WO2013072917A2 - Antiviral composition - Google Patents
Antiviral composition Download PDFInfo
- Publication number
- WO2013072917A2 WO2013072917A2 PCT/IN2012/000153 IN2012000153W WO2013072917A2 WO 2013072917 A2 WO2013072917 A2 WO 2013072917A2 IN 2012000153 W IN2012000153 W IN 2012000153W WO 2013072917 A2 WO2013072917 A2 WO 2013072917A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- protein
- hiv
- virus
- proteins
- mpt63
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/164—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/195—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
- C07K14/35—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Mycobacteriaceae (F)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/14—Antivirals for RNA viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/14—Antivirals for RNA viruses
- A61P31/16—Antivirals for RNA viruses for influenza or rhinoviruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/14—Antivirals for RNA viruses
- A61P31/18—Antivirals for RNA viruses for HIV
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/20—Antivirals for DNA viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/20—Antivirals for DNA viruses
- A61P31/22—Antivirals for DNA viruses for herpes viruses
Definitions
- the present invention relates to biotherapeutics.
- the invention particularly provides pharmaceutical compositions containing an anti-viral agent useful for combating viral infections as an active therapeutic component and methods of application.
- composition containing broad spectrum anti-HIV/AIDS agent a protein of microbial origin.
- the protein is secreted by or surface associated in microorganisms including but not limiting to bacteria, both pathogenic and non-pathogenic.
- proteins used are isolated from bacteria Mycobacterium spp. specifically from Mycobacterium tuberculosis or M. bovis BCG.
- the protein also can be substituted by various truncated derivatives thereof, peptides derived from such proteins, synthetically prepared peptides, and proteins or peptides modified by PEGylation, acetylation, and phosphorylation.
- the protein represents purified proteins and peptides.
- the anti-HIV/AIDS agent of the present invention possesses enhanced efficacy and reduced toxicity. Further, the purified proteins and peptides employed as anti-HIV/AIDS agents, may have extended half-life and reduced immunogenecity in the patient blood stream.
- the present invention also discloses the nature of the anti-HIV compound, pharmaceutical compositions and the manner of its applications as therapeutic agent to treat HIV/ AIDS.
- the pharmaceutical composition comprises an active ingredient i.e. proteins, peptides, including PEGylated, acetylated, phosphorylated form thereof in isolation or in combination and physiologically and pharmaceutically accepted adjuvants or excipients.
- the proteins or peptides may be used in combination with other known anti-HIV/AIDS drugs.
- the proteins/peptides may have additional activity against other viruses such as polio, ebola, hepatitis B or C, dengue, influenza virus H1N1, herpes simplex, etc. BACKGROUND OF THE INVENTION:
- HIV Human Immunodeficiency Virus
- AIDS Acquired Immunodeficiency Syndrome
- HIV-1 HIV-1
- HIV-2 HIV-2
- Both types of HIV damage a person's body by destroying specific blood cells, called CD4+ T cells, which are crucial to helping the body's disease fighting ability.
- UNAIDS 33.3 million people were living with HIV in 2009 (UNAIDS global report, 2010).
- This discovery in the early 1980s triggered major international scientific efforts in antiviral drug discovery and development. As a consequence, many drugs are now available to manage this condition, allowing the use of drug combination therapy known as HAART (highly active antiretro viral therapy).
- HAART drug combination therapy
- nucleoside/nucleotide analog reverse transcriptase inhibitors NRTIs
- NRTIs non-nucleoside analog reverse transcriptase inhibitors
- protease inhibitors Pis
- integrase inhibitors lis
- fusion inhibitors a treatment paradigm using 3 or more antiretroviral drugs in combination.
- HAART highly active antiretroviral therapy
- Antiviral treatment options have primarily included combinations of two nucleoside analogue reverse transcriptase inhibitors (NRTI), and one protease inhibitor (PI).
- NRTIs with a non-nucleoside analogue reverse transcriptase inhibitor (NNRTI). Recently ⁇ NRTIs were combined with an integrase inhibitor for effective viral suppression arid tolerability.
- NRTI non-nucleoside analogue reverse transcriptase inhibitor
- HIV-1 Env is a trimeric structure consisting of three identical gpl60 molecules, each with a surface gpl20 non-covalently linked to a membrane-spanning gp41 molecule, and, indeed, recombinant gpl60 and gpl20 vaccine candidates were rapidly produced and tested in phase 1 clinical trials.
- these studies showed that the vaccine-induced antibodies failed their first in vitro test because they were unable to neutralize primary viruses derived from the blood of infected individuals (Mascola et al., 1996).
