WO2013024097A1 - Combination therapy with an anti - cd19 antibody and a nitrogen mustard - Google Patents

Combination therapy with an anti - cd19 antibody and a nitrogen mustard Download PDF

Info

Publication number
WO2013024097A1
WO2013024097A1 PCT/EP2012/065906 EP2012065906W WO2013024097A1 WO 2013024097 A1 WO2013024097 A1 WO 2013024097A1 EP 2012065906 W EP2012065906 W EP 2012065906W WO 2013024097 A1 WO2013024097 A1 WO 2013024097A1
Authority
WO
WIPO (PCT)
Prior art keywords
seq
sequence
region
antibody
bendamustine
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/EP2012/065906
Other languages
English (en)
French (fr)
Inventor
Jutta AMERSDORFER
Stefan Steidl
Mark Winderlich
Susanne KROHN
Lisa Rojkjaer
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Morphosys AG
Original Assignee
Morphosys AG
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to LTEPPCT/EP2012/065906T priority Critical patent/LT2744515T/lt
Priority to CN201280036571.XA priority patent/CN103732252B/zh
Priority to KR1020207014299A priority patent/KR20200058583A/ko
Priority to CA2841875A priority patent/CA2841875C/en
Priority to JP2014525434A priority patent/JP6184952B2/ja
Priority to KR1020147006936A priority patent/KR20140064873A/ko
Priority to ES12747923T priority patent/ES2909722T3/es
Priority to PL12747923T priority patent/PL2744515T3/pl
Priority to RS20220412A priority patent/RS63238B1/sr
Priority to US14/126,928 priority patent/US20140255427A1/en
Priority to RU2014103492A priority patent/RU2625222C2/ru
Priority to BR112013033919-5A priority patent/BR112013033919B1/pt
Priority to NZ617770A priority patent/NZ617770B2/en
Priority to HRP20220228TT priority patent/HRP20220228T1/hr
Priority to SM20220159T priority patent/SMT202200159T1/it
Priority to AU2012296907A priority patent/AU2012296907B2/en
Application filed by Morphosys AG filed Critical Morphosys AG
Priority to EP22155572.5A priority patent/EP4062936A1/en
Priority to DK12747923.6T priority patent/DK2744515T3/da
Priority to EP12747923.6A priority patent/EP2744515B1/en
Priority to MX2013014933A priority patent/MX354479B/es
Priority to SI201231989T priority patent/SI2744515T1/sl
Priority to KR1020197026462A priority patent/KR102115203B1/ko
Publication of WO2013024097A1 publication Critical patent/WO2013024097A1/en
Priority to IL230293A priority patent/IL230293B/en
Anticipated expiration legal-status Critical
Priority to US16/839,777 priority patent/US20200353077A1/en
Priority to US18/411,350 priority patent/US20240366756A1/en
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/3955Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/41Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with two or more ring hetero atoms, at least one of which being nitrogen, e.g. tetrazole
    • A61K31/41641,3-Diazoles
    • A61K31/41841,3-Diazoles condensed with carbocyclic rings, e.g. benzimidazoles
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/39558Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against tumor tissues, cells, antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • A61P35/02Antineoplastic agents specific for leukemia
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2300/00Mixtures or combinations of active ingredients, wherein at least one active ingredient is fully defined in groups A61K31/00 - A61K41/00

