2 (en) 2017-08-25 2023-11-14 Five Prime Therapeutics, Inc. B7-H4 antibodies and methods of use thereof
US11306144B2 (en) 2017-08-25 2022-04-19 Five Prime Therapeutics, Inc. B7-H4 antibodies and methods of use thereof
WO2019040780A1 (en) 2017-08-25 2019-02-28 Five Prime Therapeutics Inc. B7-h4 antibodies and methods of use thereof
WO2019049061A1 (en) 2017-09-07 2019-03-14 Glaxosmithkline Intellectual Property Development Limited 5-(1 h-benzo[d]imidazo-2-yl)-pyridin-2-amine and 5-(3h-imidazo[4,5-b]pyridin-6-yl)-pyridin-2-amine derivatives as c-myc and p300/cbp histone acetyltransferase inhibitors for treating cancer
US11497756B2 (en) 2017-09-12 2022-11-15 Sumitomo Pharma Oncology, Inc. Treatment regimen for cancers that are insensitive to BCL-2 inhibitors using the MCL-1 inhibitor alvocidib
WO2019053617A1 (en) 2017-09-12 2019-03-21 Glaxosmithkline Intellectual Property Development Limited Chemical compounds
WO2019059411A1 (en) 2017-09-20 2019-03-28 Chugai Seiyaku Kabushiki Kaisha Dosage regimen for combination therapy using pd-1 axis binding antagonists and gpc3 targeting agent
US11358948B2 (en) 2017-09-22 2022-06-14 Kymera Therapeutics, Inc. CRBN ligands and uses thereof
US11623932B2 (en) 2017-09-22 2023-04-11 Kymera Therapeutics, Inc. Protein degraders and uses thereof
WO2019074824A1 (en) 2017-10-09 2019-04-18 Bristol-Myers Squibb Company Inhibitors of indoleamine 2,3-dioxygenase and methods of their use
US11203592B2 (en) 2017-10-09 2021-12-21 Bristol-Myers Squibb Company Inhibitors of indoleamine 2,3-dioxygenase and methods of their use
WO2019074822A1 (en) 2017-10-09 2019-04-18 Bristol-Myers Squibb Company Inhibitors of indoleamine 2,3-dioxygenase and methods of their use
WO2019072868A1 (en) 2017-10-10 2019-04-18 Numab Therapeutics AG Multispecific antibody
WO2019075090A1 (en) 2017-10-10 2019-04-18 Tilos Therapeutics, Inc. Anti-lap antibodies and uses thereof
EP3470429A1 (en) * 2017-10-10 2019-04-17 Numab Innovation AG Antibodies targeting pdl1 and methods of use thereof
WO2019072870A1 (en) 2017-10-10 2019-04-18 Numab Innovation Ag Antibodies targeting cd137 and methods of use thereof
WO2019072869A1 (en) 2017-10-10 2019-04-18 Numab Innovation Ag Antibodies targeting pdl1 and methods of use thereof
EP3470426A1 (en) 2017-10-10 2019-04-17 Numab Therapeutics AG Multispecific antibody
US11230601B2 (en) 2017-10-10 2022-01-25 Tilos Therapeutics, Inc. Methods of using anti-lap antibodies
CN111225926A (en) * 2017-10-10 2020-06-02 努玛治疗有限公司 Antibodies targeting PDL1 and methods of use thereof
EP3694545A4 (en) * 2017-10-11 2021-12-01 Board Of Regents, The University Of Texas System Human pd-l1 antibodies and methods of use therefor
EP4116327A1 (en) * 2017-10-11 2023-01-11 Board Of Regents, The University Of Texas System Human pd-l1 antibodies and methods of use therefor
US11525002B2 (en) 2017-10-11 2022-12-13 Board Of Regents, The University Of Texas System Human PD-L1 antibodies and methods of use therefor
US11976125B2 (en) 2017-10-13 2024-05-07 Harpoon Therapeutics, Inc. B cell maturation antigen binding proteins
WO2019075032A1 (en) 2017-10-13 2019-04-18 Merck Patent Gmbh Combination of a parp inhibitor and a pd-1 axis binding antagonist
US11713356B2 (en) 2017-10-13 2023-08-01 Ose Immunotherapeutics Modified bifunctional anti-human signal regulatory protein alpha (SIRPa) antibody and method of use thereof for treating cancer
US11919957B2 (en) 2017-10-15 2024-03-05 Bristol-Myers Squibb Company Methods of treating tumor
WO2019075468A1 (en) 2017-10-15 2019-04-18 Bristol-Myers Squibb Company Methods of treating tumor
US11613566B2 (en) 2017-10-18 2023-03-28 Alpine Immune Sciences, Inc. Variant ICOS ligand immunomodulatory proteins and related compositions and methods
WO2019079520A2 (en) 2017-10-18 2019-04-25 Alpine Immune Sciences, Inc. Variant icos ligand immunomodulatory proteins and related compositions and methods
WO2019077062A1 (en) 2017-10-18 2019-04-25 Vivia Biotech, S.L. Bite-activated car-t cells
WO2019077132A1 (en) 2017-10-19 2019-04-25 Debiopharm International S.A. Combination product for the treatment of cancer
WO2019081983A1 (en) 2017-10-25 2019-05-02 Novartis Ag Antibodies targeting cd32b and methods of use thereof
WO2019089753A2 (en) 2017-10-31 2019-05-09 Compass Therapeutics Llc Cd137 antibodies and pd-1 antagonists and uses thereof
WO2019089921A1 (en) 2017-11-01 2019-05-09 Bristol-Myers Squibb Company Immunostimulatory agonistic antibodies for use in treating cancer
WO2019090330A1 (en) 2017-11-06 2019-05-09 Bristol-Myers Squibb Company Methods of treating a tumor
WO2019090198A1 (en) 2017-11-06 2019-05-09 Bristol-Myers Squibb Company Isofuranone compounds useful as hpk1 inhibitors
WO2019097369A1 (en) 2017-11-14 2019-05-23 Pfizer Inc. Ezh2 inhibitor combination therapies
WO2019097479A1 (en) 2017-11-17 2019-05-23 Novartis Ag Novel dihydroisoxazole compounds and their use for the treatment of hepatitis b
US11638760B2 (en) 2017-11-27 2023-05-02 Mersana Therapeutics, Inc. Pyrrolobenzodiazepine antibody conjugates
WO2019101347A1 (en) 2017-11-27 2019-05-31 Ose Immunotherapeutics Improved treatment of cancer
WO2019104289A1 (en) 2017-11-27 2019-05-31 Mersana Therapeutics, Inc. Pyrrolobenzodiazepine antibody conjugates
US11786529B2 (en) 2017-11-29 2023-10-17 Beigene Switzerland Gmbh Treatment of indolent or aggressive B-cell lymphomas using a combination comprising BTK inhibitors
WO2019108900A1 (en) 2017-11-30 2019-06-06 Novartis Ag Bcma-targeting chimeric antigen receptor, and uses thereof
WO2019113464A1 (en) 2017-12-08 2019-06-13 Elstar Therapeutics, Inc. Multispecific molecules and uses thereof
WO2019123207A1 (en) 2017-12-18 2019-06-27 Pfizer Inc. Methods and combination therapy to treat cancer
US11629189B2 (en) 2017-12-19 2023-04-18 Kymab Limited Bispecific antibody for ICOS and PD-L1
WO2019122884A1 (en) 2017-12-19 2019-06-27 Kymab Limited Antibodies to icos
WO2019123285A1 (en) 2017-12-20 2019-06-27 Novartis Ag Fused tricyclic pyrazolo-dihydropyrazinyl-pyridone compounds as antivirals
US11234977B2 (en) 2017-12-20 2022-02-01 Novartis Ag Fused tricyclic pyrazolo-dihydropyrazinyl-pyridone compounds as antivirals
WO2019126691A1 (en) 2017-12-21 2019-06-27 Mersana Therapeutics, Inc. Pyrrolobenzodiazepine antibody conjugates
US10874743B2 (en) 2017-12-26 2020-12-29 Kymera Therapeutics, Inc. IRAK degraders and uses thereof
US11318205B1 (en) 2017-12-26 2022-05-03 Kymera Therapeutics, Inc. IRAK degraders and uses thereof
US11723980B2 (en) 2017-12-26 2023-08-15 Kymera Therapeutics, Inc. IRAK degraders and uses thereof
US11306149B2 (en) 2017-12-27 2022-04-19 Bristol-Myers Squibb Company Anti-CD40 antibodies and uses thereof
US11952427B2 (en) 2017-12-27 2024-04-09 Bristol-Myers Squibb Company Anti-CD40 antibodies and uses thereof
WO2019133747A1 (en) 2017-12-27 2019-07-04 Bristol-Myers Squibb Company Anti-cd40 antibodies and uses thereof
WO2019129211A1 (en) * 2017-12-28 2019-07-04 Nanjing Legend Biotech Co., Ltd. Antibodies and variants thereof against pd-l1
US11865081B2 (en) 2017-12-29 2024-01-09 Virogin Biotech Canada Ltd. Oncolytic viral delivery of therapeutic polypeptides
WO2019134946A1 (en) 2018-01-04 2019-07-11 INSERM (Institut National de la Santé et de la Recherche Médicale) Methods and compositions for treating melanoma resistant
WO2019136112A1 (en) 2018-01-05 2019-07-11 Bristol-Myers Squibb Company Inhibitors of indoleamine 2,3-dioxygenase and methods of their use
US11447449B2 (en) 2018-01-05 2022-09-20 Bristol-Myers Squibb Company Inhibitors of indoleamine 2,3-dioxygenase and methods of their use
WO2019136432A1 (en) 2018-01-08 2019-07-11 Novartis Ag Immune-enhancing rnas for combination with chimeric antigen receptor therapy
US11702461B2 (en) 2018-01-09 2023-07-18 Cue Biopharma, Inc. T-cell modulatory multimeric polypeptides comprising reduced-affinity immunomodulatory polypeptides
US11485743B2 (en) 2018-01-12 2022-11-01 Kymera Therapeutics, Inc. Protein degraders and uses thereof
US11512080B2 (en) 2018-01-12 2022-11-29 Kymera Therapeutics, Inc. CRBN ligands and uses thereof