- the results of a phase 3 trial of a gpl20 vaccine showed the lack of efficacy of this type of antibody-based vaccine strategy.
- anti- retroviral drugs so far have been based on targeting the virus attachment to CD4, its binding to cellular coreceptors CCR5 and CXCR4 and viral and host cell membrane fusion.
- maraviroc a recently approved CCR5 antagonist blocking gpl20 co-receptor engagement (Fatkenheuer et al., 2005), enfuvirtide is the other only entry inhibitor approved for clinical use (Matthews et al., 2004).
- Enfuvirtide (also known as T-20) is a peptide drug selected from chemically synthesized peptides derived from various regions of gp41 (Wild et al., 1994).
- Enfuvirtide (T20) consists of a 36-amino acid synthetic peptide that is delivered as a subcutaneous injection. While shown highly effective in clinical trials, some patients develop painful and persistent injection-site reactions. Enfuvirtide works by competitively inhibiting interactions between the heptad repeat (HR) 1 and HR-2 domains of gp41, thus preventing the reconfiguration that allows the virus and cell surfaces to meet and fusion to occur (Kilby et al., 1998 and Rice and Wilantewicz, 2006).
- HR heptad repeat
- T- 1249 The same consortium that led enfuvirtide to clinical approval (Trimeris, Inc. and Roche) developed a second generation fusion inhibitor, T- 1249. It is a 39-mer peptide which was designed taking into account the gp41 CHR sequences from HIV-1, HTV-2 and SIV (Simian Immunodeficiency Virus) (Eron et al., 2004). A successful short-term evaluation of antiretro viral activity and safety in humans proved the potential of this new drug (Eron et al., 2004), although further clinical development was put on hold (Martin-Carbonero, 2004).
- azurin has been shown to have not only anticancer activity, but activity against viruses such as HIV/AIDS virus HIV-1 or the malarial parasite Plasmodium falciparum or toxoplasmosis-causing parasite Toxoplasma gondii (Chakrabarty 2010 & Fialho and Chakrabarty, 2010).
- Another protein, the ADI from Mycoplasma arginini has been shown not only to have anticancer activity (Feun et al., 2010) but anti-viral activity against HIV-1 or hepatitis c virus (Kubo et al., 2006 and Izzo et al., 2007).
- azurin demonstrates strong growth inhibiting effect against three clades, European, Indian and African origin of HIV-1 virus (Chaudhari et al., 2006). Such strong growth inhibition (90% or greater) has been shown to be due to azurin' s ability to interfere in the entry of HIV-1 to the host cells (Chaudhari et al., 2006).
- An azurin-like protein called Laz is also produced by members of gonococci/meningococci such as Neisseria meningitidis that causes meningitis. Similar to 128 amino acid P. aeruginosa azurin, Laz has a 127 amino acid moiety highly homologous to P.
- aeruginosa azurin but has an additional 39 amino acid peptide in its N- terminal called an H-8 epitope.
- Laz is also highly efficient in strongly inhibiting not only the growth of cancers (Hong et al., 2006) and parasites (Chaudhari et al., 2006; Naguleswaran et al., 2008), but also the growth of HIV-1 virus (Chaudhari et al., 2006).
- the ability of azurin or Laz to strongly bind host proteins such as CD4, ICAM-3 or DC-SIGN, as well as the viral protein gpl20 explains the growth suppressing ability of both azurin and Laz towards HIV-1.
- azurin not only strongly binds gpl20 but also host proteins CD4, ICAM-3 or DC-SIGN that are important for HIV-1 transport and entry to the T cells. Blocking host functions will likely prevent HIV-1 to mutate to become drug resistant, since the virus cannot mutate to change the host proteins. It appears that P. aeruginosa designed its weapon azurin very cleverly not only to block the host apparatus for viral entry such as CD4 or ICAM-3, but also DC-SIGN to block the transport of HIV-1 from the mucosal surface to the T cells, thereby preventing infection.
- MPT63 is a 159 amino acid (aa) small (16 kDa) protein which is secreted after 2-3 weeks of culturing. It consists of a 130 aa mature protein preceded by 29 aa signal peptide. This protein has been shown to have immunogenic property and has been implicated in virulence. It is specific to Mycobacteria as homologues of MPT63 have only been found in Mycobacterial species like M. smegmatis, M. bovis BCG and M. avium. A pseudogene of MPT63 has been found within the M. lapre genome, but is thought not to be translated into protein. The X-ray crystal structure of MPT63 was determined to 1.5-Angstrom resolution with the hope of yielding functional information about MPT63.