Definitions

  • the present disclosure is related to a pharmaceutical combination of an anti-CD19 antibody and a nitrogen mustard for the treatment of non-Hodgkin's lymphoma, chronic lymphocytic leukemia and/or acute lymphoblastic leukemia.
  • B cells are lymphocytes that play a large role in the humoral immune response. They are produced in the bone marrow of most mammals, and represent 5-15% of the circulating lymphoid pool. The principal function of B cells is to make antibodies against various antigens, and are an essential component of the adaptive immune system.
  • lymphomas and leukemias.
  • NHL non-Hodgkin's lymphoma
  • CLL chronic lymphocytic leukemia
  • ALL acute lymphoblastic leukemia
  • NHL is a heterogeneous malignancy originating from lymphocytes.
  • U.S. United States
  • the incidence is estimated at 65,000/year with mortality of approximately 20,000 (American Cancer Society, 2006; and SEER Cancer Statistics Review).
  • the disease can occur in all ages, the usual onset begins in adults over 40 years, with the incidence increasing with age.
  • NHL is characterized by a clonal proliferation of lymphocytes that accumulate in the lymph nodes, blood, bone marrow and spleen, although any major organ may be involved.
  • the current classification system used by pathologists and clinicians is the World Health Organization (WHO) Classification of Tumours, which organizes NHL into precursor and mature B-cell or T-cell neoplasms.
  • WHO World Health Organization
  • the PDQ is currently dividing NHL as indolent or aggressive for entry into clinical trials.
  • the indolent NHL group is comprised primarily of follicular subtypes, small lymphocytic lymphoma, MALT (mucosa-associated lymphoid tissue), and marginal zone; indolent encompasses approximately 50% of newly diagnosed B-cell NHL patients.
  • Aggressive NHL includes patients with histologic diagnoses of primarily diffuse large B cell (DLBL, DLBCL, or DLCL) (40% of all newly diagnosed patients have diffuse large cell), Burkitt's, and mantle cell.
  • the clinical course of NHL is highly variable. A major determinant of clinical course is the histologic subtype. Most indolent types of NHL are considered to be incurable disease.
  • rituximab anti-CD20 antibody
  • the current standard of care for most patients is rituximab + CHOP (R-CHOP) or rituximab + CVP (R-CVP).
  • Interferon is approved for initial treatment of NHL in combination with alkylating agents, but has limited use in the U.S.
  • Rituximab therapy has been shown to be efficacious in several types of NHL, and is currently approved as a first line treatment for both indolent (follicular lymphoma) and aggressive NHL (diffuse large B cell lymphoma).
  • indolent follicular lymphoma
  • aggressive NHL diffuse large B cell lymphoma
  • anti-CD20 monoclonal antibody mAb
  • primary resistance 50% response in relapsed indolent patients
  • acquired resistance 50% response rate upon re-treatment
  • rare complete response 2% complete resonse rate in relapsed population
  • a continued pattern of relapse a continued pattern of relapse.
  • B cells do not express CD20, and thus many B-cell disorders are not treatable using anti-CD20 antibody therapy.
  • Chronic lymphocytic leukemia also known as “chronic lymphoid leukemia” or “CLL”
  • CLL chronic lymphocytic leukemia
  • the malignant lymphocytes may look normal and mature, but they are not able to cope effectively with infection.
  • CLL is the most common form of leukemia in adults. Men are twice as likely to develop CLL as women.
  • the key risk factor is age. Over 75% of new cases are diagnosed in patients over age 50. More than 10,000 cases are diagnosed every year and the mortality is almost 5,000 a year (American Cancer Society, 2006; and SEER Cancer Statistics Review).
  • CLL is an incurable disease but progresses slowly in most cases. Many people with CLL lead normal and active lives for many years. Because of its slow onset, early-stage CLL is generally not treated since it is believed that early CLL intervention does not improve survival time or quality of life. Instead, the condition is monitored over time.
  • Initial CLL treatments vary depending on the exact diagnosis and the progression of the disease. There are dozens of agents used for CLL therapy. Combination chemotherapy regimens such as FCR (fludarabine, cyclophosphamide and rituximab), and BR (bendamustine and rituximab) are effective in both newly-diagnosed and relapsed CLL. Allogeneic bone marrow (stem cell) transplantation is rarely used as a first-line treatment for CLL due to its risk.
  • ALL acute lymphoblastic leukemia
  • ALL is characterised by the overproduction and continuous multiplication of malignant and immature white blood cells (also known as lymphoblasts) in the bone marrow.
  • 'Acute' refers to the undifferentiated, immature state of the circulating lymphocytes ("blasts"), and that the disease progresses rapidly with life expectancy of weeks to months if left untreated.
  • ALL is most common in childhood with a peak incidence of 4-5 years of age. Children of age 12- 16 die more easily from it than others. Currently, at least 80% of childhood ALL are considered curable. Under 4,000 cases are diagnosed every year and the mortality is almost 1 ,500 a year (American Cancer Society, 2006; and SEER Cancer Statistics Review).
  • the human CD 19 molecule is a structurally distinct cell surface receptor expressed on the surface of human B cells, including, but not limited to, pre-B cells, B cells in early development ⁇ i.e., immature B cells), mature B cells through terminal differentiation into plasma cells, and malignant B cells.
  • CD 19 is expressed by most pre-B acute lymphoblastic leukemias (ALL), non-Hodgkin's lymphomas, B cell chronic lymphocytic leukemias (CLL), pro-lymphocytic leukemias, hairy cell leukemias, common acute lymphocytic leukemias, and some Null-acute lymphoblastic leukemias (Nadler et al, J.
  • CD 19 Oncol's tumors
  • differentiated B cell tumors such as multiple myeloma, plasmacytomas, Waldenstrom's tumors (Grossbard et al., Br. J. Haematol, 102:509- 15(1998); Treon et al, Semin. Oncol,
  • the CD 19 antigen is a target for immunotherapy in the treatment of non-Hodgkin's lymphoma (including each the subtypes described herein), chronic lymphocytic leukemia and/or acute lymphoblastic leukemia.
  • T cells expressing an anti-CD19 chimeric antigen receptor (CAR) including both CDS- ⁇ and the 4-BB costimulatory domain were administered to three patients with advanced CLL.
  • CAR chimeric antigen receptor
  • Kalos et al. T cells with Chimeric Antigen Receptors Have Potent Antitumor Effects and Can Establish Memory in Patients with Advanced Leukemia, Science Translational Medicine, vol. 3, no. 95 (10 August 201 1 ), which is incorporated by reference in its entirety.
  • Sadelain et al. The promise and potential pitfalls of chimeric antigen receptors, Current Opinion in Immunology, Elsevier, vol.
  • CD19 chimeric antigen receptors CARs. Neither Kalos et al. nor Sadelain et al., however, describe the antibody specific for CD19 in combination with bendamustine as exemplified herein.
  • WO2007076950 (US2007154473), which are both incorporated by reference in their entireties, along with the cursory mention of bendamustine within a long list of potential combination partners, but fails either to teach the antibody exemplified herein or suggest the synergistic effects of the combination in the treatment of non-Hodgkin's lymphoma, chronic lymphocytic leukemia and/or acute lymphoblastic leukemia as exemplified herein.
  • CD19 antibody in CLL, NHL and ALL is described in Scheuermann et al., CD19 Antigen in Leukemia and Lymphoma Diagnosis and Immunotherapy, Leukemia and Lymphoma, Vol. 18, 385-397 (1995), which is incorporated by reference in its entirety, but fails to suggest the combination exemplified herein.
  • WO2010151341 (US 13/377,514) (The Feinstein Institute); US5686072 (University of Texas), and WO2002022212 (PCT/US01/29026) (IDEC Pharmaceuticals), which are all incorporated by reference in their entireties.
  • the present disclosure relates to a synergistic combination of an antibody specific for CD19 and a nitrogen mustard.
  • Such combinations are useful in the treatment of B cell malignancies, such as, non-Hodgkin's lymphoma, chronic lymphocytic leukemia and/or acute lymphoblastic leukemia.
  • the inventors found that the combination of a particular antibody specific for CD19 and bendamustine inhibited tumor growth and synergistically increased median survival days and median increase in lifespan, both in Burkitt's lymphoma SCID mouse models, in comparison to the antibody and bendamustine alone. These in vivo models are indicative of how the combination will work in the treatment of non-Hodgkin's lymphoma in humans.
  • the combination of the exemplified anti-CD19 antibody and bendamustine behaved synergistically in models relevant to NHL and CLL. As both NHL and CLL are B cell related disorders and CD19 is highly expressed on B-cells, the exemplified combination would have the same mechanism of action and should also behave synergistically in the treatment of other B cell related disorders, e.g. ALL.
  • the combination of the exemplified antibody specific for CD19 and bendamustine will be effective in the treatment of humans in non-Hodgkin's lymphoma, chronic lymphocytic leukemia and/or acute lymphoblastic leukemia.
  • the antibody specific to CD19 exemplified in the present specification has already entered into clinical trials, where such combinations can be confirmed in humans.
  • bendamustine and other nitrogen mustards are similar, as they are alkylating agents that form interstrand cross-links (ICLs) between DNA bases, thus blocking fundamental processes such as replication and transcription, it is believed that synergy should also be seen when treating humans having non-Hodgkin's lymphoma, chronic lymphocytic leukemia and/or acute lymphoblastic leukemia with a combination of the exemplified anti-CD19 antibody and a nitrogen mustard other than bendamustine.
  • ICLs interstrand cross-links
  • anti-CD19 antibody and other anti-CD19 antibodies bind CD19, it is believed that synergy should also be seen when treating humans having non-Hodgkin's lymphoma, chronic lymphocytic leukemia and/or acute lymphoblastic leukemia with a combination of any anti-CD19 antibody and a nitrogen mustard, e.g., bendamustine.
  • antibodies that cross-compete with the exemplified antibody or bind to the same epitope as the exemplified antibody should also behave synergistically when treating humans having non-Hodgkin's lymphoma, chronic lymphocytic leukemia and/or acute lymphoblastic leukemia when used in combination with a nitrogen mustard, e.g., bendamustine.
  • An aspect of the present disclosure comprises a synergistic combination wherein the antibody specific for CD19 comprises an HCDR1 region of sequence SYVMH (SEQ ID NO: 1 ), an HCDR2 region of sequence NPYNDG (SEQ ID NO: 2), an HCDR3 region of sequence GTYYYGTRVFDY (SEQ ID NO: 3), an LCDR1 region of sequence RSSKSLQNVNGNTYLY (SEQ ID NO: 4), an LCDR2 region of sequence RMSNLNS (SEQ ID NO: 5), and an LCDR3 region of sequence MQHLEYPIT (SEQ ID NO: 6) and bendamustine.
  • the combination is used for the treatment of non-Hodgkin's lymphoma, chronic lymphocytic leukemia and/or acute lymphoblastic leukemia.
  • Figure 1 shows the cytotoxicity effects of MOR00208 and bendamustine alone and in combination on MEC-1 cells.
  • Figure 2 shows the ADCC dose reponse curves of the combination of MOR00208 and bendamustine in MEC-1 cells.
  • Figure 3 shows the amino acid sequence of the variable domains of MOR00208.
  • Figure 4 shows the amino acid sequence of the Fc regions of MOR00208.
  • Figure 5 shows the normalized specific killing data of Table 2.
  • Figure 6 shows the results of the human Ramos Burkitt's B-cell lymphoma survival model in SCID mice as described in Example 3. The figure represents the data shown in Table 6, but excludes treatment related deaths.
  • Figure 7 shows the statistical analysis of the results of the subcutaneously (SC)-implanted human Ramos Burkitt's B-cell lymphoma tumor growth model in SCID mice, as described in Example 2.
  • Figure 8 shows the results of the subcutaneously (SC)-implanted human Ramos Burkitt's B-cell lymphoma tumor growth model in SCID mice, as described in Example 2.
  • FIG 9 shows the results of the subcutaneously (SC)-implanted human Ramos Burkitt's B-cell lymphoma tumor growth model in SCID mice, as described in Example 2.
  • the BEN dosage is 13mg/kg.