WO2019140229A1 (en) 2018-01-12 2019-07-18 Bristol-Myers Squibb Company Antibodies against tim3 and uses thereof
WO2019140150A1 (en) 2018-01-12 2019-07-18 Bristol-Myers Squibb Company Combination therapy with anti-il-8 antibodies and anti-pd-1 antibodies for treating cancer
US11932635B2 (en) 2018-01-12 2024-03-19 Kymera Therapeutics, Inc. CRBN ligands and uses thereof
WO2019143607A1 (en) 2018-01-16 2019-07-25 Bristol-Myers Squibb Company Methods of treating cancer with antibodies against tim3
WO2019144098A1 (en) 2018-01-22 2019-07-25 Bristol-Myers Squibb Company Compositions and methods of treating cancer
WO2019144126A1 (en) 2018-01-22 2019-07-25 Pascal Biosciences Inc. Cannabinoids and derivatives for promoting immunogenicity of tumor and infected cells
US10988477B2 (en) 2018-01-29 2021-04-27 Merck Patent Gmbh GCN2 inhibitors and uses thereof
US10793563B2 (en) 2018-01-29 2020-10-06 Merck Patent Gmbh GCN2 inhibitors and uses thereof
WO2019152660A1 (en) 2018-01-31 2019-08-08 Novartis Ag Combination therapy using a chimeric antigen receptor
WO2019152743A1 (en) 2018-01-31 2019-08-08 Celgene Corporation Combination therapy using adoptive cell therapy and checkpoint inhibitor
EP4317972A2 (en) 2018-02-06 2024-02-07 The General Hospital Corporation Repeat rna as biomarkers of tumor immune response
WO2019160956A1 (en) 2018-02-13 2019-08-22 Novartis Ag Chimeric antigen receptor therapy in combination with il-15r and il15
WO2019162325A1 (en) 2018-02-21 2019-08-29 INSERM (Institut National de la Santé et de la Recherche Médicale) Use of sk1 as biomarker for predicting response to immunecheckpoint inhibitors
WO2019165315A1 (en) 2018-02-23 2019-08-29 Syntrix Biosystems Inc. Method for treating cancer using chemokine antagonists alone or in combination
WO2019166951A1 (en) 2018-02-28 2019-09-06 Novartis Ag Indole-2-carbonyl compounds and their use for the treatment of hepatitis b
US11939383B2 (en) 2018-03-02 2024-03-26 Five Prime Therapeutics, Inc. B7-H4 antibodies and methods and use thereof
US11884723B2 (en) 2018-03-13 2024-01-30 Ose Immunotherapeutics Use of anti-human SIRPa v1 antibodies and method for producing anti-SIRPa v1 antibodies
WO2019178269A2 (en) 2018-03-14 2019-09-19 Surface Oncology, Inc. Antibodies that bind cd39 and uses thereof
WO2019178362A1 (en) 2018-03-14 2019-09-19 Elstar Therapeutics, Inc. Multifunctional molecules that bind to calreticulin and uses thereof
WO2019178364A2 (en) 2018-03-14 2019-09-19 Elstar Therapeutics, Inc. Multifunctional molecules and uses thereof
WO2019175243A1 (en) 2018-03-14 2019-09-19 Merck Patent Gmbh Compounds and uses thereof to treat tumors in a subject
EP4043496A1 (en) 2018-03-14 2022-08-17 Surface Oncology, Inc. Antibodies that bind cd39 and uses thereof
US10793637B2 (en) 2018-03-14 2020-10-06 Surface Oncology, Inc. Antibodies that bind CD39 and uses thereof
US10738128B2 (en) 2018-03-14 2020-08-11 Surface Oncology, Inc. Antibodies that bind CD39 and uses thereof
EP3768719A4 (en) * 2018-03-19 2022-04-27 Abeome Corporation High affinity neutralizing monoclonal antibodies to programmed death ligand 1 (pd-l1) and uses thereof
WO2019183040A1 (en) 2018-03-21 2019-09-26 Five Prime Therapeutics, Inc. ANTIBODIES BINDING TO VISTA AT ACIDIC pH
US11332524B2 (en) 2018-03-22 2022-05-17 Surface Oncology, Inc. Anti-IL-27 antibodies and uses thereof
US11242393B2 (en) 2018-03-23 2022-02-08 Bristol-Myers Squibb Company Antibodies against MICA and/or MICB and uses thereof
US11976128B2 (en) 2018-03-23 2024-05-07 Board Of Regents, The University Of Texas System Human PD-L2 antibodies and methods of use therefor
US11952424B2 (en) 2018-03-30 2024-04-09 Merus N.V. Multivalent antibody
WO2019191676A1 (en) 2018-03-30 2019-10-03 Bristol-Myers Squibb Company Methods of treating tumor
WO2019190327A2 (en) 2018-03-30 2019-10-03 Merus N.V. Multivalent antibody
WO2019193540A1 (en) 2018-04-06 2019-10-10 Glaxosmithkline Intellectual Property Development Limited Heteroaryl derivatives of formula (i) as atf4 inhibitors
WO2019193541A1 (en) 2018-04-06 2019-10-10 Glaxosmithkline Intellectual Property Development Limited Bicyclic aromatic ring derivatives of formula (i) as atf4 inhibitors
WO2019200256A1 (en) 2018-04-12 2019-10-17 Bristol-Myers Squibb Company Anticancer combination therapy with cd73 antagonist antibody and pd-1/pd-l1 axis antagonist antibody
WO2019200229A1 (en) 2018-04-13 2019-10-17 Novartis Ag Dosage regimens for anti-pd-l1 antibodies and uses thereof
WO2019204257A1 (en) 2018-04-16 2019-10-24 Arrys Therapeutics, Inc. Ep4 inhibitors and use thereof
WO2019204592A1 (en) 2018-04-18 2019-10-24 Xencor, Inc. Il-15/il-15ra heterodimeric fc fusion proteins and uses thereof
WO2019204665A1 (en) 2018-04-18 2019-10-24 Xencor, Inc. Pd-1 targeted heterodimeric fusion proteins containing il-15/il-15ra fc-fusion proteins and pd-1 antigen binding domains and uses thereof
WO2019204743A1 (en) 2018-04-19 2019-10-24 Checkmate Pharmaceuticals, Inc. Synthetic rig-i-like receptor agonists
EP4353235A2 (en) 2018-04-25 2024-04-17 Innate Tumor Immunity, Inc. Nlrp3 modulators
WO2019209896A1 (en) 2018-04-25 2019-10-31 Innate Tumor Immunity, Inc. Nlrp3 modulators
WO2019213340A1 (en) 2018-05-03 2019-11-07 Bristol-Myers Squibb Company Uracil derivatives as mer-axl inhibitors
WO2019211489A1 (en) 2018-05-04 2019-11-07 Merck Patent Gmbh COMBINED INHIBITION OF PD-1/PD-L1, TGFβ AND DNA-PK FOR THE TREATMENT OF CANCER
WO2019229658A1 (en) 2018-05-30 2019-12-05 Novartis Ag Entpd2 antibodies, combination therapies, and methods of using the antibodies and combination therapies
WO2019232244A2 (en) 2018-05-31 2019-12-05 Novartis Ag Antibody molecules to cd73 and uses thereof
WO2019229701A2 (en) 2018-06-01 2019-12-05 Novartis Ag Binding molecules against bcma and uses thereof
WO2019232528A1 (en) 2018-06-01 2019-12-05 Xencor, Inc. Dosing of a bispecific antibody that bind cd123 and cd3
US11912792B2 (en) 2018-06-22 2024-02-27 Bicycletx Limited Bicyclic peptide ligands specific for nectin-4
WO2019243832A1 (en) 2018-06-22 2019-12-26 Bicycletx Limited Bicyclic peptide ligands specific for nectin-4
US11453702B2 (en) 2018-06-22 2022-09-27 Bicycletx Limited Bicyclic peptide ligands specific for Nectin-4
US11180531B2 (en) 2018-06-22 2021-11-23 Bicycletx Limited Bicyclic peptide ligands specific for Nectin-4
WO2019243833A1 (en) 2018-06-22 2019-12-26 Bicycletx Limited Bicyclic peptide ligands specific for nectin-4
WO2019246528A1 (en) * 2018-06-22 2019-12-26 Vyriad Methods of treating cancer using combination therapy
WO2020006016A1 (en) 2018-06-27 2020-01-02 Bristol-Myers Squibb Company Naphthyridinone compounds useful as t cell activators
WO2020006018A1 (en) 2018-06-27 2020-01-02 Bristol-Myers Squibb Company Substituted naphthyridinone compounds useful as t cell activators
US11845797B2 (en) 2018-07-03 2023-12-19 Marengo Therapeutics, Inc. Anti-TCR antibody molecules and uses thereof
US11965025B2 (en) 2018-07-03 2024-04-23 Marengo Therapeutics, Inc. Method of treating solid cancers with bispecific interleukin-anti-TCRß molecules
WO2020010250A2 (en) 2018-07-03 2020-01-09 Elstar Therapeutics, Inc. Anti-tcr antibody molecules and uses thereof
DE202019005887U1 (en) 2018-07-03 2023-06-14 Marengo Therapeutics, Inc. Anti-TCR antibody molecules and uses thereof
US11897882B2 (en) 2018-07-06 2024-02-13 Kymera Therapeutics, Inc. Tricyclic crbn ligands and uses thereof
US11292792B2 (en) 2018-07-06 2022-04-05 Kymera Therapeutics, Inc. Tricyclic CRBN ligands and uses thereof
WO2020010177A1 (en) 2018-07-06 2020-01-09 Kymera Therapeutics, Inc. Tricyclic crbn ligands and uses thereof
WO2020014132A2 (en) 2018-07-09 2020-01-16 Five Prime Therapeutics, Inc. Antibodies binding to ilt4
WO2020012339A1 (en) 2018-07-09 2020-01-16 Glaxosmithkline Intellectual Property Development Limited Chemical compounds
US11401328B2 (en) 2018-07-09 2022-08-02 Five Prime Therapeutics, Inc. Antibodies binding to ILT4