- MPT63 The structure of MPT63 is a ⁇ - sandwich consisting of two antiparallel ⁇ -sheets similar to an immunoglobulin like fold, with an additional small, antiparallel ⁇ -sheet (Goulding et al., 2002).
- the function of MPT63 has hitherto been unknown and could not be predicted by its structural features as it has an extremely common immunoglobulin like fold that occurs in about 24% of the structures in the Protein Data Bank.
- the ⁇ - sandwich fold that MPT63 resembles is at the core of many proteins with diverse functions (Goulding et al, 2002).
- a 30 amino acid peptide, termed MB30 and derived from MPT63 protein, also possesses strong anticancer activity against a range of human cancers (Suri et al., 2010).
- the main object is to provide an antiviral compositions eliminating the limitations of prior art. Particularly it provides anti-HIV/AIDS agent pharmaceutical compositions and methods of application thereof.
- the other object is to provide an anti-HIV/AIDS agent, particularly broad spectrum anti-HIV/AIDS agent of microbial origin, more particularly proteins either secreted by or surface associated in microorganisms including but not limiting to bacteria, both pathogenic and non-pathogenic.
- Yet another object is to provide purified proteins isolated from bacteria, specifically proteins isolated from Mycobacterium tuberculosis or M. bovis BCG useful as an anti-HIV/AIDS agent.
- Still other object is to provide peptides derived from such proteins, synthetically prepared peptides, and proteins or peptides modified by PEGylation, acetylation, phosphorylation, etc. useful as an anti-HIV/AIDS agent.
- Still another object is to also provide anti-HIV/AIDS agent comprising the proteins or various truncated derivatives thereof that possess enhanced efficacy and reduced toxicity.
- Yet other object is to provide purified proteins and peptides, as an anti- HIV/AIDS agent, with extended half life and reduced immunogenecity in the patient blood stream.
- proteins and peptides may also be useful against other viruses such as dengue, polio, H1N1, hepatitis B and C, herpes, etc.
- the other object of the present invention also discloses the nature of the anti-HIV compound, pharmaceutical compositions and the manner of its applications as therapeutic agent to treat HIV/AIDS.
- the pharmaceutical composition comprises an active ingredient i.e. proteins, peptides, including PEGylated, acetylated, phosphorylated form thereof in isolation or in combination and physiologically and pharmaceutically accepted adjuvants or excipients.
- the present invention provides an antiviral composition
- an antiviral composition comprising protein of amino acid sequence of SEQ ID NO: 1 or variant/truncated derivatives thereof and optionally suitable carriers and/or excipients.
- the protein may be purified protein isolated from micro-organisms or synthetically prepared.
- the protein may be secreted or surface associated and isolated from Mycobacterium spp.
- the protein may preferably be obtained from Mycobacterium tuberculosis or M. bovis BCG.
- the protein or variant thereof may further be modified by PEGylation, acetylation, phosphorylation wherein the variant may be peptides.
- the peptides used may be having amino acids sequence of SEQ ID No. 2.
- the present invention also provides a pharmaceutical composition
- a pharmaceutical composition comprising protein of amino acid sequence of SEQ ID NO. 1 or variant/truncated derivatives thereof having amino acid sequence of SEQ ID No. 2 as an active therapeutic component and pharmaceutically acceptable carriers and/or excipients in the range of 0.0 to 95 % by wt.
- the pharmaceutically acceptable carriers and/or excipients may be conventional one that facilitate the preparation of desired formulation and delivery of the active component by specified route.
- the carriers and/or excipients used includes solvents, dispersion media, coatings antibacterial and antifungal agent isotonic and absorption delaying agents that are compatible with pharmaceutical administration and achieve required pharmacokinetics and pharmacodynamics of the active component. It may be noted that these carriers and/or excipients have to work interdependently or in synergy with the active component to deliver desired therapeutic effect.
- the pharmaceutical composition of the present invention may be useful as intravenous (iv), intramuscular, oral, subcutaneous or topical application, against HIV/AIDS, Hepatitis B and C viruses, Dengue virus, Measles virus, Swine flu virus, Polio virus, Herpes simplex virus, Japanese Encephalitis virus.
- the pharmaceutical composition as claimed in claim 7 is also useful for inhibition of virus propagation, blocking of gp-120 epitope.
- SEQ ID NO. 2 GQVWEATATVNAIRGSVTPAVSQFNARTAD (MB30)
- MPT63 protein from Mycobacterium bovis or Mycobacterium tuberculosis is given below.
- the first 29 amino acids (underlined) in the following MPT63 sequence form secretion signal peptide (leader) sequence.