  • FIG 10 shows the results of the subcutaneously (SC)-implanted human Ramos Burkitt's B-cell lymphoma tumor growth model in SCID mice, as described in Example 2.
  • the BEN dosage is 16mg/kg.
  • “Synergy”, “synergism” or “synergistic” mean more than the expected additive effect of a combination.
  • the “synergy”, “synergism” or “synergistic” effect of a combination is determined herein by the methods of Chou et al., Clarke et al. and/or Webb et al. See Ting-Chao Chou, Theoretical Basis, Experimental Design, and Computerized Simulation of Synergism and
  • antibody means monoclonal antibodies, including any isotype, such as, IgG, IgM, IgA, IgD and IgE.
  • An IgG antibody is comprised of two identical heavy chains and two identical light chains that are joined by disulfide bonds. Each heavy and light chain contains a constant region and a variable region. Each variable region contains three segments called “complementarity-determining regions" ("CDRs") or “hypervariable regions", which are primarily responsible for binding an epitope of an antigen. They are referred to as CDR1 , CDR2, and CDR3, numbered sequentially from the N-terminus. The more highly conserved portions of the variable regions outside of the CDRs are called the "framework regions".
  • an “antibody fragment” means an Fv, scFv, dsFv, Fab, Fab' F(ab')2 fragment, or other fragment, which contains at least one variable heavy or variable light chain, each containing CDRs and framework regions.
  • a "nitrogen mustard” is a nonspecific DNA alkylating agents used as chemotherapy.
  • Alkylating agents add an alkyi group (CnH2n+1 ) to nucleic acid bases, e.g., adding an alkyi group to the guanine base of DNA at the number 7 nitrogen atom of the imidazole ring.
  • the alkylation steps result in the formation of interstrand cross-links (ICLs).
  • ICLs interstrand cross-links
  • Nitrogen mustards include cyclophosphamide, chlorambucil, uramustine, ifosfamide, melphalan and bendamustine.
  • Cyclophosphamide is marketed as Endoxan, Cytoxan, Neosar, Procytox, and Revimmune, and is also known as cytophosphane. Cyclophosphamide, or combinations including
  • cyclophosphamide is used in the treatment of lymphomas, leukemia and some solid tumors.
  • Cyclophosphamide has the following structure:
  • Chlorambucil is marketed as Leukeran by GlaxoSmithKline. It is used mainly in the treatment of chronic lymphocytic leukemia. Chlorambucil has the following structure:
  • Uramustine is used in the treatment of non-Hodgkin's lymphoma. Uramustine has the following structure:
  • Ifosfamide has the following structure:
  • Melphalan is marketed as Alkeran. Melphalan has the following structure:
  • Bendamustine is marketed under the names Ribomustin®,and Treanda®, and is also known as SDX-105, by Mundipharma International C-nmnratinn ⁇ imitc-H (Licensee of Astellas Pharma GmbH) and Cephalon for the treatment of chronic lymphocytic leukemias (CLL), indolent B-cell non-Hodgkin's lymphoma (NHL), and other lymphomas.
  • CLL chronic lymphocytic leukemias
  • NHS indolent B-cell non-Hodgkin's lymphoma
  • Bendamustine has the following structure:
  • BEN when used herein means bendamustine.
  • VH refers to the variable region of an immunoglobulin heavy chain of an antibody, or antibody fragment.
  • VL refers to the variable region of the immunoglobulin light chain of an antibody, or antibody fragment.
  • CD19 refers to the protein known as CD19, having the following synonyms: B4, B-lymphocyte antigen CD19, B-lymphocyte surface antigen B4, CVID3, Differentiation antigen CD19, MGC12802, and T-cell surface antigen Leu-12.
  • Human CD19 has the amino acid sequence of:
  • SIRGQPGPNHEEDADSYENMDNPDGPDPAWGGGGRMGTWSTR (SEQ ID NO: 7)
  • “MOR00208” is an anti-CD19 antibody.
  • the amino acid sequence of the variable domains is provided in Figure 3.
  • MOR00208 are provided in Figure 4. "MOR00208” and “XmAb 5574” are used as synonyms to describe the antibody shown in Figures 3 and 4. The MOR00208 antibody is described in US patent application serial number 12/377,251 , which is incorporated by reference in its entirety.
  • Fc region means the constant region of an antibody, which in humans may be of the lgG1 , 2, 3, 4 subclass or others. The sequences of human Fc regions are available at IMGT, Human IGH C-REGIONs, http://www.imgt.org/IMGTrepertoire/Proteins
  • RefmAb33 is an antibody whose amino acid sequence is as follows:
  • RefmAb33 is specific for RSV, and is used as isotype control, as it shares the same Fc region as MOR00208.
  • a “combination” means more than one item, e.g. a compound such as an antibody and bendamustine.
  • the present disclosure also relates to combinations, pharmaceuticals, and pharmaceutical compositions containing the described combinations.
  • the two components of the synergistic combination of the present invention e.g. the antibody specific for CD19 and bendamustine
  • the two components may be administered together, simultaneously or separately.
  • the two components may be formulated together in one pharmaceutical composition, which may include a pharmaceutical acceptable carrier or excipient.
  • the two components might also be formulated in different pharmaceutical compositions. In this case the two components can be administered simultaneously or subsequently.
  • bendamustine is administered prior to and/or separately from the administration of the antibody specific for CD19, e.g. MOR00208.
  • a pharmaceutical composition includes an active agent, eg. an antibody for therapeutic use in humans.
  • a pharmaceutical composition may include acceptable carriers or excipients.
  • administering includes but is not limited to delivery by an injectable form, such as, for example, an intravenous, intramuscular, intradermal or subcutaneous route or mucosal route, for example, as a nasal spray or aerosol for inhalation or as an ingestable solution, capsule or tablet.
  • an injectable form such as, for example, an intravenous, intramuscular, intradermal or subcutaneous route or mucosal route, for example, as a nasal spray or aerosol for inhalation or as an ingestable solution, capsule or tablet.
  • a “therapeutically effective amount” of a compound or combination refers to an amount sufficient to cure, alleviate or partially arrest the clinical manifestations of a given disease or disorder and its complications.
  • the amount that is effective for a particular therapeutic purpose will depend on the severity of the disease or injury as well as on the weight and general state of the subject. It will be understood that determination of an appropriate dosage may be achieved, using routine experimentation, by constructing a matrix of values and testing different points in the matrix, all of which is within the ordinary skills of a trained physician or clinical scientist.
  • CDRs herein are defined by either Chothia et al or Kabat et al. See Chothia C, Lesk AM. (1987) Canonical structures for the hypervariable regions of immunoglobulins. J Mol Biol., 196(4):901 -17, which is incorporated by reference in its entirety. See Kabat E.A, Wu T.T., Perry H.M., Gottesman K.S. and Foeller C. (1991 ). Sequences of Proteins of Immunological Interest. 5th edit., NIH Publication no. 91 -3242, US Dept. of Health and Human Services, Washington, DC, which is incorporated by reference in its entirety.
  • Cross competes means the ability of an antibody or other binding agent to interfere with the binding of other antibodies or binding agents to CD19 in a standard competitive binding assay. The ability or extent to which an antibody or other binding agent is able to interfere with the binding of another antibody or binding molecule to CD19, and, therefore whether it can be said to
  • cross-compete according to the invention can be determined using standard competition binding assays.
  • One suitable assay involves the use of the Biacore technology (e.g. by using the BIAcore 3000 instrument (Biacore, Uppsala, Sweden)), which can measure the extent of interactions using surface plasmon resonance technology.
  • Another assay for measuring cross-competing uses an ELISA-based approach.
  • a high throughput process for "epitope binning" antibodies based upon their cross-competition is described in International Patent Application No. WO 2003/48731
  • epitope includes any protein determinant capable of specific binding to an antibody or otherwise interacting with a molecule.
  • Epitopic determinants generally consist of chemically active surface groupings of molecules such as amino acids or carbohydrate or sugar side chains and can have specific three-dimensional structural characteristics, as well as specific charge characteristics.
  • An epitope may be "linear” or “conformational.”
  • linear epitope refers to an epitope with all of the points of interaction between the protein and the interacting molecule (such as an antibody) occur linearally along the primary amino acid sequence of the protein (continuous).
  • formational epitope refers to an epitope in which discontinuous amino acids that come together in three dimensional conformation.
  • epitope mapping techniques include Epitope Mapping Protocols in Methods in Molecular Biology, Vol. 66 (Glenn E.Morris, Ed., 1996) Humana Press, Totowa, New Jersey.
  • linear epitopes may be determined by e.g., concurrently synthesizing large numbers of peptides on solid supports, the peptides corresponding to portions of the protein molecule, and reacting the peptides with antibodies while the peptides are still attached to the supports.
  • Such techniques are known in the art and described in, e.g., U.S. Patent No. 4,708,871 ; Geysen et al, (1984) Proc. Natl. Acad. Sci. USA 8:3998-4002; Geysen et al, (1985) Proc. Natl. Acad. Sci. USA 82:78-182; Geysen et al, (1986) Mol. Immunol.
  • conformational epitopes are readily identified by determining spatial conformation of amino acids such as by, e.g., hydrogen/deuterium exchange, x-ray crystallography and two-dimensional nuclear magnetic resonance. See, e.g., Epitope Mapping Protocols, supra.
  • Antigenic regions of proteins can also be identified using standard antigenicity and hydropathy plots, such as those calculated using, e.g., the Omiga version 1.0 software program available from the Oxford Molecular Group. This computer program employs the Hopp/Woods method, Hopp et al, (1981 ) Proc. Natl. Acad. Sci USA
  • An aspect of the present disclosure comprises a combination of an antibody specific for CD19 and a nitrogen mustard for use in the treatment of non-Hodgkin's lymphoma, chronic lymphocytic leukemia and/or acute lymphoblastic leukemia.
  • the combination is synergistic.
  • the combination of the exemplified anti-CD19 antibody and bendamustine behaved synergistically in in vitro and in vivo models relevant to NHL and CLL.
  • NHL and CLL are B cell related disorders and CD19 is highly expressed on B-cells
  • the exemplified combination should have the same mechanism of action and should also behave synergistically in the treatment of other B cell related disorders, e.g. ALL. Therefore, the combination of the exemplified antibody specific for CD19 and bendamustine will be effective in the treatment of humans in non-Hodgkin's lymphoma, chronic lymphocytic leukemia and/or acute lymphoblastic leukemia.
  • bendamustine and other nitrogen mustards are similar, as they are alkylating agents that form interstrand cross-links (ICLs) between DNA bases, thus blocking fundamental processes such as replication and transcription, it is believed that synergy should also be seen when treating humans having non-Hodgkin's lymphoma, chronic lymphocytic leukemia and/or acute lymphoblastic leukemia with a combination of the exemplified anti-CD19 antibody and a nitrogen mustard other than bendamustine, e.g. cyclophosphamide, chlorambucil, uramustine, ifosfamide, and melphalan.
  • a nitrogen mustard other than bendamustine e.g. cyclophosphamide, chlorambucil, uramustine, ifosfamide, and melphalan.
  • anti-CD19 antibody and other anti-CD19 antibodies bind CD19, it is believed that synergy should also be seen when treating humans having non-Hodgkin's lymphoma, chronic lymphocytic leukemia and/or acute lymphoblastic leukemia with a combination of any anti-CD19 antibody and a nitrogen mustard, where the anti-CD19 antibody is, for example, described in US patent application serial number 12/377,251 (Xencor), WO2005012493, WO2010053716 (Immunomedics); WO2007002223 (Medarex); WO2008022152 (Xencor); WO2008031056 (Medimmune); WO 2007/076950 (Merck Patent GmbH); WO 2009/052431 (Seattle Genetics); and WO2010095031 (Glenmark Pharmaceuticals), all of which are incorporated by reference in their entireties.