WO2020012337A1 (en) 2018-07-10 2020-01-16 Novartis Ag 3-(5-amino-1-oxoisoindolin-2-yl)piperidine-2,6-dione derivatives and their use in the treatment of i karos family zinc finger 2 (ikzf2)-dependent diseases
WO2020012334A1 (en) 2018-07-10 2020-01-16 Novartis Ag 3-(5-hydroxy-1-oxoisoindolin-2-yl)piperidine-2,6-dione derivatives and their use in the treatment of ikaros family zinc finger 2 (ikzf2)-dependent diseases
EP4306111A2 (en) 2018-07-10 2024-01-17 Novartis AG 3-(5-hydroxy-1-oxoisoindolin-2-yl)piperidine-2,6-dione derivatives and uses thereof
WO2020014327A2 (en) 2018-07-11 2020-01-16 Five Prime Therapeutics, Inc. Antibodies binding to vista at acidic ph
US11214619B2 (en) 2018-07-20 2022-01-04 Surface Oncology, Inc. Anti-CD112R compositions and methods
US11279758B2 (en) 2018-07-20 2022-03-22 Surface Oncology, Inc. Anti-CD112R compositions and methods
WO2020023356A1 (en) 2018-07-23 2020-01-30 Bristol-Myers Squibb Company Inhibitors of indoleamine 2,3-dioxygenase and methods of their use
WO2020023355A1 (en) 2018-07-23 2020-01-30 Bristol-Myers Squibb Company Inhibitors of indoleamine 2,3-dioxygenase and methods of their use
US11034771B2 (en) 2018-07-25 2021-06-15 I-Mab Biopharma Us Limited Anti-CD73 anti-PD-L1 bispecific antibodies
WO2020023707A1 (en) 2018-07-26 2020-01-30 Bristol-Myers Squibb Company Lag-3 combination therapy for the treatment of cancer
WO2020027224A1 (en) 2018-07-31 2020-02-06 国立大学法人東京大学 Super versatile method for imparting new binding specificity to antibody
WO2020031107A1 (en) 2018-08-08 2020-02-13 Glaxosmithkline Intellectual Property Development Limited Chemical compounds
WO2020037094A1 (en) 2018-08-16 2020-02-20 Innate Tumor Immunity, Inc. Substitued 4-amino-1h-imidazo[4,5-c]quinoline compounds and improved methods for their preparation
WO2020037092A1 (en) 2018-08-16 2020-02-20 Innate Tumor Immunity, Inc. Imidazo[4,5-c]quinoline derived nlrp3-modulators
WO2020037091A1 (en) 2018-08-16 2020-02-20 Innate Tumor Immunity, Inc. Imidazo[4,5-c]quinoline derived nlrp3-modulators
EP3841126A4 (en) * 2018-08-20 2022-08-10 1Globe Biomedical Co., Ltd. Novel cancer immunotherapy antibody compositions
US11566066B2 (en) 2018-08-20 2023-01-31 Pfizer Inc. Anti-GDF15 antibodies, compositions and methods of use
WO2020039321A2 (en) 2018-08-20 2020-02-27 Pfizer Inc. Anti-gdf15 antibodies, compositions and methods of use
WO2020043683A1 (en) 2018-08-27 2020-03-05 Pieris Pharmaceuticals Gmbh Combination therapies comprising cd137/her2 bispecific agents and pd-1 axis inhibitors and uses thereof
US10959986B2 (en) 2018-08-29 2021-03-30 Bristol-Myers Squibb Company Inhibitors of indoleamine 2,3-dioxygenase and methods of their use
US11253525B2 (en) 2018-08-29 2022-02-22 Bristol-Myers Squibb Company Inhibitors of indoleamine 2,3-dioxygenase and methods of their use
WO2020051424A1 (en) 2018-09-07 2020-03-12 Pic Therapeutics Eif4e inhibitors and uses thereof
WO2020053654A1 (en) 2018-09-12 2020-03-19 Novartis Ag Antiviral pyridopyrazinedione compounds
US11072610B2 (en) 2018-09-12 2021-07-27 Novartis Ag Antiviral pyridopyrazinedione compounds
US11807692B2 (en) 2018-09-25 2023-11-07 Harpoon Therapeutics, Inc. DLL3 binding proteins and methods of use
WO2020064971A1 (en) 2018-09-26 2020-04-02 Merck Patent Gmbh Combination of a pd-1 antagonist, an atr inhibitor and a platinating agent for the treatment of cancer
WO2020069372A1 (en) 2018-09-27 2020-04-02 Elstar Therapeutics, Inc. Csf1r/ccr2 multispecific antibodies
WO2020072821A2 (en) 2018-10-03 2020-04-09 Xencor, Inc. Il-12 heterodimeric fc-fusion proteins
US11130802B2 (en) 2018-10-10 2021-09-28 Tilos Therapeutics, Inc. Anti-lap antibody variants
WO2020076969A2 (en) 2018-10-10 2020-04-16 Tilos Therapeutics, Inc. Anti-lap antibody variants and uses thereof
WO2020077276A2 (en) 2018-10-12 2020-04-16 Xencor, Inc. Pd-1 targeted il-15/il-15ralpha fc fusion proteins and uses in combination therapies thereof
WO2020079581A1 (en) 2018-10-16 2020-04-23 Novartis Ag Tumor mutation burden alone or in combination with immune markers as biomarkers for predicting response to targeted therapy
WO2020081928A1 (en) 2018-10-19 2020-04-23 Bristol-Myers Squibb Company Combination therapy for melanoma
WO2020086479A1 (en) 2018-10-22 2020-04-30 Glaxosmithkline Intellectual Property Development Limited Dosing
WO2020086476A1 (en) 2018-10-22 2020-04-30 Glaxosmithkline Intellectual Property Development Limited Dosing
WO2020086724A1 (en) 2018-10-23 2020-04-30 Bristol-Myers Squibb Company Methods of treating tumor
WO2020092385A1 (en) 2018-10-29 2020-05-07 Mersana Therapeutics, Inc. Cysteine engineered antibody-drug conjugates with peptide-containing linkers
WO2020089811A1 (en) 2018-10-31 2020-05-07 Novartis Ag Dc-sign antibody drug conjugates
WO2020093024A2 (en) 2018-11-01 2020-05-07 Merck Patent Gmbh Methods of administering anti-tim-3 antibodies
WO2020093023A1 (en) 2018-11-01 2020-05-07 Merck Patent Gmbh Anti-tim-3 antibodies
WO2020095184A1 (en) 2018-11-05 2020-05-14 Pfizer Inc. Combinations for treating cancer
WO2020095183A1 (en) 2018-11-05 2020-05-14 Pfizer Inc. Combination for treating cancer
WO2020094744A1 (en) 2018-11-06 2020-05-14 Genmab A/S Antibody formulation
WO2020102501A1 (en) 2018-11-16 2020-05-22 Bristol-Myers Squibb Company Anti-nkg2a antibodies and uses thereof
WO2020104496A1 (en) 2018-11-20 2020-05-28 INSERM (Institut National de la Santé et de la Recherche Médicale) Bispecific antibody targeting transferrin receptor 1 and soluble antigen
WO2020104479A1 (en) 2018-11-20 2020-05-28 INSERM (Institut National de la Santé et de la Recherche Médicale) Methods and compositions for treating cancers and resistant cancers with anti transferrin receptor 1 antibodies
WO2020109328A1 (en) 2018-11-26 2020-06-04 Debiopharm International S.A. Combination treatment of hiv infections
US11807636B2 (en) 2018-11-30 2023-11-07 Kymera Therapeutics, Inc. IRAK degraders and uses thereof
US11117889B1 (en) 2018-11-30 2021-09-14 Kymera Therapeutics, Inc. IRAK degraders and uses thereof
WO2020110056A1 (en) 2018-11-30 2020-06-04 Glaxosmithkline Intellectual Property Development Limited Compounds useful in hiv therapy
US11352350B2 (en) 2018-11-30 2022-06-07 Kymera Therapeutics, Inc. IRAK degraders and uses thereof
US11530231B2 (en) 2018-12-04 2022-12-20 Sumitomo Pharma Oncology, Inc. CDK9 inhibitors and polymorphs thereof for use as agents for treatment of cancer
WO2020117849A1 (en) 2018-12-04 2020-06-11 Bristol-Myers Squibb Company Methods of analysis using in-sample calibration curve by multiple isotopologue reaction monitoring
WO2020117988A1 (en) 2018-12-04 2020-06-11 Tolero Pharmaceuticals, Inc. Cdk9 inhibitors and polymorphs thereof for use as agents for treatment of cancer
US11034710B2 (en) 2018-12-04 2021-06-15 Sumitomo Dainippon Pharma Oncology, Inc. CDK9 inhibitors and polymorphs thereof for use as agents for treatment of cancer
WO2020115261A1 (en) 2018-12-07 2020-06-11 INSERM (Institut National de la Santé et de la Recherche Médicale) Methods and compositions for treating melanoma
WO2020120592A1 (en) 2018-12-12 2020-06-18 INSERM (Institut National de la Santé et de la Recherche Médicale) Methods and compositions for predicting and treating melanoma
WO2020127411A1 (en) 2018-12-19 2020-06-25 INSERM (Institut National de la Santé et de la Recherche Médicale) Methods and compositions for treating cancers by immuno-modulation using antibodies against cathespin-d
WO2020132646A1 (en) 2018-12-20 2020-06-25 Xencor, Inc. Targeted heterodimeric fc fusion proteins containing il-15/il-15ra and nkg2d antigen binding domains
WO2020128972A1 (en) 2018-12-20 2020-06-25 Novartis Ag Dosing regimen and pharmaceutical combination comprising 3-(1-oxoisoindolin-2-yl)piperidine-2,6-dione derivatives
WO2020127853A1 (en) 2018-12-20 2020-06-25 Abivax Biomarkers, and uses in treatment of viral infections, inflammations, or cancer
EP3670659A1 (en) 2018-12-20 2020-06-24 Abivax Biomarkers, and uses in treatment of viral infections, inflammations, or cancer