- MPT63 -encoding gene from Mycobacterium tuberculosis was amplified by PCR with genomic DNA as template.
- the forward and reverse primers used were: 5' - GCCTATCCCATCACCGGAAAA - 3 ' and 5'
- E. coli SURE strain was used as a the host for expression in the following conditions: cells were incubated overnight in LB medium at 37°C with 150 ⁇ / ⁇ of ampicillin and inoculated in the morning at an initial OD 64 o of 0.1 in SB medium (3.2% tryptone, 2% yeast extract and 0.5% NaCl) with the same antibiotic concentration. When reached OD 64 o 0.6-0.7, cells were induced with 0.2mM IPTG and grown for 5-6h at 37°C, 250 rpm.
- Cells were harvested by centrifugation at 8000 rpm for 10 minutes at 4°C, washed one time in buffer I (lOmM Imidazol, 0.2M mM sodium phosphate, 0.5M NaCl, pH 7.4), re-suspended in the same buffer and stored at -80°C.
- Cell disruption was performed by sonication and protein purification was performed in a histidine affinity chromatography column, HisTrapTM HP (GE Healthcare). Briefly, disrupted cells were centrifuged for 5 min, at 17600xg, 4°C, and the supernatant was centrifuged again at the same conditions for lh.
- the clarified extract was then loaded into a 5ml HisTrap HP column equilibrated with START buffer (lOmM Imidazol, phosphate buffer: 0.2M sodium phosphate, 1M NaCl, pH 7.4) Protein elution was achieved with a continuous imidazole gradient (from 20 to 500 mM) in the same buffer.
- protein was immediately de-salted and buffer exchanged to PBS ( 137 mM NaCl, 2.7 mM KC1, 8,1 mM Na 2 HP0 4 .2H 2 0, 1,76 mM KH 2 P0 4 , pH 7.4), pH 7.4, in HiPrep 26/10 Desalting column (GE Healthcare) in an AKTA purifier system following manufacturer instructions.
- CD4 + T-cell isolation Peripheral blood mononuclear cells (PBMCs) were isolated by Ficoll-Hypaque (Amersham Biosciences, Uppsala, Sweden) gradient centrifugation of leukopacks (Stanford Blood Bank, Stanford, California) obtained by apheresis of healthy donors.
- CD4 + T cells were purified by negative selection using Microbeads (Miltenyi Biotec, Auburn, California). Cell purity was determined by staining cells with fluorescently conjugated antibodies directed against CD4, CD3, CD8, and CD14 cells. Cell populations were found to be >95% CD3 + CD4 + .
- CD4 + T-cell stimulation CD4 + T cells were activated by phytohemagglutinin (PHA) stimulation or by CD3/CD28 costimulation.
- PHA phytohemagglutinin
- CD3/CD28 costimulation cells were cultured at a density of 2 x 10 6 cells/ml with 1 ⁇ g of PHA (Sigma, St. Louis, Mo.)/ml for 24, 48, or 72 h.
- RPMI 1640 medium MediaTech, Herndon, Va.
- FBS fetal bovine serum
- IL-2 interleukin-2
- tissue culture plates were precoated with CD3 antibody. Briefly, wells were washed with lx phosphate-buffered saline (PBS) and then coated with a 50 ⁇ g/ml stock solution of CD3 antibody.
- Viral stocks HIV-1 NL4-3 stocks were prepared by transfecting 293T cells with pNL4-3. Lipofectamine 2000 (Invitrogen) was used for transfection according to the manufacturer's instructions. Essentially, lipid complexes were generated by mixing pNL4-3 and Lipofectamine 2000 in Optimem-I reduced serum medium (Invitrogen). 293T cells in Optimem-I (70 to 90% confluent) on poly-D-lysine- coated plates (Becton Dickinson) were incubated with lipid complexes for 5 h. The medium was changed to Optimem-I containing 10% heat-inactivated FBS.
- the supernatant containing viral particles was harvested, clarified of cellular debris by centrifugation at 10,000 x g for 10 min, and filtered through 0.22 ⁇ m-pore-size polyvinylidene difluoride membranes.
- Viral titers were determined by the p24 antigen enzyme-linked immunosorbent assay (ELISA) with a HIV-1 p24 ELISA kit (Innotest).
- Cells were treated with MPT63 and subsequently infected with HIV-1 NL4-3.
- Cells were cultured in RPMI 1640 supplemented with 10% heat-inactivated FBS, minimal essential medium (MEM)-vitamins, nonessential amino acids, sodium pyruvate, 200 ⁇ L-glutamine, 5.5 x 10 "5 M P-mercaptoethanol, and 50 g of gentamicin/ml.