  • the antibody specific for CD19 comprises an antibody that cross-competes with the antibody comprising an HCDR1 region of sequence SYVMH (SEQ ID NO: 1 ), an HCDR2 region of sequence NPYNDG (SEQ ID NO: 2), an HCDR3 region of sequence GTYYYGTRVFDY (SEQ ID NO: 3), an LCDR1 region of sequence RSSKSLQNVNGNTYLY (SEQ ID NO: 4), an LCDR2 region of sequence RMSNLNS (SEQ ID NO: 5), and an LCDR3 region of sequence MQHLEYPIT (SEQ ID NO: 6).
  • SYVMH SEQ ID NO: 1
  • an HCDR2 region of sequence NPYNDG SEQ ID NO: 2
  • an HCDR3 region of sequence GTYYYGTRVFDY SEQ ID NO: 3
  • an LCDR1 region of sequence RSSKSLQNVNGNTYLY SEQ ID NO: 4
  • an LCDR2 region of sequence RMSNLNS SEQ ID NO: 5
  • the antibody specific for CD19 comprises an antibody that binds to the same epitope as an antibody comprising an HCDR1 region of sequence SYVMH (SEQ ID NO: 1 ), an HCDR2 region of sequence NPYNDG (SEQ ID NO: 2), an HCDR3 region of sequence
  • GTYYYGTRVFDY (SEQ ID NO: 3), an LCDR1 region of sequence RSSKSLQNVNGNTYLY (SEQ ID NO: 4), an LCDR2 region of sequence RMSNLNS (SEQ ID NO: 5), and an LCDR3 region of sequence MQHLEYPIT (SEQ ID NO: 6).
  • the antibody specific for CD19 comprises an HCDR1 region of sequence SYVMH (SEQ ID NO: 1 ), an HCDR2 region of sequence NPYNDG (SEQ ID NO: 2), an HCDR3 region of sequence GTYYYGTRVFDY (SEQ ID NO: 3), an LCDR1 region of sequence
  • RSSKSLQNVNGNTYLY (SEQ ID NO: 4), an LCDR2 region of sequence RMSNLNS (SEQ ID NO: 5), and an LCDR3 region of sequence MQHLEYPIT (SEQ ID NO: 6).
  • the antibody specific for CD19 comprises a variable heavy chain of the sequence EVQLVESGGGLVKPGGSLKLSCAASGYTFTSYVMHWVRQAPGKGLEWIGYINPY NDGTKYNEKFQGRVTISSDKSISTAYMELSSLRSEDTAMYYCARGTYYYGTRVFDYWG QGTLVTVSS (SEQ ID NO: 10) and a variable light chain of the sequence
  • the antibody specific for CD19 comprises a heavy chain constant domain of the sequence
  • the antibody specific for CD19 comprises a light chain constant domain of the sequence
  • the nitrogen mustard is bendamustine.
  • the components of the combination, the antibody specific for CD19 and bendamustine are administered separately.
  • bendamustine is administered prior to administration of the antibody specific for CD19.
  • the combination is a pharmaceutical composition.
  • the composition comprises an acceptable carrier.
  • the combination is administered in an effective amount.
  • an antibody specific for CD19 comprising an HCDR1 region of sequence SYVMH (SEQ ID NO: 1 ), an HCDR2 region of sequence NPYNDG (SEQ ID NO: 2), an HCDR3 region of sequence GTYYYGTRVFDY (SEQ ID NO: 3), an LCDR1 region of sequence RSSKSLQNVNGNTYLY (SEQ ID NO: 4), an LCDR2 region of sequence RMSNLNS (SEQ ID NO: 5), and an LCDR3 region of sequence MQHLEYPIT (SEQ ID NO: 6) and bendamustine is able to mediate killing of MEC-1 cells by ADCC in the presence of isolated human PBMCs with an at least two-fold, three-fold, four-fold, or five-fold better efficacy than bendamustine alone.
  • An aspect of the present disclosure comprises a synergistic combination of an antibody specific for CD19 comprising an HCDR1 region of sequence SYVMH (SEQ ID NO: 1 ), an HCDR2 region of sequence NPYNDG (SEQ ID NO: 2), an HCDR3 region of sequence GTYYYGTRVFDY (SEQ ID NO: 3), an LCDR1 region of sequence RSSKSLQNVNGNTYLY (SEQ ID NO: 4), an LCDR2 region of sequence RMSNLNS (SEQ ID NO: 5), and an LCDR3 region of sequence MQHLEYPIT (SEQ ID NO: 6) and bendamustine for the treatment of non-Hodgkin's lymphoma, chronic lymphocytic leukemia and/or acute lymphoblastic leukemia.
  • the non-Hodgkin's lymphoma is selected from the group consisting of follicular lymphoma, small lymphocytic lymphoma, mucosa-associated lymphoid tissue, marginal zone, diffuse large B cell, Burkitt's, and mantle cell.
  • Another aspect comprises a method of treating non-Hodgkin's lymphoma, chronic lymphocytic leukemia and/or acute lymphoblastic leukemia in an individual in need thereof, which method comprises administration of an antibody specific for CD19 and a nitrogen mustard.
  • the antibody specific for CD19 comprises an HCDR1 region of sequence SYVMH (SEQ ID NO: 1 ), an HCDR2 region of sequence NPYNDG (SEQ ID NO: 2), an HCDR3 region of sequence GTYYYGTRVFDY (SEQ ID NO: 3), an LCDR1 region of sequence RSSKSLQNVNGNTYLY (SEQ ID NO: 4), an LCDR2 region of sequence RMSNLNS (SEQ ID NO: 5), and an LCDR3 region of sequence MQHLEYPIT (SEQ ID NO: 6).
  • the antibody comprises the exemplified antibody specific for CD19.
  • the nitrogen mustard is bendamustine.
  • Example 1 Inhibition of proliferation of MEC-1 cells using MOR00208 and bendamustine alone and in combination
  • MEC-1 cells chronic B-cell leukemia cell line DSMZ# ACC497;
  • Cell Medium Iscove's Modified Dulbecco's Medium (IMDM) with GlutaMAXTM, Invitrogen, Cat No.: 31980-048, 20% FCS;
  • PBMCs RPMI1640, with stabile Glutamine, PAN Biotech GmbH, Cat No.: P04-13500 supplemented with 10% FCS;
  • Biocoll Biochrome AG CAT No.: L61 15 LOT No.: 1050T; Bendamustine:
  • MOR00208 The cytotoxicity of MOR00208 and bendamustine alone and in combination was tested in MEC-1 cells.
  • BEN is an alkylating agent, therefore, functions via direct cytoxicity in MEC-1 cells.
  • MOR00208 targets CD19 and additionally functions via ADCC in killing MEC-1 cells.
  • MEC-1 cell killing was measured: BEN at 100Mg/ml; MOR00208 at 6,6pm and the combination of MOR00208 at 6,6pm and BEN at 100 g ml. These concentrations were chosen as they are near or at the EC50 for MOR00208 and BEN. The following were used as controls: RefmAb33, or PBMCs alone.
  • MEC-1 cells were pre-incubated with BEN 48 hours prior to the ADCC assay measurements.
  • the MEC-1 cells were stained using I mg/ml Calcein AM then counted and adjusted to 2X10 5 /ml.
  • the PBMCs were counted and adjusted to 6X10 6 /ml.
  • the cell killing assays were done as follows: using 96 well plates, a 10 ⁇ cell suspension of MEC-1 cells was added per well, then 10 ⁇ cell suspension of PBMCs was added to each well resulting in an E:T ratio of 30:1.
  • the antibodies were diluted to i g ml in medium. Cells were centrifuged and re-suspended.
  • the values represent % dead cells.
  • Each experiment represents PBMCs from different donors.
  • the controls used for each experiment was RefMab33.
  • Table 2 shows the raw data of Table 1 normalized for specific killing and the results of the Chou calculations done in the determination of synergism.
  • Table 2 The values shown in Table 2 are calculated as follows: 1 ) from the raw data (% dead cells) shown in Table 1 , the background (controls) were subtracted, resulting in the specific killing for each treatment group; then 2) the specific killing values were normalized by setting the combination of MOR00208 + BEN to 1. The averages of Table 2 are depicted in Figure 5.
  • Example ADCC dose response curves used in the Chou factor calculations of the MOR00208 + BEN combination are shown in Figure 2.
  • the constant m determines the shape of the dose-effect curve.
  • fraction F u the ratio of % cell death of the treated cell line to the % cell death of the cell line exposed to a control. That is:
  • F u % cell death(treated cell line)/ % cell death (non-treated cell line)
  • the % cell death of a cell line is the constant D50 in the median effect equation, which can be estimated by the linear regression described above.
  • the Cl-isobol method provides a quantitative assessment of synergism between drugs.
  • a combination index (CI) is estimated from dose-effect data of single and combined drug treatments.
  • Drug interaction is more pronounced the farther a CI value is from 1.
  • the combination index (CI) of a combined drug treatment is defined as
  • D1 and D2 are the doses of drug 1 and drug 2 of the combination, respectively; and Dx1 , and Dx2 is the dose of a treatment with only drug 1 and drug 2 that would give the same effect as that of the combination.
  • the doses Dx1 and Dx2 need to be estimated from the dose-effect data of single drug treatments. Essentially, a median effect equation is fitted to the data of each drug. From the median effect equation of a drug, we can estimate the dose (i.e. D) necessary to produce an effect (i.e. Fa, Fu). The further a point lies from the additive line, the bigger the different between 1 and its CI, thus the stronger the (synergistic or antagonistic) effect is.
  • the Chou index values indicate clear synergism of the combination of MOR00208 and bendamustine in the specific killing of MEC-1 cells as compared to MOR00208 and bendamustine alone. This conclusion is based upon the Chou calculations of 0,2, 0.7 and 0.75 of each of the three experiments, respectively, having an average of 0,6, where a CI ⁇ 1 indicates synergism. Therefore, the combination of MOR00208 and bendamustine will also behave synergistically in the treatment of non-Hodgkin's lymphoma (NHL), chronic lymphoid leukemia (CLL), and acute lymphoblastic leukemia (ALL) in humans.
  • NHL non-Hodgkin's lymphoma
  • CLL chronic lymphoid leukemia
  • ALL acute lymphoblastic leukemia
  • the Bonferroni's Multiple Comparison Test shows that the combination treatment of BEN + MOR00208 is statistically more effective in the specific killing of MEC-1 cells than the treatment of BEN and MOR00208 alone.
  • Example 2 MOR00208 and BEN alone and in combination in subcutaneously (SC)-implanted human Ramos Burkitt's B-cell lymphoma tumor growth model.
  • RAMOS human Burkitt's lymphoma cells (ATCC number CRL-1596, lot# 3953138); Vehicle control: 150 mM NaCI, 25 mg/mL mannitol, pH 5.5-6.0; (adjusted with 0.01 M NaOH).
  • Ref_mAb_33_lgG_Xen 10 mg/mL in PBS, referred to as Ref_mAb_33.
  • Ref_mAb_33 Six-week-old, female, C.B-17 SCID mice (CB17/lcr-Prkdcscid/lcrlcoCrl) were purchased from Charles River Laboratories (Wilmington, MA) and acclimated in the laboratories for nine days prior to experimentation.
  • SCID mice were implanted sub-cutaneously with RAMOS cells ( ⁇ 5 x 10 6 cells/mouse). When the mice had tumors of approximately 150 mm3 in size, or ⁇ 14 days after inoculation, they were separated into groups, where each group had tumor volumes of relatively the same size. Treatments began on Day 15. The treatment regimens are provided in Table 4. The study duration was 60 days.
  • MOR00208, and bendamustine were administered in a volume of 0.1 mL_/10 g of body weight.
  • MOR00208 and vehicle control/Ref_mAb_33 at a concentration of 0.6/1 .0 mg/mL, and bendamustine at concentration of 1 .3, and 1.6 mg/mL.
  • the readouts were 1 ) Median days to reach 4000 mg in size, where the statistical analysis was done using the log rank test and 2) Tumor size on study day 34, where the statistical analysis was done using the One-Way-ANOVA and Bonferroni's post hoc tests. (Raw data not shown). Tumor weights were calculated using the equation (I x w2)/2, where I and w refer to the larger and smaller dimensions collected at each measurement. The results are shown in Figures 7-10. The combination therapy was not significantly superior to the respective monotherapies in this subcut model, as compared to the clear synergy shown in the orthotopic survival model below. This is considered to be related to the ineffective MOR00208 dosing regimen in this model.
  • orthotopic survival model is believed to be more predictive of how well the combination treatment would work in the treatment of CLL, NHL, and ALL in humans, as the orthotopic model better mimics the multifocal disease nature, including an involvement of the vascular system, as compared to the subcut, solid tumor model above.
  • Cyclophosphamide (Baxter, Lot. No.1 A548C); Vehicle Control: 0.9% sodium chloride, 25mg/ml mannitol, pH 6.5-6.8 (adjusted with 0.01 M NaOH); SCID Mice (University of Sydney, Waite Campus, Urrbaraie, SA, Australia, Strain C.B.-17-lgh-1 b -Prkdc scid ); RAMOS human Burkitt's lymphoma cells (ATCC number CRL-1596); Ref_mAb_33_lgG_Xen (10 mg/mL in PBS, referred to as Ref_mAb_33); Bendamustine (Mundipharma, Lot No. 83889).
  • SCID mice were pre-treated with Cyclophosphamide (75 mg/kg, i.p., twice daily) for two days prior to RAMOS cell inoculation (Day -2 and -1 ).
  • Cyclophosphamide 75 mg/kg, i.p., twice daily
  • the mice were separated into seven groups of ten mice each, and inoculated with 1 x 10 6 RAMOS cells each intravenously into the tail vein.
  • the planned dosing regimen for each group is shown in Table 5 and commenced on Day 3. The study duration was 60 days. Table 5: Dosing regimen
  • the survival data is shown in Table 6 and Figure 6.
  • ILSMOR00208 3mg/kg + ILSBendamustine 16mg/kg (25.5% + (-5.88)% 19.62%).