WO2020127885A1 (en) 2018-12-21 2020-06-25 INSERM (Institut National de la Santé et de la Recherche Médicale) Compositions for treating cancers and resistant cancers
WO2020128620A1 (en) 2018-12-21 2020-06-25 Novartis Ag Use of il-1beta binding antibodies
WO2020128637A1 (en) 2018-12-21 2020-06-25 Novartis Ag Use of il-1 binding antibodies in the treatment of a msi-h cancer
WO2020127965A1 (en) 2018-12-21 2020-06-25 Onxeo New conjugated nucleic acid molecules and their uses
WO2020128613A1 (en) 2018-12-21 2020-06-25 Novartis Ag Use of il-1beta binding antibodies
WO2020128893A1 (en) 2018-12-21 2020-06-25 Pfizer Inc. Combination treatments of cancer comprising a tlr agonist
WO2020128636A1 (en) 2018-12-21 2020-06-25 Novartis Ag Use of il-1 beta antibodies in the treatment or prevention of myelodysplastic syndrome
WO2020136235A1 (en) 2018-12-28 2020-07-02 Transgene Sa M2-defective poxvirus
KR20210110838A (en) 2018-12-28 2021-09-09 트랜스진 에스.에이. M2 defective poxvirus
WO2020150113A1 (en) 2019-01-14 2020-07-23 Innate Tumor Immunity, Inc. Substituted quinazolines as nlrp3 modulators, for use in the treatment of cancer
WO2020150116A1 (en) 2019-01-14 2020-07-23 Innate Tumor Immunity, Inc. Nlrp3 modulators
WO2020150114A1 (en) 2019-01-14 2020-07-23 Innate Tumor Immunity, Inc. Heterocyclic nlrp3 modulators, for use in the treatment of cancer
WO2020150115A1 (en) 2019-01-14 2020-07-23 Innate Tumor Immunity, Inc. Nlrp3 modulators
WO2020157131A1 (en) 2019-01-30 2020-08-06 INSERM (Institut National de la Santé et de la Recherche Médicale) Methods and compositions for identifying whether a subject suffering from a cancer will achieve a response with an immune-checkpoint inhibitor
WO2020161083A1 (en) 2019-02-04 2020-08-13 INSERM (Institut National de la Santé et de la Recherche Médicale) Methods and compositions for modulating blood-brain barrier
US11471456B2 (en) 2019-02-12 2022-10-18 Sumitomo Pharma Oncology, Inc. Formulations comprising heterocyclic protein kinase inhibitors
WO2020165370A1 (en) 2019-02-13 2020-08-20 INSERM (Institut National de la Santé et de la Recherche Médicale) Methods and compositions for selecting a cancer treatment in a subject suffering from cancer
WO2020165833A1 (en) 2019-02-15 2020-08-20 Novartis Ag 3-(1-oxo-5-(piperidin-4-yl)isoindolin-2-yl)piperidine-2,6-dione derivatives and uses thereof
WO2020165834A1 (en) 2019-02-15 2020-08-20 Novartis Ag Substituted 3-(1-oxoisoindolin-2-yl)piperidine-2,6-dione derivatives and uses thereof
WO2020171757A1 (en) * 2019-02-18 2020-08-27 Medivir Aktiebolag Methods for treating liver cancers using an orally administered dioxolane nucleotide in combination with an anti-pd1 or anti-pdl1 monoclonal antibody
EP3929213A4 (en) * 2019-02-21 2023-03-08 Eucure (Beijing) Biopharma Co., Ltd Anti-pd-l1 antibody and use thereof
WO2020187998A1 (en) 2019-03-19 2020-09-24 Fundació Privada Institut D'investigació Oncològica De Vall Hebron Combination therapy with omomyc and an antibody binding pd-1 or ctla-4 for the treatment of cancer
US11793802B2 (en) 2019-03-20 2023-10-24 Sumitomo Pharma Oncology, Inc. Treatment of acute myeloid leukemia (AML) with venetoclax failure
US11712433B2 (en) 2019-03-22 2023-08-01 Sumitomo Pharma Oncology, Inc. Compositions comprising PKM2 modulators and methods of treatment using the same
WO2020198077A1 (en) 2019-03-22 2020-10-01 Sumitomo Dainippon Pharma Oncology, Inc. Compositions comprising pkm2 modulators and methods of treatment using the same
WO2020198676A1 (en) 2019-03-28 2020-10-01 Bristol-Myers Squibb Company Methods of treating tumor
WO2020198672A1 (en) 2019-03-28 2020-10-01 Bristol-Myers Squibb Company Methods of treating tumor
WO2020201753A1 (en) 2019-04-02 2020-10-08 Bicycletx Limited Bicycle toxin conjugates and uses thereof
US11746120B2 (en) 2019-04-05 2023-09-05 Kymera Therapeutics, Inc. Stat degraders and uses thereof
US11485750B1 (en) 2019-04-05 2022-11-01 Kymera Therapeutics, Inc. STAT degraders and uses thereof
WO2020216379A1 (en) 2019-04-26 2020-10-29 I-Mab Human pd-l1 antibodies
EP3833691A4 (en) * 2019-04-26 2022-05-18 I-Mab Biopharma US Limited Human pd-l1 antibodies
WO2020221796A1 (en) 2019-04-30 2020-11-05 INSERM (Institut National de la Santé et de la Recherche Médicale) Methods and compositions for treating melanoma
WO2020239558A1 (en) 2019-05-24 2020-12-03 Pfizer Inc. Combination therapies using cdk inhibitors
WO2020243570A1 (en) 2019-05-30 2020-12-03 Bristol-Myers Squibb Company Cell localization signature and combination therapy
WO2020243563A1 (en) 2019-05-30 2020-12-03 Bristol-Myers Squibb Company Multi-tumor gene signatures for suitability to immuno-oncology therapy
WO2020243568A1 (en) 2019-05-30 2020-12-03 Bristol-Myers Squibb Company Methods of identifying a subject suitable for an immuno-oncology (i-o) therapy
WO2020243423A1 (en) 2019-05-31 2020-12-03 Ikena Oncology, Inc. Tead inhibitors and uses thereof
EP3929215A4 (en) * 2019-06-10 2022-06-22 Shandong Boan Biotechnology Co., Ltd. Bifunctional fusion protein against pdl1 and tgf? and use thereof
WO2020249071A1 (en) * 2019-06-12 2020-12-17 Nanjing GenScript Biotech Co., Ltd. Anti-pd-l1/anti-lag-3 multiple antigen binding proteins and methods of use thereof
CN114008080A (en) * 2019-06-12 2022-02-01 南京金斯瑞生物科技有限公司 anti-PD-L1/anti-LAG-3 multiple antigen binding proteins and methods of use thereof
CN114008080B (en) * 2019-06-12 2023-06-09 南京金斯瑞生物科技有限公司 anti-PD-L1/anti-LAG-3 multi-antigen binding proteins and methods of use thereof
US11529350B2 (en) 2019-07-03 2022-12-20 Sumitomo Pharma Oncology, Inc. Tyrosine kinase non-receptor 1 (TNK1) inhibitors and uses thereof
WO2021003417A1 (en) 2019-07-03 2021-01-07 Sumitomo Dainippon Pharma Oncology, Inc. Tyrosine kinase non-receptor 1 (tnk1) inhibitors and uses thereof
EP3999534A4 (en) * 2019-07-19 2023-02-08 Beijing Sinotau Bio-Pharmaceuticals Technology Co., Ltd. A novel anti-pd-l1 antibody and use thereof
WO2021041588A1 (en) 2019-08-28 2021-03-04 Bristol-Myers Squibb Company Substituted pyridopyrimidinonyl compounds useful as t cell activators
WO2021048292A1 (en) 2019-09-11 2021-03-18 INSERM (Institut National de la Santé et de la Recherche Médicale) Methods and compositions for treating melanoma
US11021481B2 (en) 2019-09-13 2021-06-01 Nimbus Saturn, Inc. Substituted isoindolin-1-ones and 2,3-dihydro-1h-pyrrolo[3,4-c]pyridin-1-ones as HPK1 antagonists
US11034694B2 (en) 2019-09-13 2021-06-15 Nimbus Saturn, Inc. Substituted isoindolin-1-ones and 2,3-dihydro-1H-pyrrolo[3,4-c]pyridin-1-ones as HPK1 antagonists
US11028085B2 (en) 2019-09-13 2021-06-08 Nimbus Saturn, Inc. Substituted isoindolin-1-ones and 2,3-dihydro-1h-pyrrolo[3,4-c]pyridin-1-ones as hpk1 antagonists
US11078201B2 (en) 2019-09-13 2021-08-03 Nimbus Saturn, Inc. Substituted isoindolin-1-ones and 2,3-dihydro-1H-pyrrol[3,4-c]pyridin-1-ones as HPK1 antagonists
US11548890B1 (en) 2019-09-13 2023-01-10 Nimbus Saturn, Inc. HPK1 antagonists and uses thereof
US11655303B2 (en) 2019-09-16 2023-05-23 Surface Oncology, Inc. Anti-CD39 antibody compositions and methods
WO2021053560A1 (en) 2019-09-18 2021-03-25 Novartis Ag Combination therapy with entpd2 and cd73 antibodies
WO2021053559A1 (en) 2019-09-18 2021-03-25 Novartis Ag Entpd2 antibodies, combination therapies, and methods of using the antibodies and combination therapies
WO2021055698A1 (en) 2019-09-19 2021-03-25 Bristol-Myers Squibb Company Antibodies binding to vista at acidic ph
WO2021053207A1 (en) 2019-09-20 2021-03-25 Transgene Combination of a poxvirus encoding hpv polypeptides and il-2 with an anti-pd-l1 antibody
WO2021055994A1 (en) 2019-09-22 2021-03-25 Bristol-Myers Squibb Company Quantitative spatial profiling for lag-3 antagonist therapy
WO2021062018A1 (en) 2019-09-25 2021-04-01 Bristol-Myers Squibb Company Composite biomarker for cancer therapy
WO2021062244A1 (en) 2019-09-25 2021-04-01 Surface Oncology, Inc. Anti-il-27 antibodies and uses thereof
US11667613B2 (en) 2019-09-26 2023-06-06 Novartis Ag Antiviral pyrazolopyridinone compounds
WO2021058711A2 (en) 2019-09-27 2021-04-01 Glaxosmithkline Intellectual Property Development Limited Antigen binding proteins