- the cells were also supplemented with recombinant human interleukin 2 (50 U/ml; a generous gift of Hoffmann-La Roche, Nutley, N.J.). HIV-1 p24 antigen levels in cell extracts and culture supernatants were measured by an ELISA p24 antigen.
- CD4+ Lymphocytes (10 6 ) were preincubated, in duplicate, for 30 min with several concentrations of MPT63 protein as represented in figure 2 in Hanks' balanced salt solution prior to the addition of HIV-1 NL4-3.
- HIV- 1 NL4-3 was preincubated with MPT63 protein for 30 min.
- MPT63-treated virus was added to T-cells (10 6 ). After infection, the virus was removed after 1 h, and the cells were cultured for 5 days in presence of appropriate concentrations of MPT63. The negative control cells were incubated with the MPT63 diluents. Viral load was quantified using commercial p24 antigen ELISA (Innotest).
- Virus preparation The HIV-1 from clade G and C was isolated from infected patients and was kindly provided by Dr. Jose Miguel Pereira (Universidade Lisboa). Viral stocks were centrifuged at 1,000 x g for 10 min to remove cell debris and then passed through a 45 ⁇ m-pore-size filter. The infectious titer of each viral preparation was determined by 50% tissue culture infective dose assay. Briefly, PHA-stimulated PBMCs from multiple donors were pooled and infected with serially diluted virus in quadruplicate wells. Cell supematants were collected 5 days post infection, and HIV p24 antigen was quantified by p24 enzyme-linked immunosorbent assay (ELISA).
- ELISA enzyme-linked immunosorbent assay
- Infections were scored positive for replication when p24 levels were higher than 50pg/ml.
- the 50% tissue culture infective dose value represents the virus dilution at which 50% of wells scored positive for infection.
- HIV infection CD4 + T cells were activated by CD3/CD28 costimulation for 72 h prior to infection. Cells were treated with as described above, washed and incubated with virus at an MOI of 0.01 for 4 h at 37°C. After infection, cells were washed three times to remove any unbound virions and then cultured in RPMI 1640 medium supplemented with 15% FBS and 50 U of IL-2/ml.
- Viral replication was assessed by measuring the amount of soluble HIV p24 antigen in culture supematants. Aliquots (200 ⁇ ) of supernatant were removed from infected cell cultures at 3, 5, 7, and 10 days post infection. Supematants were stored at -80°C until completion of the experiment. Quantification of p24 was determined using an ELISA (Innotest) according to the manufacturer's protocol. e. Role of MPT63 in cell-to-cell fusion
- HIV Env-mediated cell fusion The effect of MPT63 on HIV-1 Env-mediated cell fusion was analyzed with the previously described standard reporter gene activation assay (Schwartz et al., 1994). Briefly, effector cells were prepared by infecting HeLa cells in suspension with the recombinant vaccinia virus vCB-32 (encoding the HIV-1 Env SF162) and vPHT7genel (encoding the bacteriophage T7 RNA polymerase gene driven by a vaccinia virus promoter).
- Target cells were prepared by infecting HEK293-CCR5 cells with two recombinant vaccinia viruses, vCB21R-LacZ (encoding lacZ linked to the T7 promoter) and vCB-3 (encoding human CD4). Following overnight incubation at 37°C to allow protein expression, effector and target cells were each washed and resuspended. Effector cells (100 ⁇ , 2 x 10 6 cells/ml) were added to duplicate wells of 96-well plates and preincubated for 15 min at room temperature with 10 ⁇ of PBS containing different concentrations of MPT63. Target cells (100 ⁇ , 2 ⁇ 10 6 cells/ml) were then mixed with these effector cells.
- vCB21R-LacZ encoding lacZ linked to the T7 promoter
- vCB-3 encoding human CD4
- Effector cells were first incubated with MPT63 for 15 min at room temperature before mixing with the target cells. The cell mixtures were incubated for 2.5 h at 37°C to allow fusion. The cells were then lysed with Nonidet P-40, and P-galactosidase (P-Gal) activity was measured at 570 nm in the presence of chlorophenol-red-P-D-galactopyranoside.
- P-Gal P-galactosidase
- Enfuvirtide (T20), a competitive inhibitor of the heptad repeat (HR) 1 and HR-2 domains of gp41 was used as positive control in all the above experiments.
- HR heptad repeat
- Figure 1 depicts SDS-PAGE and Coomassie Brilliant Blue stain of MPT63 protein overproduced in is. coli SURE cells.