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Immunology (AREA)
  • General Health & Medical Sciences (AREA)
  • Organic Chemistry (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Engineering & Computer Science (AREA)
  • Epidemiology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Microbiology (AREA)
  • Mycology (AREA)
  • Biophysics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Molecular Biology (AREA)
  • Genetics & Genomics (AREA)
  • Biochemistry (AREA)
  • Oncology (AREA)
  • Biomedical Technology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Endocrinology (AREA)
  • Cell Biology (AREA)
  • Hematology (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Peptides Or Proteins (AREA)
PCT/EP2012/065906 2011-08-16 2012-08-14 Combination therapy with an anti - cd19 antibody and a nitrogen mustard Ceased WO2013024097A1 (en)

Priority Applications (25)

Application Number Priority Date Filing Date Title
SM20220159T SMT202200159T1 (it) 2011-08-16 2012-08-14 Terapia in combinazione con un anticorpo anti-cd19 e una mostarda azotata
KR1020207014299A KR20200058583A (ko) 2011-08-16 2012-08-14 항-cd19 항체 및 질소 머스타드를 사용한 조합 요법
CA2841875A CA2841875C (en) 2011-08-16 2012-08-14 Combination therapy with an anti - cd19 antibody and a nitrogen mustard
JP2014525434A JP6184952B2 (ja) 2011-08-16 2012-08-14 抗cd19抗体とナイトロゲンマスタードとの併用療法
KR1020147006936A KR20140064873A (ko) 2011-08-16 2012-08-14 항-cd19 항체 및 질소 머스타드를 사용한 조합 요법
ES12747923T ES2909722T3 (es) 2011-08-16 2012-08-14 Terapia de combinación con un anticuerpo anti-CD19 y una mostaza nitrogenada
PL12747923T PL2744515T3 (pl) 2011-08-16 2012-08-14 Terapia skojarzona przeciwciałem anty-cd19 i iperytem azotowym
RS20220412A RS63238B1 (sr) 2011-08-16 2012-08-14 Kombinovana terapija sa anti-cd19 antitelom i azotnim senfom
US14/126,928 US20140255427A1 (en) 2011-08-16 2012-08-14 Combination therapy with an anti - cd19 antibody and a nitrogen mustard
RU2014103492A RU2625222C2 (ru) 2011-08-16 2012-08-14 Комбинированная терапия антителом к cd19 и азотистым ипритом
BR112013033919-5A BR112013033919B1 (pt) 2011-08-16 2012-08-14 Uso de um anticorpo específico para cd19
NZ617770A NZ617770B2 (en) 2011-08-16 2012-08-14 Combination therapy with an anti - cd19 antibody and a nitrogen mustard
HRP20220228TT HRP20220228T1 (hr) 2011-08-16 2012-08-14 Kombinacijska terapija s protutijelom anti-cd19 i dušičnim alkilirajućim agensom
LTEPPCT/EP2012/065906T LT2744515T (lt) 2011-08-16 2012-08-14 Kombinuota terapija su anti-cd19 antikūnu ir azoto garstyčiomis
EP12747923.6A EP2744515B1 (en) 2011-08-16 2012-08-14 Combination therapy with an anti-cd19 antibody and a nitrogen mustard
AU2012296907A AU2012296907B2 (en) 2011-08-16 2012-08-14 Combination therapy with an anti - CD19 antibody and a nitrogen mustard
EP22155572.5A EP4062936A1 (en) 2011-08-16 2012-08-14 Combination therapy with an anti-cd19 antibody and a nitrogen mustard
DK12747923.6T DK2744515T3 (da) 2011-08-16 2012-08-14 Kombinationsterapi med et anti-cd19-antistof og en nitrogensennep
CN201280036571.XA CN103732252B (zh) 2011-08-16 2012-08-14 使用抗cd‑19抗体和氮芥的联合治疗
MX2013014933A MX354479B (es) 2011-08-16 2012-08-14 Terapia de combinación con un anticuerpo anti-cd19 y una mostaza de nitrógeno.
SI201231989T SI2744515T1 (sl) 2011-08-16 2012-08-14 Kombinirana terapija s protitelesom proti CD19 in dušikovim iperitom
KR1020197026462A KR102115203B1 (ko) 2011-08-16 2012-08-14 항-cd19 항체 및 질소 머스타드를 사용한 조합 요법
IL230293A IL230293B (en) 2011-08-16 2014-01-02 Combined treatment with anti-19cd antibody and nitrogen mustard
US16/839,777 US20200353077A1 (en) 2011-08-16 2020-04-03 Combinations and uses thereof
US18/411,350 US20240366756A1 (en) 2011-08-16 2024-01-12 Combinations and uses thereof