WO2021067863A2 (en) 2019-10-03 2021-04-08 Xencor, Inc. Targeted il-12 heterodimeric fc-fusion proteins
WO2021064180A1 (en) 2019-10-03 2021-04-08 INSERM (Institut National de la Santé et de la Recherche Médicale) Methods and compositions for modulating macrophages polarization
WO2021072298A1 (en) 2019-10-11 2021-04-15 Genentech, Inc. Pd-1 targeted il-15/il-15ralpha fc fusion proteins with improved properties
WO2021074391A1 (en) 2019-10-17 2021-04-22 INSERM (Institut National de la Santé et de la Recherche Médicale) Methods for diagnosing nasal intestinal type adenocarcinomas
WO2021079195A1 (en) 2019-10-21 2021-04-29 Novartis Ag Tim-3 inhibitors and uses thereof
WO2021079188A1 (en) 2019-10-21 2021-04-29 Novartis Ag Combination therapies with venetoclax and tim-3 inhibitors
WO2021081353A1 (en) 2019-10-23 2021-04-29 Checkmate Pharmaceuticals, Inc. Synthetic rig-i-like receptor agonists
KR20220088425A (en) 2019-10-25 2022-06-27 다이이찌 산쿄 가부시키가이샤 Combination of anti-GARP antibodies and immunomodulators
WO2021079958A1 (en) 2019-10-25 2021-04-29 第一三共株式会社 Combination of anti-garp antibody and immunoregulator
WO2021083959A1 (en) 2019-10-29 2021-05-06 INSERM (Institut National de la Santé et de la Recherche Médicale) Methods and compositions for treating uveal melanoma
WO2021091885A2 (en) 2019-11-04 2021-05-14 Alector Llc Siglec-9 ecd fusion molecules and methods of use thereof
WO2021092220A1 (en) 2019-11-06 2021-05-14 Bristol-Myers Squibb Company Methods of identifying a subject with a tumor suitable for a checkpoint inhibitor therapy
WO2021092221A1 (en) 2019-11-06 2021-05-14 Bristol-Myers Squibb Company Methods of identifying a subject with a tumor suitable for a checkpoint inhibitor therapy
WO2021092380A1 (en) 2019-11-08 2021-05-14 Bristol-Myers Squibb Company Lag-3 antagonist therapy for melanoma
WO2021097256A1 (en) 2019-11-14 2021-05-20 Cohbar, Inc. Cxcr4 antagonist peptides
WO2021101919A1 (en) 2019-11-19 2021-05-27 Bristol-Myers Squibb Company Compounds useful as inhibitors of helios protein
WO2021102343A1 (en) 2019-11-22 2021-05-27 Sumitomo Dainippon Pharma Oncology, Inc. Solid dose pharmaceutical composition
WO2021108528A1 (en) 2019-11-26 2021-06-03 Ikena Oncology, Inc. Polymorphic carbazole derivatives and uses thereof
WO2021108288A1 (en) 2019-11-26 2021-06-03 Bristol-Myers Squibb Company Salts/cocrystals of (r)-n-(4-chlorophenyl)-2-((1s,4s)-4-(6-fluoroquinolin-4-yl)cyclohexyl)propanamide
US11591339B2 (en) 2019-11-26 2023-02-28 Ikena Oncology, Inc. Solid forms of (R)-N-(2-(5-fluoropyridin-3-yl)-8-isopropylpyrazolo[ 1,5-a][1,3,5]triazin-4-yl)-2,3,4,9-tetrahydro-1H-carbazol-3-amine maleate as aryl hydrocarbon receptor (AHR) inhibitors
WO2021106978A1 (en) 2019-11-27 2021-06-03 サイトリミック株式会社 Pharmaceutical composition
US11591332B2 (en) 2019-12-17 2023-02-28 Kymera Therapeutics, Inc. IRAK degraders and uses thereof
US11707457B2 (en) 2019-12-17 2023-07-25 Kymera Therapeutics, Inc. IRAK degraders and uses thereof
US11779578B2 (en) 2019-12-17 2023-10-10 Kymera Therapeutics, Inc. IRAK degraders and uses thereof
WO2021123243A1 (en) 2019-12-19 2021-06-24 INSERM (Institut National de la Santé et de la Recherche Médicale) Methods and vaccine compositions to treat cancers
WO2021127554A1 (en) 2019-12-19 2021-06-24 Bristol-Myers Squibb Company Combinations of dgk inhibitors and checkpoint antagonists
WO2021123996A1 (en) 2019-12-20 2021-06-24 Novartis Ag Uses of anti-tgf-beta antibodies and checkpoint inhibitors for the treatment of proliferative diseases
WO2021123902A1 (en) 2019-12-20 2021-06-24 Novartis Ag Combination of anti tim-3 antibody mbg453 and anti tgf-beta antibody nis793, with or without decitabine or the anti pd-1 antibody spartalizumab, for treating myelofibrosis and myelodysplastic syndrome
WO2021133750A1 (en) 2019-12-23 2021-07-01 Bristol-Myers Squibb Company Substituted bicyclic piperidine derivatives useful as t cell activators
US11679109B2 (en) 2019-12-23 2023-06-20 Kymera Therapeutics, Inc. SMARCA degraders and uses thereof
WO2021133749A1 (en) 2019-12-23 2021-07-01 Bristol-Myers Squibb Company Substituted piperazine derivatives useful as t cell activators
WO2021133748A1 (en) 2019-12-23 2021-07-01 Bristol-Myers Squibb Company Substituted quinolinonyl piperazine compounds useful as t cell activators
WO2021133752A1 (en) 2019-12-23 2021-07-01 Bristol-Myers Squibb Company Substituted heteroaryl compounds useful as t cell activators
WO2021133751A1 (en) 2019-12-23 2021-07-01 Bristol-Myers Squibb Company Substituted quinazolinyl compounds useful as t cell activators
WO2021138407A2 (en) 2020-01-03 2021-07-08 Marengo Therapeutics, Inc. Multifunctional molecules that bind to cd33 and uses thereof
WO2021141907A1 (en) 2020-01-06 2021-07-15 Hifibio (Hong Kong) Limited Anti-tnfr2 antibody and uses thereof
WO2021139682A1 (en) 2020-01-07 2021-07-15 Hifibio (Hk) Limited Anti-galectin-9 antibody and uses thereof
WO2021142203A1 (en) 2020-01-10 2021-07-15 Innate Tumor Immunity, Inc. Nlrp3 modulators
WO2021146370A1 (en) 2020-01-15 2021-07-22 Blueprint Medicines Corporation Map4k1 inhibitors
WO2021144426A1 (en) 2020-01-17 2021-07-22 INSERM (Institut National de la Santé et de la Recherche Médicale) Methods and compositions for treating melanoma
WO2021144657A1 (en) 2020-01-17 2021-07-22 Novartis Ag Combination comprising a tim-3 inhibitor and a hypomethylating agent for use in treating myelodysplastic syndrome or chronic myelomonocytic leukemia
WO2021152005A1 (en) 2020-01-28 2021-08-05 Universite De Strasbourg Antisense oligonucleotide targeting linc00518 for treating melanoma
WO2021154073A1 (en) 2020-01-29 2021-08-05 Merus N.V. Means and method for modulating immune cell engaging effects.
WO2021152548A1 (en) 2020-01-30 2021-08-05 Benitah Salvador Aznar Combination therapy for treatment of cancer and cancer metastasis
WO2021156360A1 (en) 2020-02-05 2021-08-12 INSERM (Institut National de la Santé et de la Recherche Médicale) Methods for discontinuing a treatment with a tyrosine kinase inhibitor (tki)
WO2021158938A1 (en) 2020-02-06 2021-08-12 Bristol-Myers Squibb Company Il-10 and uses thereof
WO2021167964A1 (en) 2020-02-18 2021-08-26 Alector Llc Pilra antibodies and methods of use thereof
WO2021174045A1 (en) 2020-02-28 2021-09-02 Bristol-Myers Squibb Company Radiolabeled fibronectin based scaffolds and antibodies and theranostic uses thereof
WO2021170777A1 (en) 2020-02-28 2021-09-02 INSERM (Institut National de la Santé et de la Recherche Médicale) Methods for diagnosing, prognosing and managing treatment of breast cancer
WO2021171264A1 (en) 2020-02-28 2021-09-02 Novartis Ag Dosing of a bispecific antibody that binds cd123 and cd3
WO2021178488A1 (en) 2020-03-03 2021-09-10 PIC Therapeutics, Inc. Eif4e inhibitors and uses thereof
WO2021178807A1 (en) 2020-03-06 2021-09-10 Celgene Quanticel Research, Inc. Combination of an lsd-1 inhibitor and nivolumab for use in treating sclc or sqnsclc
WO2021176424A1 (en) 2020-03-06 2021-09-10 Ona Therapeutics, S.L. Anti-cd36 antibodies and their use to treat cancer
WO2021183428A1 (en) 2020-03-09 2021-09-16 Bristol-Myers Squibb Company Antibodies to cd40 with enhanced agonist activity
EP3878446A1 (en) 2020-03-09 2021-09-15 Universite De Geneve Hsd11b1 inhibitors for use in immunotherapy and uses thereof
WO2021180643A1 (en) 2020-03-09 2021-09-16 Universite De Geneve Hsd11b1 inhibitors for use in immunotherapy and uses thereof
WO2021188769A1 (en) 2020-03-19 2021-09-23 Arcus Biosciences, Inc. Tetralin and tetrahydroquinoline compounds as inhibitors of hif-2alpha
US11932624B2 (en) 2020-03-19 2024-03-19 Kymera Therapeutics, Inc. MDM2 degraders and uses thereof
WO2021194914A1 (en) 2020-03-23 2021-09-30 Bristol-Myers Squibb Company Substituted oxoisoindoline compounds for the treatment of cancer
WO2021207449A1 (en) 2020-04-09 2021-10-14 Merck Sharp & Dohme Corp. Affinity matured anti-lap antibodies and uses thereof