- Figure 2 - depicts the comparative data of Inhibition of HIV-1 NL4-3 replication in peripheral blood lymphocytes by MPT63 protein and Enfuvirtide (T20).
- Peripheral blood lymphocytes were infected with HIV-1 NL4-3 in the presence of increasing concentrations of MPT63 protein (nM) with a multiplicity of infection of 0.01.
- Viral replication was assessed by measuring the amount of soluble HIV p24 antigen in culture supernatants at day 7. Quantification of p24 was determined using an ELISA and values represent mean values of triplicate samples. Inhibition of replication was determined as percentage of p24 concentration relative to HIV- 1 NL4-3 in the absence of MPT63.
- Figure 3 depicts inhibition of replication of HIV-1 primary isolates clade G and C in CD4+ lymphocytes by MPT63 protein.
- Peripheral blood lymphocytes were infected with HIV-1 primary isolates from subtype G and C in the presence of increasing concentrations of MPT63 protein (nM) with a multiplicity of infection of 0.01.
- Viral replication was assessed by measuring the amount of soluble HTV p24 antigen in culture supernatants at day 7. Quantification of p24 was determined using an ELISA and values represent mean values of triplicate samples.
- Enfuvirtide (T20), a competitive inhibitor of the heptad repeat (HR) 1 and HR-2 domains of gp41 was used as positive control.
- FIG. 4 depicts inhibition of cell to cell fusion by MPT63 protein. Effector HeLa cells expressing the Env glycoprotein and Tat were incubated with target HEK293 expressing CD4 and harboring LTR-P-Gal. Effector cells were added to target cells containing different concentrations of MPT63. After cell fusion the cell mixtures were disrupted in detergent and ⁇ -Gal activity was measured at 570 nm in the presence of chlorophenol-red-D-galactopyranoside.
- a method comprising administering to a patient who has HIV/AIDS a pharmaceutical composition consisting of one or more anti-HIV/AIDS compounds selected from the group consisting of MPT63 protein or various truncated derivatives of MPT63 protein, called peptides, all of which demonstrate anti-HIV/AIDS activity.
- a pharmaceutical composition consisting of one or more anti-HIV/AIDS compounds selected from the group consisting of MPT63 protein or various truncated derivatives of MPT63 protein, called peptides, all of which demonstrate anti-HIV/AIDS activity.
- the amino acid sequence of MPT63 protein is given under Materials and Methods. This compound may also be used in combination with other known anti-HIV/AIDS agents to enhance their potency.
- viruses can be selected from the group consisting of all clades of HIV/AIDS virus.
- anti-viral activity of MPT63 protein, and peptides derived from it can also be measured against other viruses such as Hepatitis B and C viruses, Dengue virus, Measles virus, Swine flu virus, Polio virus, Herpes simplex virus, Japanese Encephalitis virus and other viruses.
- invention 2 where the HIV/AIDS viruses are contacted by the bacterial protein or peptides leading to virus killing, inhibition of virus entry or fusion with host cells, inhibition of virus propagation, blocking of gp-120 epitope and other virus epitopes, blocking of host functions important in HIV/AIDS virus transport and/or entry into host T cells in HIV/AIDS patients or in other virus-infected patients.
- the method of introduction of the proteins/peptides in virus patients may involve intravenous (iv), intramuscular, oral, subcutaneous or topical application, in presence or absence of adjuvants or excipients.
- protein or peptide sequences can be variable by 10 to 40% without any loss of activity.
- the proteins or peptides in embodiment 1 wherein the structure of the protein or peptide can be modified by PEGylation, acetylation, phosphorylation, etc, to extend or optimize the half life of the protein or the peptide, or to reduce immunogenicity, in the patient bloodstream. Such modifications may also lead to extended virus targets other than HIV-1 such as polio, hepatitis B or C, dengue, H1N1, and others.
- the MPT63 protein was purified to more than 95% purity as per the protocol described in materials and methods and further used in the experiments. Treatment of HIV/AIDS virus with MPT63 protein in this investigation revealed anti-HIV/AIDS property of the protein. All the experiments ' were carried out in triplicates and repeated three times. As shown in figure 2, the replication of HIV-1 NL4-3 is competitively inhibited by MPT63 similar to Enfuvirtide (T20), with a EC50 of 10 '2 nM. The effect of MPT63 in a larger number of primary isolates of HIV/AIDSis further evaluated.
- MPT63 protein was incubated with clade C and clade G of HIV/AIDS virus at the concentrations mentioned in materials and methods section. As shown in figure 3, the replication of primary isolates of clade C and G was competitively inhibited by MPT63 at various concentrations. The clade G of HIV-1 has shown more resistance to MPT63 protein than clade C primary isolate. Both the clades of viruses were effectively inhibited, with IC50 ranging between 0.1 nM to 50 nM, thus revealing a considerable inhibition of replication of viruses by MPT63 protein depending on the HIV clade tested.