Applications Claiming Priority (8)

Application Number Priority Date Filing Date Title
US201161523861P 2011-08-16 2011-08-16
EP11177658 2011-08-16
EP11177658.9 2011-08-16
US61/523,861 2011-08-16
US201261647539P 2012-05-16 2012-05-16
US61/647,539 2012-05-16
US201261654097P 2012-06-01 2012-06-01
US61/654,097 2012-06-01

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US14/126,928 A-371-Of-International US20140255427A1 (en) 2011-08-16 2012-08-14 Combination therapy with an anti - cd19 antibody and a nitrogen mustard
US16/839,777 Continuation US20200353077A1 (en) 2011-08-16 2020-04-03 Combinations and uses thereof

Publications (1)

Publication Number Publication Date
WO2013024097A1 true WO2013024097A1 (en) 2013-02-21

Family

ID=47714801

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2012/065906 Ceased WO2013024097A1 (en) 2011-08-16 2012-08-14 Combination therapy with an anti - cd19 antibody and a nitrogen mustard

Country Status (24)

Country Link
US (3) US20140255427A1 (enExample)
EP (2) EP2744515B1 (enExample)
JP (1) JP6184952B2 (enExample)
KR (3) KR20200058583A (enExample)
CN (1) CN103732252B (enExample)
AU (1) AU2012296907B2 (enExample)
BR (1) BR112013033919B1 (enExample)
CA (2) CA2841875C (enExample)
CY (1) CY1125122T1 (enExample)
DK (1) DK2744515T3 (enExample)
ES (1) ES2909722T3 (enExample)
HR (1) HRP20220228T1 (enExample)
HU (1) HUE058350T2 (enExample)
IL (1) IL230293B (enExample)
LT (1) LT2744515T (enExample)
MX (1) MX354479B (enExample)
PL (1) PL2744515T3 (enExample)
PT (1) PT2744515T (enExample)
RS (1) RS63238B1 (enExample)
RU (1) RU2625222C2 (enExample)
SG (1) SG10201606785UA (enExample)
SI (1) SI2744515T1 (enExample)
SM (1) SMT202200159T1 (enExample)
WO (1) WO2013024097A1 (enExample)

Cited By (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2016189014A1 (en) 2015-05-26 2016-12-01 Morphosys Ag Combination of an anti-cd19 antibody and a bruton's tyrosine kinase inhibitor and uses thereof
WO2017032679A1 (en) 2015-08-21 2017-03-02 Morphosys Ag Combinations and uses thereof
CN106794231A (zh) * 2014-06-16 2017-05-31 赞科股份有限公司 用于慢性淋巴细胞性白血病(cll)的治疗
WO2017172981A2 (en) 2016-03-29 2017-10-05 University Of Southern California Chimeric antigen receptors targeting cancer
WO2018078123A1 (en) 2016-10-28 2018-05-03 Morphosys Ag Combination of anti cd19 antibody with a bcl-2 inhibitor and uses thereof
WO2018220040A1 (en) 2017-05-31 2018-12-06 Morphosys Ag Treatment paradigm for an anti-cd19 antibody and venetoclax combination treatment
RU2802812C2 (ru) * 2017-05-31 2023-09-04 МорфоСис АГ Лечебный подход, предназначенный для лечения комбинацией антитела к CD19 и венетоклакса
US12269859B2 (en) 2016-12-02 2025-04-08 Angeles Therapeutics, Inc. Synthetic immune receptors and methods of use thereof
US12491244B2 (en) 2018-09-12 2025-12-09 GC Cell Corporation Pharmaceutical combinations for treating tumor comprising anti-CD19 antibody and natural killer cell

Families Citing this family (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
SG11201810159TA (en) * 2016-05-30 2018-12-28 Morphosys Ag Methods for predicting therapeutic benefit of anti-cd19 therapy in patients
IL313736A (en) * 2021-12-22 2024-08-01 Incyte Corp Treatment paradigm for CD19 antibody therapy

Citations (15)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4708871A (en) 1983-03-08 1987-11-24 Commonwealth Serum Laboratories Commission Antigenically active amino acid sequences
US5686072A (en) 1992-06-17 1997-11-11 Board Of Regents, The University Of Texas Epitope-specific monoclonal antibodies and immunotoxins and uses thereof
WO2002022212A2 (en) 2000-09-18 2002-03-21 Idec Pharmaceuticals Corporation Combination therapy for treatment of autoimmune diseases using b cell depleting/immunoregulatory antibody combination
WO2003048731A2 (en) 2001-12-03 2003-06-12 Abgenix, Inc. Antibody categorization based on binding characteristics
WO2005012493A2 (en) 2003-07-31 2005-02-10 Immunomedics, Inc. Anti-cd19 antibodies
WO2006065392A2 (en) 2004-11-05 2006-06-22 Cephalon, Inc. Cancer treatments
WO2007002223A2 (en) 2005-06-20 2007-01-04 Medarex, Inc. Cd19 antibodies and their uses
US20070154473A1 (en) 2005-12-30 2007-07-05 Merck Patent Gmbh Anti-CD19 antibodies with reduced immunogenicity
WO2008022152A2 (en) 2006-08-14 2008-02-21 Xencor, Inc. Optimized antibodies that target cd19
WO2008031056A2 (en) 2006-09-08 2008-03-13 Medimmune, Llc Humanized anti-cd19 antibodies and their use in treatment of oncology, transplantation and autoimmune disease
WO2008150494A1 (en) 2007-05-30 2008-12-11 Xencor, Inc. Methods and compositions for inhibiting cd32b expressing cells
WO2009052431A2 (en) 2007-10-19 2009-04-23 Seattle Genetics, Inc. Cd19 binding agents and uses thereof
WO2010053716A1 (en) 2008-11-07 2010-05-14 Immunomedics, Inc. Improved anti-cd19 antibodies
WO2010095031A2 (en) 2009-02-23 2010-08-26 Glenmark Pharmaceuticals S.A. Humanized antibodies that bind to cd19 and their uses
WO2010151341A1 (en) 2009-06-24 2010-12-29 The Feinstein Institute For Medical Research Method for treating chronic lymphocytic leukemia

Family Cites Families (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
DK1071752T3 (da) * 1998-04-21 2003-10-20 Micromet Ag CD19xCD3-specifikke polypeptider og anvendelsen deraf
HK1043312B (en) * 1999-05-07 2006-07-28 Genentech, Inc. Treatment of autoimmune diseases with antagonists which bind to b cell surface markers
US20080260731A1 (en) * 2002-03-01 2008-10-23 Bernett Matthew J Optimized antibodies that target cd19
US20110274697A1 (en) * 2009-01-16 2011-11-10 Cherry Teresa Thomas Novel uses
TWI409079B (zh) * 2009-08-14 2013-09-21 Roche Glycart Ag 非典型岩藻醣化cd20抗體與苯達莫斯汀(bendamustine)之組合療法
CN102470172B (zh) * 2009-08-14 2014-09-24 罗切格利卡特公司 无岩藻糖基化cd20抗体与氟达拉滨和/或米托蒽醌的联合疗法
MX2012005163A (es) * 2009-11-06 2012-11-22 Infinity Pharmaceuticals Inc Formulaciones orales de un inhibidor de la ruta de hedgehog.