WO2021209358A1 (en) 2020-04-14 2021-10-21 Glaxosmithkline Intellectual Property Development Limited Combination treatment for cancer based upon an icos antibody and a pd-l1 antibody tgf-beta-receptor fusion protein
WO2021224215A1 (en) 2020-05-05 2021-11-11 F. Hoffmann-La Roche Ag Predicting response to pd-1 axis inhibitors
US11878062B2 (en) 2020-05-12 2024-01-23 Cue Biopharma, Inc. Multimeric T-cell modulatory polypeptides and methods of use thereof
WO2021231732A1 (en) 2020-05-15 2021-11-18 Bristol-Myers Squibb Company Antibodies to garp
WO2021247591A1 (en) 2020-06-02 2021-12-09 Arcus Biosciences, Inc. Antibodies to tigit
US11685750B2 (en) 2020-06-03 2023-06-27 Kymera Therapeutics, Inc. Crystalline forms of IRAK degraders
WO2021249969A1 (en) 2020-06-10 2021-12-16 Merck Patent Gmbh Combination product for the treatment of cancer diseases
WO2021255223A1 (en) 2020-06-19 2021-12-23 Onxeo New conjugated nucleic acid molecules and their uses
WO2021258010A1 (en) 2020-06-19 2021-12-23 Gossamer Bio Services, Inc. Oxime compounds useful as t cell activators
WO2021260528A1 (en) 2020-06-23 2021-12-30 Novartis Ag Dosing regimen comprising 3-(1-oxoisoindolin-2-yl)piperidine-2,6-dione derivatives
WO2022003554A1 (en) 2020-07-01 2022-01-06 Pfizer Inc. Biomarkers for pd-1 axis binding antagonist therapy
WO2022023379A1 (en) 2020-07-28 2022-02-03 INSERM (Institut National de la Santé et de la Recherche Médicale) Methods and compositions for preventing and treating a cancer
US11857535B2 (en) 2020-07-30 2024-01-02 Kymera Therapeutics, Inc. Methods of treating mutant lymphomas
WO2022029573A1 (en) 2020-08-03 2022-02-10 Novartis Ag Heteroaryl substituted 3-(1-oxoisoindolin-2-yl)piperidine-2,6-dione derivatives and uses thereof
WO2022033419A2 (en) 2020-08-10 2022-02-17 Shanghai Xbh Biotechnology Co., Ltd. Compositions and methods for treating autoimmune diseases and cancers by targeting igsf8
WO2022038158A1 (en) 2020-08-17 2022-02-24 Bicycletx Limited Bicycle conjugates specific for nectin-4 and uses thereof
WO2022047046A1 (en) 2020-08-26 2022-03-03 Marengo Therapeutics, Inc. Methods of detecting trbc1 or trbc2
WO2022047189A1 (en) 2020-08-28 2022-03-03 Bristol-Myers Squibb Company Lag-3 antagonist therapy for hepatocellular carcinoma
WO2022047412A1 (en) 2020-08-31 2022-03-03 Bristol-Myers Squibb Company Cell localization signature and immunotherapy
WO2022053703A1 (en) 2020-09-14 2022-03-17 Boehringer Ingelheim International Gmbh Heterologous prime boost vaccine
WO2022076318A1 (en) 2020-10-05 2022-04-14 Bristol-Myers Squibb Company Methods for concentrating proteins
WO2022076596A1 (en) 2020-10-06 2022-04-14 Codiak Biosciences, Inc. Extracellular vesicle-aso constructs targeting stat6
WO2022084531A1 (en) 2020-10-23 2022-04-28 INSERM (Institut National de la Santé et de la Recherche Médicale) Methods and compositions for treating glioma
WO2022087402A1 (en) 2020-10-23 2022-04-28 Bristol-Myers Squibb Company Lag-3 antagonist therapy for lung cancer
WO2022094567A1 (en) 2020-10-28 2022-05-05 Ikena Oncology, Inc. Combination of an ahr inhibitor with a pdx inhibitor or doxorubicine
WO2022096470A1 (en) * 2020-11-03 2022-05-12 Randox Laboratories Ltd Immune checkpoint inhibitor
EP3992208A1 (en) * 2020-11-03 2022-05-04 Randox Laboratories Ltd Anti-pd-l1 vhh antibodies
WO2022097060A1 (en) 2020-11-06 2022-05-12 Novartis Ag Cd19 binding molecules and uses thereof
US11981736B2 (en) 2020-11-13 2024-05-14 St Cube Inc. Antibodies specific to glycosylated PD-1 and methods of use thereof
WO2022101484A1 (en) 2020-11-16 2022-05-19 INSERM (Institut National de la Santé et de la Recherche Médicale) Methods and compositions for predicting and treating uveal melanoma
WO2022101481A1 (en) 2020-11-16 2022-05-19 INSERM (Institut National de la Santé et de la Recherche Médicale) Methods and compositions for predicting and treating uveal melanoma
WO2022120353A1 (en) 2020-12-02 2022-06-09 Ikena Oncology, Inc. Tead inhibitors and uses thereof
WO2022120354A1 (en) 2020-12-02 2022-06-09 Ikena Oncology, Inc. Tead inhibitors and uses thereof
WO2022120179A1 (en) 2020-12-03 2022-06-09 Bristol-Myers Squibb Company Multi-tumor gene signatures and uses thereof
US11746103B2 (en) 2020-12-10 2023-09-05 Sumitomo Pharma Oncology, Inc. ALK-5 inhibitors and uses thereof
WO2022133083A1 (en) 2020-12-16 2022-06-23 Gossamer Bio Services, Inc. Compounds useful as t cell activators
WO2022146947A1 (en) 2020-12-28 2022-07-07 Bristol-Myers Squibb Company Antibody compositions and methods of use thereof
WO2022146948A1 (en) 2020-12-28 2022-07-07 Bristol-Myers Squibb Company Subcutaneous administration of pd1/pd-l1 antibodies
WO2022148736A1 (en) 2021-01-05 2022-07-14 Transgene Vectorization of muc1 t cell engager
US11981705B2 (en) 2021-01-08 2024-05-14 The Brigham And Women's Hospital, Inc. Methods and compositions for delivery of immunotherapy agents across the blood-brain barrier to treat brain cancer
WO2022148979A1 (en) 2021-01-11 2022-07-14 Bicycletx Limited Methods for treating cancer
WO2022162569A1 (en) 2021-01-29 2022-08-04 Novartis Ag Dosage regimes for anti-cd73 and anti-entpd2 antibodies and uses thereof
WO2022167445A1 (en) 2021-02-02 2022-08-11 Liminal Biosciences Limited Gpr84 antagonists and uses thereof
WO2022167457A1 (en) 2021-02-02 2022-08-11 Liminal Biosciences Limited Gpr84 antagonists and uses thereof
WO2022171121A1 (en) 2021-02-10 2022-08-18 同润生物医药(上海)有限公司 Method and combination for treating tumors
WO2022171745A1 (en) 2021-02-12 2022-08-18 F. Hoffmann-La Roche Ag Bicyclic tetrahydroazepine derivatives for the treatment of cancer
US11773103B2 (en) 2021-02-15 2023-10-03 Kymera Therapeutics, Inc. IRAK4 degraders and uses thereof
WO2022185160A1 (en) 2021-03-02 2022-09-09 Glaxosmithkline Intellectual Property Development Limited Substituted pyridines as dnmt1 inhibitors
US11926625B2 (en) 2021-03-05 2024-03-12 Nimbus Saturn, Inc. HPK1 antagonists and uses thereof
WO2022184937A1 (en) 2021-03-05 2022-09-09 Leadartis, S.L. Trimeric polypeptides and uses thereof in the treatment of cancer
WO2022192145A1 (en) 2021-03-08 2022-09-15 Blueprint Medicines Corporation Map4k1 inhibitors
WO2022197641A1 (en) 2021-03-15 2022-09-22 Rapt Therapeutics, Inc. 1h-pyrazolo[3,4-d]pyrimidin-6-yl-amine derivatives as hematopoietic progenitor kinase 1 (hpk1) modulators and/or inhibitors for the treatment of cancer and other diseases
WO2022194908A1 (en) 2021-03-17 2022-09-22 INSERM (Institut National de la Santé et de la Recherche Médicale) Methods and compositions for treating melanoma
WO2022195551A1 (en) 2021-03-18 2022-09-22 Novartis Ag Biomarkers for cancer and methods of use thereof
WO2022212400A1 (en) 2021-03-29 2022-10-06 Juno Therapeutics, Inc. Methods for dosing and treatment with a combination of a checkpoint inhibitor therapy and a car t cell therapy
WO2022208353A1 (en) 2021-03-31 2022-10-06 Glaxosmithkline Intellectual Property Development Limited Antigen binding proteins and combinations thereof
WO2022212876A1 (en) 2021-04-02 2022-10-06 The Regents Of The University Of California Antibodies against cleaved cdcp1 and uses thereof
WO2022216573A1 (en) 2021-04-05 2022-10-13 Bristol-Myers Squibb Company Pyridinyl substituted oxoisoindoline compounds for the treatment of cancer
WO2022216644A1 (en) 2021-04-06 2022-10-13 Bristol-Myers Squibb Company Pyridinyl substituted oxoisoindoline compounds
WO2022215011A1 (en) 2021-04-07 2022-10-13 Novartis Ag USES OF ANTI-TGFβ ANTIBODIES AND OTHER THERAPEUTIC AGENTS FOR THE TREATMENT OF PROLIFERATIVE DISEASES
WO2022216993A2 (en) 2021-04-08 2022-10-13 Marengo Therapeutics, Inc. Multifuntional molecules binding to tcr and uses thereof
WO2022214652A1 (en) 2021-04-09 2022-10-13 Ose Immunotherapeutics Scaffold for bifunctioanl molecules comprising pd-1 or cd28 and sirp binding domains
WO2022214653A1 (en) 2021-04-09 2022-10-13 Ose Immunotherapeutics New scaffold for bifunctional molecules with improved properties
WO2022221227A1 (en) 2021-04-13 2022-10-20 Nuvalent, Inc. Amino-substituted heterocycles for treating cancers with egfr mutations