- MPT63 The effect of MPT63 on HIV-1 Env-mediated cell fusion was analyzed by reporter gene activation assay as described in materials and methods section.
- cells expressing gpl20 are targeted towards cell expressing CD4 and inhibition of this cell to cell fusion is monitored in presence of MPT63 protein.
- the figure 4 shows more inhibition of cell to cell fusion in presence of MPT63 protein as compared to the positive control Enfuvirtide (T20) indicating that viral transmission by cell contact could be highly inhibited.
- MPT63 protein effectively inhibits the replication of HIV/AIDS virus as well as cell to cell transmission.
- IZZO F. Montella M., Orlando A.P., Nasti G., Beneduce G., Castello G., Cremona F., Ensor CM., Holtzberg F.W., Bomalaski J.S., Clark M.A., Curley S.A., Orlando R., Scordino F. and Korba B.E. 2007.
- Pegylated arginine deiminase lowers hepatitis c viral titers and inhibits nitric oxide synthesis. J. Gastroenterol. Hepatol. 22: 86-91.
- Peptides corresponding to a predictive alpha-helical domain of human immunodeficiency virus type 1 gp41 are potent inhibitors of virus infection Proc. Natl. Acad. Sci. USA. 91: 9770- ⁇ 9774.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Virology (AREA)
- Chemical & Material Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Organic Chemistry (AREA)
- Pharmacology & Pharmacy (AREA)
- Veterinary Medicine (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Molecular Biology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Oncology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Communicable Diseases (AREA)
- Engineering & Computer Science (AREA)
- Gastroenterology & Hepatology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biotechnology (AREA)
- Epidemiology (AREA)
- Immunology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Biochemistry (AREA)
- Tropical Medicine & Parasitology (AREA)
- Pulmonology (AREA)
- AIDS & HIV (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Peptides Or Proteins (AREA)
Priority Applications (3)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP12850210.1A EP2691106A4 (en) | 2011-03-31 | 2012-03-05 | ANTIVIRAL COMPOSITION |
| US14/005,756 US20140011735A1 (en) | 2011-03-31 | 2012-03-05 | Antiviral composition |
| JP2014501814A JP2014512353A (ja) | 2011-03-31 | 2012-03-05 | 抗ウイルス組成物 |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| IN1126MU2011 | 2011-03-31 | ||
| IN1126/MUM/2011 | 2011-03-31 |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2013072917A2 true WO2013072917A2 (en) | 2013-05-23 |
| WO2013072917A3 WO2013072917A3 (en) | 2014-02-06 |
Family
ID=48430291
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/IN2012/000153 Ceased WO2013072917A2 (en) | 2011-03-31 | 2012-03-05 | Antiviral composition |
Country Status (4)
| Country | Link |
|---|---|
| US (1) | US20140011735A1 (OSRAM) |
| EP (1) | EP2691106A4 (OSRAM) |
| JP (1) | JP2014512353A (OSRAM) |
| WO (1) | WO2013072917A2 (OSRAM) |
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP3294311A4 (en) * | 2015-03-05 | 2018-12-19 | Amrita Therapeutics Limited | A modified peptide as an anticancer agent |
| US11821111B2 (en) | 2019-11-15 | 2023-11-21 | Fred Hutchinson Cancer Center | Barcoded influenza viruses and deep mutational scanning libraries including the same |
| US12421626B2 (en) | 2018-06-29 | 2025-09-23 | Fred Hutchinson Cancer Center | Cell-stored barcoded deep mutational scanning libraries and uses of the same |
Families Citing this family (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP3154746B1 (en) | 2014-06-16 | 2017-09-27 | Swerea IVF AB | Impact machine |
Family Cites Families (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US6087163A (en) * | 1997-02-06 | 2000-07-11 | The Public Health Research Institute Of The City Of New York, Inc. | Mycobacterium tuberculosis specific proteins and genes, mixtures of anitgens and uses thereof |
| AU762405B2 (en) * | 1998-04-29 | 2003-06-26 | Medac Gesellschaft Fur Klinische Spezialpraparate Mbh | Treatment of papilloma virus infection using a mycobacterium |