Patent Citations (19)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4708871A (en) 1983-03-08 1987-11-24 Commonwealth Serum Laboratories Commission Antigenically active amino acid sequences
US5686072A (en) 1992-06-17 1997-11-11 Board Of Regents, The University Of Texas Epitope-specific monoclonal antibodies and immunotoxins and uses thereof
WO2002022212A2 (en) 2000-09-18 2002-03-21 Idec Pharmaceuticals Corporation Combination therapy for treatment of autoimmune diseases using b cell depleting/immunoregulatory antibody combination
WO2003048731A2 (en) 2001-12-03 2003-06-12 Abgenix, Inc. Antibody categorization based on binding characteristics
WO2005012493A2 (en) 2003-07-31 2005-02-10 Immunomedics, Inc. Anti-cd19 antibodies
US7109304B2 (en) 2003-07-31 2006-09-19 Immunomedics, Inc. Humanized anti-CD19 antibodies
WO2006065392A2 (en) 2004-11-05 2006-06-22 Cephalon, Inc. Cancer treatments
US8097703B2 (en) 2005-06-20 2012-01-17 Medarex, Inc. CD19 antibodies and their uses
WO2007002223A2 (en) 2005-06-20 2007-01-04 Medarex, Inc. Cd19 antibodies and their uses
US20070154473A1 (en) 2005-12-30 2007-07-05 Merck Patent Gmbh Anti-CD19 antibodies with reduced immunogenicity
WO2007076950A1 (en) 2005-12-30 2007-07-12 Merck Patent Gmbh Anti-cd19 antibodies with reduced immunogenicity
WO2008022152A2 (en) 2006-08-14 2008-02-21 Xencor, Inc. Optimized antibodies that target cd19
WO2008031056A2 (en) 2006-09-08 2008-03-13 Medimmune, Llc Humanized anti-cd19 antibodies and their use in treatment of oncology, transplantation and autoimmune disease
WO2008150494A1 (en) 2007-05-30 2008-12-11 Xencor, Inc. Methods and compositions for inhibiting cd32b expressing cells
WO2009052431A2 (en) 2007-10-19 2009-04-23 Seattle Genetics, Inc. Cd19 binding agents and uses thereof
US7968687B2 (en) 2007-10-19 2011-06-28 Seattle Genetics, Inc. CD19 binding agents and uses thereof
WO2010053716A1 (en) 2008-11-07 2010-05-14 Immunomedics, Inc. Improved anti-cd19 antibodies
WO2010095031A2 (en) 2009-02-23 2010-08-26 Glenmark Pharmaceuticals S.A. Humanized antibodies that bind to cd19 and their uses
WO2010151341A1 (en) 2009-06-24 2010-12-29 The Feinstein Institute For Medical Research Method for treating chronic lymphocytic leukemia

Non-Patent Citations (28)

* Cited by examiner, † Cited by third party
Title
"Epitope Mapping Protocols in Methods in Molecular Biology", vol. 66, 1996, HUMANA PRESS
ANDERSON ET AL., BLOOD, vol. 63, 1984, pages 1424 - 1433
BREMER ET AL.: "Journal of Cancer Research and Clinical Oncology", vol. 128, 1 November 2002, SPRINGER INTERNATIONAL, article "High rates of long lasting remission after 5-day bendamustine chemotherapy cycles in pre-treated low-grade non-Hodgkin's lymphomas"
BREMER KARL: "High rates of long-lasting remissions after 5-day bendamustine chemotherapy cycles in pre-treated low-grade non-Hodgkin's-lymphomas", JOURNAL OF CANCER RESEARCH AND CLINICAL ONCOLOGY, SPRINGER INTERNATIONAL, BERLIN, DE, vol. 128, no. 11, 1 November 2002 (2002-11-01), pages 603 - 609, XP002551065, ISSN: 0171-5216, [retrieved on 20021026], DOI: 10.1007/S00432-002-0378-6 *
CHOTHIA C; LESK AM: "Canonical structures for the hypervariable regions of immunoglobulins", J MOL BIOL., vol. 196, no. 4, 1987, pages 901 - 17, XP024010426, DOI: doi:10.1016/0022-2836(87)90412-8
CHOU TC; TALALAY P: "Quantitative analysis of dose-effect relationships: the combined effects of multiple drugs or enzyme inhibitors", ADV ENZYME REGUL, vol. 22, 1984, pages 27 - 55, XP023796270, DOI: doi:10.1016/0065-2571(84)90007-4
CLARKE ET AL.: "Issues in experimental design and endpoint analysis in the study of experimental cytotoxic agents in vivo in breast cancer and other models", BREAST CANCER RESEARCH AND TREATMENT, vol. 46, 1997, pages 255 - 278
CLL. KALOS ET AL.: "T cells with Chimeric Antigen Receptors Have Potent Antitumor Effects and Can Establish Memory in Patients with Advanced Leukemia", SCIENCE TRANSLATIONAL MEDICINE, vol. 3, no. 95, 10 August 2011 (2011-08-10), XP002667262, DOI: doi:10.1126/scitranslmed.3002842
GEYSEN ET AL., MOL. IMMUNOL., vol. 23, 1986, pages 709 - 715
GEYSEN ET AL., PROC. NATL. ACAD. SCI. USA, vol. 8, 1984, pages 3998 - 4002
GEYSEN ET AL., PROC. NATL. ACAD. SCI. USA, vol. 82, 1985, pages 78 - 182
GROSSBARD ET AL., BR. J. HAEMATOL, vol. 102, 1998, pages 509 - 15
HOPP ET AL., PROC. NATL. ACAD. SCI USA, vol. 78, 1981, pages 3824 - 3828
JAMES ET AL.: "Antibody-mediated B-cell depletion before adoptive immunotherapy with T cells expressing CD20-specific chimeric T-cell receptors facilitates eradication of leukemia in immunocompetent mice", BLOOD, vol. 114, no. 27, 30 October 2009 (2009-10-30), pages 5454 - 63
KABAT E.A; WU T.T.; PERRY H.M.; GOTTESMAN K.S.; FOELLER C.: "Sequences of Proteins of Immunological Interest", 1991, NIH PUBLICATION NO. 91-3242
KALOS MICHAEL ET AL: "T Cells with Chimeric Antigen Receptors Have Potent Antitumor Effects and Can Establish Memory in Patients with Advanced Leukemia", SCIENCE TRANSLATIONAL MEDICINE, vol. 3, no. 95, 10 August 2011 (2011-08-10), pages - HTTP://ST, XP002667262 *
KYTE ET AL., J.MO. BIOL., vol. 157, 1982, pages 105 - 132
LOKEN ET AL., BLOOD, vol. 70, 1987, pages 1316 - 1324
NADLER ET AL., J. IMMUNOL., vol. 131, 1983, pages 244 - 250
SADELAIN ET AL.: "Current Opinion in Immunology", vol. 21, 2 April 2009, ELSEVIER, article "The promise and potential pitfalls of chimeric antigen receptors"
SADELAIN MICHEL ET AL: "The promise and potential pitfalls of chimeric antigen receptors", CURRENT OPINION IN IMMUNOLOGY, ELSEVIER, OXFORD, GB, vol. 21, no. 2, 2 April 2009 (2009-04-02), pages 215 - 223, XP002667114, ISSN: 0952-7915 *
SCHEUERMANN ET AL.: "CD19 Antigen in Leukemia and Lymphoma Diagnosis and Immunotherapy", LEUKEMIA AND LYMPHOMA, vol. 18, 1995, pages 385 - 397, XP009155469, DOI: doi:10.3109/10428199509059636
SCHEUERMANN R H ET AL: "CD19 antigen in leukemia and lymphoma diagnosis and immunotherapy", LEUKEMIA AND LYMPHOMA, HARWOOD ACADEMIC PUBLISHERS, CHUR, CH, vol. 18, no. 5-6, 1 August 1995 (1995-08-01), pages 385 - 397, XP009155469, ISSN: 1042-8194 *
SCHEUERMANN, LEUK. LYMPHOMA, vol. 18, 1995, pages 385 - 397
TING-CHAO CHOU: "Theoretical Basis, Experimental Design, and Computerized Simulation of Synergism and Antagonism in Drug Combination Studies", PHARMACOL REV, vol. 58, 2006, pages 621 - 681, XP055151376, DOI: doi:10.1124/pr.58.3.10
TREON ET AL., SEMIN. ONCOL, vol. 30, 2003, pages 248 - 52
UCKUN ET AL., BLOOD, vol. 71, 1988, pages 13 - 29
WEBB, J. L.: "Enzyme and Metabolic Inhibitors", 1963, ACADEMIC PRESS