WO2022219080A1 (en) 2021-04-14 2022-10-20 INSERM (Institut National de la Santé et de la Recherche Médicale) New method to improve nk cells cytotoxicity
WO2022221866A1 (en) 2021-04-16 2022-10-20 Ikena Oncology, Inc. Mek inhibitors and uses thereof
WO2022223791A1 (en) 2021-04-23 2022-10-27 INSERM (Institut National de la Santé et de la Recherche Médicale) Methods and compositions for treating cell senescence accumulation related disease
WO2022236134A1 (en) 2021-05-07 2022-11-10 Surface Oncology, Inc. Anti-il-27 antibodies and uses thereof
WO2022243846A1 (en) 2021-05-18 2022-11-24 Novartis Ag Combination therapies
WO2022243378A1 (en) 2021-05-18 2022-11-24 Kymab Limited Uses of anti-icos antibodies
WO2022246177A1 (en) 2021-05-21 2022-11-24 Arcus Biosciences, Inc. Axl compounds
WO2022246179A1 (en) 2021-05-21 2022-11-24 Arcus Biosciences, Inc. Axl inhibitor compounds
US11572412B2 (en) 2021-06-04 2023-02-07 Boehringer Ingelheim International Gmbh Anti-SIRP-alpha antibodies
WO2022254227A1 (en) 2021-06-04 2022-12-08 Kymab Limited Treatment of pd-l1 negative or low expressing cancer with anti-icos antibodies
WO2023288254A1 (en) 2021-07-14 2023-01-19 Blueprint Medicines Corporation Heterocyclic compounds as map4k1 inhibitors
WO2023288264A1 (en) 2021-07-15 2023-01-19 Blueprint Medicines Corporation Map4k1 inhibitors
WO2023007472A1 (en) 2021-07-30 2023-02-02 ONA Therapeutics S.L. Anti-cd36 antibodies and their use to treat cancer
WO2023028238A1 (en) 2021-08-25 2023-03-02 PIC Therapeutics, Inc. Eif4e inhibitors and uses thereof
WO2023028235A1 (en) 2021-08-25 2023-03-02 PIC Therapeutics, Inc. Eif4e inhibitors and uses thereof
WO2023039089A1 (en) 2021-09-08 2023-03-16 Twentyeight-Seven, Inc. Papd5 and/or papd7 inhibiting 4-oxo-1,4-dihydroquinoline-3-carboxylic acid derivatives
WO2023077090A1 (en) 2021-10-29 2023-05-04 Bristol-Myers Squibb Company Lag-3 antagonist therapy for hematological cancer
WO2023079430A1 (en) 2021-11-02 2023-05-11 Pfizer Inc. Methods of treating mitochondrial myopathies using anti-gdf15 antibodies
WO2023078900A1 (en) 2021-11-03 2023-05-11 INSERM (Institut National de la Santé et de la Recherche Médicale) Methods and compositions for treating triple negative breast cancer (tnbc)
WO2023111203A1 (en) 2021-12-16 2023-06-22 Onxeo New conjugated nucleic acid molecules and their uses
WO2023114984A1 (en) 2021-12-17 2023-06-22 Ikena Oncology, Inc. Tead inhibitors and uses thereof
WO2023118165A1 (en) 2021-12-21 2023-06-29 INSERM (Institut National de la Santé et de la Recherche Médicale) Methods and compositions for treating melanoma
WO2023122772A1 (en) 2021-12-22 2023-06-29 Gossamer Bio Services, Inc. Oxime derivatives useful as t cell activators
WO2023122777A1 (en) 2021-12-22 2023-06-29 Gossamer Bio Services, Inc. Oxime derivatives useful as t cell activators
WO2023122778A1 (en) 2021-12-22 2023-06-29 Gossamer Bio Services, Inc. Pyridazinone derivatives useful as t cell activators
WO2023147371A1 (en) 2022-01-26 2023-08-03 Bristol-Myers Squibb Company Combination therapy for hepatocellular carcinoma
WO2023150186A1 (en) 2022-02-01 2023-08-10 Arvinas Operations, Inc. Dgk targeting compounds and uses thereof
WO2023154799A1 (en) 2022-02-14 2023-08-17 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Combination immunotherapy for treating cancer
WO2023154905A1 (en) 2022-02-14 2023-08-17 Gilead Sciences, Inc. Antiviral pyrazolopyridinone compounds
WO2023164638A1 (en) 2022-02-25 2023-08-31 Bristol-Myers Squibb Company Combination therapy for colorectal carcinoma
WO2023166418A2 (en) 2022-03-03 2023-09-07 Pfizer Inc. Multispecific antibodies and uses thereof
WO2023166420A1 (en) 2022-03-03 2023-09-07 Pfizer Inc. Multispecific antibodies and uses thereof
WO2023168404A1 (en) 2022-03-04 2023-09-07 Bristol-Myers Squibb Company Methods of treating a tumor
WO2023170606A1 (en) 2022-03-08 2023-09-14 Alentis Therapeutics Ag Use of anti-claudin-1 antibodies to increase t cell availability
WO2023173057A1 (en) 2022-03-10 2023-09-14 Ikena Oncology, Inc. Mek inhibitors and uses thereof
WO2023173053A1 (en) 2022-03-10 2023-09-14 Ikena Oncology, Inc. Mek inhibitors and uses thereof
WO2023174210A1 (en) 2022-03-14 2023-09-21 Laekna Limited Combination treatment for cancer
WO2023178192A1 (en) 2022-03-15 2023-09-21 Compugen Ltd. Il-18bp antagonist antibodies and their use in monotherapy and combination therapy in the treatment of cancer
WO2023178329A1 (en) 2022-03-18 2023-09-21 Bristol-Myers Squibb Company Methods of isolating polypeptides
WO2023192478A1 (en) 2022-04-01 2023-10-05 Bristol-Myers Squibb Company Combination therapy with anti-il-8 antibodies and anti-pd-1 antibodies for treating cancer
WO2023196987A1 (en) 2022-04-07 2023-10-12 Bristol-Myers Squibb Company Methods of treating tumor
WO2023196964A1 (en) 2022-04-08 2023-10-12 Bristol-Myers Squibb Company Machine learning identification, classification, and quantification of tertiary lymphoid structures
WO2023211889A1 (en) 2022-04-25 2023-11-02 Ikena Oncology, Inc. Polymorphic compounds and uses thereof
WO2023213763A1 (en) * 2022-05-02 2023-11-09 Transgene Poxvirus encoding a binding agent comprising an anti- pd-l1 sdab
WO2023213764A1 (en) * 2022-05-02 2023-11-09 Transgene Fusion polypeptide comprising an anti-pd-l1 sdab and a member of the tnfsf
WO2023214325A1 (en) 2022-05-05 2023-11-09 Novartis Ag Pyrazolopyrimidine derivatives and uses thereof as tet2 inhibitors
WO2023222854A1 (en) 2022-05-18 2023-11-23 Kymab Limited Uses of anti-icos antibodies
WO2023228095A1 (en) 2022-05-24 2023-11-30 Daiichi Sankyo Company, Limited Dosage regimen of an anti-cdh6 antibody-drug conjugate
WO2023230205A1 (en) 2022-05-25 2023-11-30 Ikena Oncology, Inc. Mek inhibitors and uses thereof
WO2023235847A1 (en) 2022-06-02 2023-12-07 Bristol-Myers Squibb Company Antibody compositions and methods of use thereof
WO2024023740A1 (en) 2022-07-27 2024-02-01 Astrazeneca Ab Combinations of recombinant virus expressing interleukin-12 with pd-1/pd-l1 inhibitors
WO2024023750A1 (en) 2022-07-28 2024-02-01 Astrazeneca Uk Limited Combination of antibody-drug conjugate and bispecific checkpoint inhibitor
WO2024028364A1 (en) 2022-08-02 2024-02-08 Liminal Biosciences Limited Aryl-triazolyl and related gpr84 antagonists and uses thereof
WO2024028363A1 (en) 2022-08-02 2024-02-08 Liminal Biosciences Limited Heteroaryl carboxamide and related gpr84 antagonists and uses thereof
WO2024028365A1 (en) 2022-08-02 2024-02-08 Liminal Biosciences Limited Substituted pyridone gpr84 antagonists and uses thereof
WO2024036100A1 (en) 2022-08-08 2024-02-15 Bristol-Myers Squibb Company Substituted tetrazolyl compounds useful as t cell activators
WO2024036101A1 (en) 2022-08-09 2024-02-15 Bristol-Myers Squibb Company Tertiary amine substituted bicyclic compounds useful as t cell activators
WO2024033399A1 (en) 2022-08-10 2024-02-15 Institut National de la Santé et de la Recherche Médicale Sigmar1 ligand for the treatment of pancreatic cancer
WO2024033400A1 (en) 2022-08-10 2024-02-15 Institut National de la Santé et de la Recherche Médicale Sk2 inhibitor for the treatment of pancreatic cancer
WO2024033388A1 (en) 2022-08-11 2024-02-15 F. Hoffmann-La Roche Ag Bicyclic tetrahydrothiazepine derivatives
WO2024033457A1 (en) 2022-08-11 2024-02-15 F. Hoffmann-La Roche Ag Bicyclic tetrahydrothiazepine derivatives
WO2024033458A1 (en) 2022-08-11 2024-02-15 F. Hoffmann-La Roche Ag Bicyclic tetrahydroazepine derivatives
WO2024054992A1 (en) 2022-09-09 2024-03-14 Bristol-Myers Squibb Company Methods of separating chelator
WO2024056716A1 (en) 2022-09-14 2024-03-21 Institut National de la Santé et de la Recherche Médicale Methods and pharmaceutical compositions for the treatment of dilated cardiomyopathy
WO2024069009A1 (en) 2022-09-30 2024-04-04 Alentis Therapeutics Ag Treatment of drug-resistant hepatocellular carcinoma
WO2024084034A1 (en) 2022-10-21 2024-04-25 Institut National de la Santé et de la Recherche Médicale Methods and pharmaceutical compositions for the treatment of osteoarthritis