| EP2497831B1 (en) * | 2004-05-25 | 2014-07-16 | Oregon Health and Science University | TB vaccination using HCMV-based vaccine vectors |
| JP2006149234A (ja) * | 2004-11-25 | 2006-06-15 | Japan Science & Technology Agency | プライム−ブーストワクチン接種法 |
| JP5246730B2 (ja) * | 2006-12-08 | 2013-07-24 | 独立行政法人理化学研究所 | Th1細胞分化促進剤 |
| US10611818B2 (en) * | 2007-09-27 | 2020-04-07 | Agilent Technologies, Inc. | MHC multimers in tuberculosis diagnostics, vaccine and therapeutics |
| JP5873499B2 (ja) * | 2010-10-01 | 2016-03-01 | アムリタ セラピューティクス リミテッドAmrita Therapeutics Limited | 抗がん剤 |
-
2012
- 2012-03-05 EP EP12850210.1A patent/EP2691106A4/en not_active Withdrawn
- 2012-03-05 US US14/005,756 patent/US20140011735A1/en not_active Abandoned
- 2012-03-05 JP JP2014501814A patent/JP2014512353A/ja active Pending
- 2012-03-05 WO PCT/IN2012/000153 patent/WO2013072917A2/en not_active Ceased
Non-Patent Citations (1)
| Title |
|---|
| See references of EP2691106A4 * |
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP3294311A4 (en) * | 2015-03-05 | 2018-12-19 | Amrita Therapeutics Limited | A modified peptide as an anticancer agent |
| US12421626B2 (en) | 2018-06-29 | 2025-09-23 | Fred Hutchinson Cancer Center | Cell-stored barcoded deep mutational scanning libraries and uses of the same |
| US11821111B2 (en) | 2019-11-15 | 2023-11-21 | Fred Hutchinson Cancer Center | Barcoded influenza viruses and deep mutational scanning libraries including the same |
Also Published As
| Publication number | Publication date |
|---|---|
| EP2691106A4 (en) | 2014-12-24 |
| US20140011735A1 (en) | 2014-01-09 |
| EP2691106A2 (en) | 2014-02-05 |
| JP2014512353A (ja) | 2014-05-22 |
| WO2013072917A3 (en) | 2014-02-06 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| JP3587538B2 (ja) | Hiv−1 のインヒビターとしての合成ポリペプチド | |
| JP2015520179A (ja) | ワクチン | |
| CN102883740B (zh) | 用于使hiv失活并阻断hiv的双功能分子 | |
| ES2781085T3 (es) | Mutantes de griffithsina | |
| CN105209057B (zh) | 稳定的人单cd4结构域和融合蛋白 | |
| AU2014274927B2 (en) | Monomeric griffithsin tandemers | |
| WO1989002277A2 (en) | Prophylaxis and therapy of acquired immunodeficiency syndrome | |
| US20140011735A1 (en) | Antiviral composition | |
| RU2290197C2 (ru) | Фармацевтическое средство для лечения вич-инфекции, содержащая его композиция и способы его применения | |
| EP2291392B1 (en) | Bifunctional molecules for inhibiting hiv entry | |
| WO2016184962A1 (en) | Treatment of hiv-infected individuals | |
| WO2005007831A2 (en) | Compositions of protein mimetics and methods of using same against hiv-1, sars-cov and the like | |
| EP2821082A1 (en) | Method of producing an inactivated lentivirus, especially HIV, vaccine, kit and method of use | |
| WO2007137591A8 (en) | Hiv vaccine | |
| CN106397548A (zh) | 用于抑制hiv感染的多肽及其药物用途 | |
| WO2002020052A1 (fr) | Utilisation de lipopeptides pour l'immunotherapie des sujets vih+ | |
| Avram et al. | Evaluation of the therapeutic properties of mastoparan-and sifuvirtide-derivative antimicrobial peptides using chemical structure-function relationship-in vivo and in silico approaches | |
| EP2788372B1 (en) | Mutated lentiviral env proteins and their use as drugs | |
| US20030219451A1 (en) | Stable helical C peptides and uses therefor | |
| KR20010042400A (ko) | 세포상해성 t-세포 유도용 약물 | |
| CA2548483A1 (en) | Induction of antiviral neutralizing antibodies in humans and animals | |
| CN101235083B (zh) | 抗hiv-i的多肽、其编码序列及其用途 | |
| US7285621B2 (en) | Multiple branch peptide construction | |
| WO2020139116A1 (ru) | Рекомбинантный ингибитор проникновения вич | |
| Wilson et al. | Characterising antibody responses in ART-treated individuals |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 12850210 Country of ref document: EP Kind code of ref document: A2 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2012850210 Country of ref document: EP |
|
| ENP | Entry into the national phase |
Ref document number: 2014501814 Country of ref document: JP Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 14005756 Country of ref document: US |