Cited By (35)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN106794231A (zh) * 2014-06-16 2017-05-31 赞科股份有限公司 用于慢性淋巴细胞性白血病(cll)的治疗
EP3157553A4 (en) * 2014-06-16 2018-02-28 Xencor, Inc. Treatment for chronic lymphocytic leukemia (cll)
CN114601931B (zh) * 2015-05-26 2023-09-01 莫佛塞斯公司 抗-cd19抗体和布鲁顿酪氨酸激酶抑制剂的组合及其用途
WO2016189014A1 (en) 2015-05-26 2016-12-01 Morphosys Ag Combination of an anti-cd19 antibody and a bruton's tyrosine kinase inhibitor and uses thereof
CN107660151A (zh) * 2015-05-26 2018-02-02 莫佛塞斯公司 抗‑cd19抗体和布鲁顿酪氨酸激酶抑制剂的组合及其用途
IL255377B (en) * 2015-05-26 2021-12-01 Morphosys Ag Combination of anti-cd19 antibody and proton tyrosine kinase inhibitor and its uses
IL255377A (en) * 2015-05-26 2018-02-28 Morphosys Ag A combination of anti-cd19 antibody and broth-inhibiting kinase inhibitor kinases and uses
CN107660151B (zh) * 2015-05-26 2022-03-11 莫佛塞斯公司 抗-cd19抗体和布鲁顿酪氨酸激酶抑制剂的组合及其用途
RU2756010C2 (ru) * 2015-05-26 2021-09-24 МорфоСис АГ Комбинация антитела к CD19 и ингибитора тирозинкиназы брутона и их применение
US10617691B2 (en) 2015-05-26 2020-04-14 Morphosys Ag Combination of an anti-CD19 antibody and a Bruton's tyrosine kinase inhibitor and uses thereof
CN114601931A (zh) * 2015-05-26 2022-06-10 莫佛塞斯公司 抗-cd19抗体和布鲁顿酪氨酸激酶抑制剂的组合及其用途
EP3603672A1 (en) 2015-05-26 2020-02-05 MorphoSys AG Combination of an anti-cd19 antibody and a bruton's tyrosine kinase inhibitor and uses thereof
RU2767063C2 (ru) * 2015-08-21 2022-03-16 МорфоСис АГ Комбинации и их использование
US11224654B2 (en) 2015-08-21 2022-01-18 Morphosys Ag Combinations and uses thereof
US12194095B2 (en) 2015-08-21 2025-01-14 Incyte Corporation Combinations and uses thereof
EP3954388A1 (en) 2015-08-21 2022-02-16 MorphoSys AG Combinations and uses thereof
WO2017032679A1 (en) 2015-08-21 2017-03-02 Morphosys Ag Combinations and uses thereof
WO2017172981A2 (en) 2016-03-29 2017-10-05 University Of Southern California Chimeric antigen receptors targeting cancer
KR102500868B1 (ko) 2016-10-28 2023-02-16 모르포시스 아게 항-cd19 항체 및 bcl-2 억제제의 조합 및 이의 용도
IL301786B1 (en) * 2016-10-28 2025-05-01 Morphosys Ag Combination of anti-CD19 antibody with BCL-2 inhibitor and their uses
RU2756405C2 (ru) * 2016-10-28 2021-09-30 МорфоСис АГ Комбинация антитела CD19 с ингибитором BCL-2 и пути ее применения
IL301786B2 (en) * 2016-10-28 2025-09-01 Morphosys Ag Combination of anti-CD19 antibody with BCL-2 inhibitor and their uses
JP2019533682A (ja) * 2016-10-28 2019-11-21 モルフォシス・アーゲー 抗cd19抗体とbcl−2阻害剤との組み合わせおよびその使用
JP7094950B2 (ja) 2016-10-28 2022-07-04 モルフォシス・アーゲー 抗cd19抗体とbcl-2阻害剤との組み合わせおよびその使用
KR20190075942A (ko) * 2016-10-28 2019-07-01 모르포시스 아게 항-cd19 항체 및 bcl-2 억제제의 조합 및 이의 용도
US12358983B2 (en) 2016-10-28 2025-07-15 Incyte Corporation Combination of anti CD19 antibody with a BCL-2 inhibitor and uses thereof
EP3903821A1 (en) 2016-10-28 2021-11-03 MorphoSys AG Combination of anti cd19 antibody with a bcl-2 inhibitor and uses thereof
WO2018078123A1 (en) 2016-10-28 2018-05-03 Morphosys Ag Combination of anti cd19 antibody with a bcl-2 inhibitor and uses thereof
US12269859B2 (en) 2016-12-02 2025-04-08 Angeles Therapeutics, Inc. Synthetic immune receptors and methods of use thereof
EP4268900A3 (en) * 2017-05-31 2024-03-06 MorphoSys AG Treatment paradigm for an anti-cd19 antibody and venetoclax combination treatment
EP4268900A2 (en) 2017-05-31 2023-11-01 MorphoSys AG Treatment paradigm for an anti-cd19 antibody and venetoclax combination treatment
RU2802812C2 (ru) * 2017-05-31 2023-09-04 МорфоСис АГ Лечебный подход, предназначенный для лечения комбинацией антитела к CD19 и венетоклакса
WO2018220040A1 (en) 2017-05-31 2018-12-06 Morphosys Ag Treatment paradigm for an anti-cd19 antibody and venetoclax combination treatment
CN110678201A (zh) * 2017-05-31 2020-01-10 莫佛塞斯公司 抗cd19抗体和维奈托克组合治疗的治疗模式
US12491244B2 (en) 2018-09-12 2025-12-09 GC Cell Corporation Pharmaceutical combinations for treating tumor comprising anti-CD19 antibody and natural killer cell

Also Published As

Publication number Publication date
JP6184952B2 (ja) 2017-08-23
HUE058350T2 (hu) 2022-07-28
KR20190107749A (ko) 2019-09-20
NZ617770A (en) 2016-01-29
US20200353077A1 (en) 2020-11-12
KR20140064873A (ko) 2014-05-28
ES2909722T3 (es) 2022-05-10
MX2013014933A (es) 2014-04-16
CN103732252B (zh) 2017-11-10
PT2744515T (pt) 2022-05-19
KR20200058583A (ko) 2020-05-27
RS63238B1 (sr) 2022-06-30
SI2744515T1 (sl) 2022-05-31
HRP20220228T1 (hr) 2022-05-13
DK2744515T3 (da) 2022-03-28
US20140255427A1 (en) 2014-09-11
KR102115203B1 (ko) 2020-05-28
CY1125122T1 (el) 2024-12-13
BR112013033919B1 (pt) 2022-11-16
AU2012296907B2 (en) 2017-01-05
LT2744515T (lt) 2022-04-25
SMT202200159T1 (it) 2022-05-12
EP2744515A1 (en) 2014-06-25
RU2625222C2 (ru) 2017-07-12
RU2014103492A (ru) 2015-09-27
SG10201606785UA (en) 2016-10-28
PL2744515T3 (pl) 2022-05-30
JP2014525926A (ja) 2014-10-02
BR112013033919A2 (pt) 2017-12-19
IL230293B (en) 2019-01-31
CA2841875C (en) 2021-11-02
CA2841875A1 (en) 2013-02-21
CA3137321A1 (en) 2013-02-21
MX354479B (es) 2018-03-07
US20240366756A1 (en) 2024-11-07
CN103732252A (zh) 2014-04-16
EP4062936A1 (en) 2022-09-28
EP2744515B1 (en) 2022-02-09

Similar Documents

Publication Publication Date Title
US20240366756A1 (en) Combinations and uses thereof
US20240009196A1 (en) Combination of an anti-cd19 antibody and a bruton's tyrosine kinase inhibitor and uses thereof
US12194095B2 (en) Combinations and uses thereof
AU2012296905B2 (en) Combination therapy with an anti - CD19 antibody and a purine analog
AU2012296907A1 (en) Combination therapy with an anti - CD19 antibody and a nitrogen mustard
HK1251152A1 (en) Combination of an anti-cd19 antibody and a bruton's tyrosine kinase inhibitor and uses thereof
JP2014525926A5 (enExample)
HK40081594A (en) Combination therapy with an anti-cd19 antibody and a nitrogen mustard
HK40069168A (en) Combinations and uses thereof
HK40023127A (en) Combination of an anti-cd19 antibody and a bruton's tyrosine kinase inhibitor and uses thereof
NZ617770B2 (en) Combination therapy with an anti - cd19 antibody and a nitrogen mustard

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 12747923

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2012296907

Country of ref document: AU

Date of ref document: 20120814

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 14126928

Country of ref document: US

Ref document number: MX/A/2013/014933

Country of ref document: MX

ENP Entry into the national phase

Ref document number: 2841875

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2014525434

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 20147006936

Country of ref document: KR

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2014103492

Country of ref document: RU

Kind code of ref document: A

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112013033919

Country of ref document: BR

REG Reference to national code

Ref country code: BR

Ref legal event code: B01E

Ref document number: 112013033919

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 112013033919

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20131230