Also Published As

Publication number Publication date
EA036814B9 (en) 2021-12-27
CA2856895A1 (en) 2013-06-06
AU2012344260A1 (en) 2014-07-17
JP6138813B2 (en) 2017-05-31
US11884724B2 (en) 2024-01-30
AU2017268603A1 (en) 2017-12-21
US20170253653A1 (en) 2017-09-07
CN103987405B (en) 2017-03-29
KR20140104982A (en) 2014-08-29
ES2808152T3 (en) 2021-02-25
SG11201402603WA (en) 2014-06-27
RS61033B1 (en) 2020-12-31
KR20170090523A (en) 2017-08-07
NO2021003I1 (en) 2021-01-19
MX349096B (en) 2017-07-11
BR112014012819B1 (en) 2022-08-16
HUS2000056I1 (en) 2021-03-01
EP2785375B1 (en) 2020-07-22
FR20C1068I2 (en) 2021-11-19
HK1200736A1 (en) 2015-08-14
US9624298B2 (en) 2017-04-18
AU2017268603B2 (en) 2019-06-06
NL301081I1 (en) 2020-12-23
PT2785375T (en) 2020-10-29
IL232778A0 (en) 2014-07-31
EA201400625A1 (en) 2014-11-28
BR112014012819A2 (en) 2020-10-20
CN103987405A (en) 2014-08-13
KR101764096B1 (en) 2017-08-02
SI2785375T1 (en) 2020-11-30
IL232778B (en) 2020-09-30
JP2015500207A (en) 2015-01-05
EP3763741A1 (en) 2021-01-13
US20170253654A1 (en) 2017-09-07
CY1123435T1 (en) 2021-05-05
HUE051954T2 (en) 2021-03-29
US10759856B2 (en) 2020-09-01
AR089010A1 (en) 2014-07-23
AU2012344260B2 (en) 2017-09-07
CA2856895C (en) 2021-10-26
EP2785375A1 (en) 2014-10-08
US20140341917A1 (en) 2014-11-20
EA036814B1 (en) 2020-12-23
JP2017158553A (en) 2017-09-14
LTPA2021001I1 (en) 2021-01-25
HRP20201595T1 (en) 2020-12-11
FR20C1068I1 (en) 2021-03-05
ZA201404790B (en) 2021-05-26
MX2014006316A (en) 2014-09-04
LTC2785375I2 (en) 2023-04-25
DK2785375T3 (en) 2020-10-12
LT2785375T (en) 2020-11-10
US20210054073A1 (en) 2021-02-25
KR101981873B1 (en) 2019-05-23
NL301081I2 (en) 2021-02-04
IL276573A (en) 2020-09-30
US10487147B2 (en) 2019-11-26

Similar Documents

Publication Publication Date Title
US11884724B2 (en) Anti-PD-L1 antibodies and uses thereof
US20180171025A1 (en) Methods of treating cancer using pd-1 axis binding antagonists and an anti-cd20 antibody
AU2021202413A1 (en) Methods of treating cancer using PD-1 axis binding antagonists and TIGIT inhibitors
CA3000386A1 (en) Combination of a pd-1 axis binding antagonist and an alk inhibitor for treating alk-negative cancer
WO2019185035A1 (en) Anti-pd-l1 antibodies and use thereof
NZ755387B2 (en) Methods of treating cancer using pd-1 axis binding antagonists and tigit inhibitors

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 12790432

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 2012790432

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 232778

Country of ref document: IL

ENP Entry into the national phase

Ref document number: 2856895

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: MX/A/2014/006316

Country of ref document: MX

ENP Entry into the national phase

Ref document number: 2014542728

Country of ref document: JP

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 14360775

Country of ref document: US

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 20147017974

Country of ref document: KR

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 201400625

Country of ref document: EA

ENP Entry into the national phase

Ref document number: 2012344260

Country of ref document: AU

Date of ref document: 20121121

Kind code of ref document: A

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112014012819

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 112014012819

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20140528