WO2013024095A1 - Combination therapy with an anti - cd19 antibody and a purine analog - Google Patents

Combination therapy with an anti - cd19 antibody and a purine analog Download PDF

Info

Publication number
WO2013024095A1
WO2013024095A1 PCT/EP2012/065904 EP2012065904W WO2013024095A1 WO 2013024095 A1 WO2013024095 A1 WO 2013024095A1 EP 2012065904 W EP2012065904 W EP 2012065904W WO 2013024095 A1 WO2013024095 A1 WO 2013024095A1
Authority
WO
WIPO (PCT)
Prior art keywords
seq
sequence
region
antibody
fludarabine
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/EP2012/065904
Other languages
English (en)
French (fr)
Inventor
Jutta AMERSDORFFER
Stefan Steidl
Mark Winderlich
Susanne KROHN
Lisa Rojkjaer
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Morphosys AG
Original Assignee
Morphosys AG
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to KR1020147006942A priority Critical patent/KR20140071368A/ko
Priority to KR1020197022418A priority patent/KR102117202B1/ko
Priority to JP2014525432A priority patent/JP6114273B2/ja
Priority to AU2012296905A priority patent/AU2012296905B2/en
Priority to US14/127,217 priority patent/US20140227277A1/en
Priority to RU2014103490A priority patent/RU2664462C9/ru
Priority to BR112013033916-0A priority patent/BR112013033916B1/pt
Priority to DK12745883.4T priority patent/DK2744826T3/da
Priority to MX2013014935A priority patent/MX353589B/es
Priority to RS20220314A priority patent/RS63121B1/sr
Priority to PL12745883T priority patent/PL2744826T3/pl
Priority to LTEPPCT/EP2012/065904T priority patent/LT2744826T/lt
Priority to ES12745883T priority patent/ES2909720T3/es
Priority to SI201231992T priority patent/SI2744826T1/sl
Priority to CN201280036572.4A priority patent/CN103703027B/zh
Application filed by Morphosys AG filed Critical Morphosys AG
Priority to CA2841738A priority patent/CA2841738C/en
Priority to EP12745883.4A priority patent/EP2744826B1/en
Priority to SM20220160T priority patent/SMT202200160T1/it
Priority to HRP20220224TT priority patent/HRP20220224T1/hr
Priority to KR1020207014644A priority patent/KR20200060779A/ko
Priority to EP22155604.6A priority patent/EP4083071A3/en
Priority to NZ617771A priority patent/NZ617771B2/en
Publication of WO2013024095A1 publication Critical patent/WO2013024095A1/en
Priority to IL230295A priority patent/IL230295B/en
Anticipated expiration legal-status Critical
Priority to ZA2014/01835A priority patent/ZA201401835B/en
Priority to US16/839,903 priority patent/US20200352975A1/en
Priority to US18/581,959 priority patent/US20240424012A1/en
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/3955Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/70Carbohydrates; Sugars; Derivatives thereof
    • A61K31/7042Compounds having saccharide radicals and heterocyclic rings
    • A61K31/7052Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides
    • A61K31/706Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom
    • A61K31/7064Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom containing condensed or non-condensed pyrimidines
    • A61K31/7076Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom containing condensed or non-condensed pyrimidines containing purines, e.g. adenosine, adenylic acid
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • A61P35/02Antineoplastic agents specific for leukemia
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2300/00Mixtures or combinations of active ingredients, wherein at least one active ingredient is fully defined in groups A61K31/00 - A61K41/00

Definitions

  • the present disclosure is related to a pharmaceutical combination of an anti-CD19 antibody and a purine analog for the treatment of non-Hodgkin's lymphoma, chronic lymphocytic leukemia and/or acute lymphoblastic leukemia.
  • B cells are lymphocytes that play a large role in the humoral immune response. They are produced in the bone marrow of most mammals, and represent 5-15% of the circulating lymphoid pool. The principal function of B cells is to make antibodies against various antigens, and are an essential component of the adaptive immune system.
  • lymphomas and leukemias.
  • NHL non-Hodgkin's lymphoma
  • CLL chronic lymphoid leukemia
  • ALL acute lymphoblastic leukemia
  • NHL is a heterogeneous malignancy originating from lymphocytes.
  • U.S. United States
  • the incidence is estimated at 65,000/year with mortality of approximately 20,000 (American Cancer Society, 2006; and SEER Cancer Statistics Review).
  • the disease can occur in all ages, the usual onset begins in adults over 40 years, with the incidence increasing with age.
  • NHL is characterized by a clonal proliferation of lymphocytes that accumulate in the lymph nodes, blood, bone marrow and spleen, although any major organ may be involved.
  • the current classification system used by pathologists and clinicians is the World Health Organization (WHO) Classification of Tumours, which organizes NHL into precursor and mature B-cell or T-cell neoplasms.
  • WHO World Health Organization
  • the PDQ is currently dividing NHL as indolent or aggressive for entry into clinical trials.
  • the indolent NHL group is comprised primarily of follicular subtypes, small lymphocytic lymphoma, MALT (mucosa-associated lymphoid tissue), and marginal zone; indolent encompasses approximately 50% of newly diagnosed B-cell NHL patients.
  • Aggressive NHL includes patients with histologic diagnoses of primarily diffuse large B cell (DLBL, DLBCL, or DLCL) (40% of all newly diagnosed patients have diffuse large cell), Burkitt's, and mantle cell.
  • the clinical course of NHL is highly variable. A major determinant of clinical course is the histologic subtype. Most indolent types of NHL are considered to be incurable disease.
  • rituximab anti-CD20 antibody
  • the current standard of care for most patients is rituximab + CHOP (R-CHOP) or rituximab + CVP (R-CVP).
  • Interferon is approved for initial treatment of NHL in combination with alkylating agents, but has limited use in the U.S.
  • Rituximab therapy has been shown to be efficacious in several types of NHL, and is currently approved as a first line treatment for both indolent (follicular lymphoma) and aggressive NHL (diffuse large B cell lymphoma).
  • indolent follicular lymphoma
  • aggressive NHL diffuse large B cell lymphoma
  • anti-CD20 monoclonal antibody mAb
  • primary resistance 50% response in relapsed indolent patients
  • acquired resistance 50% response rate upon re-treatment
  • rare complete response 2% complete resonse rate in relapsed population
  • a continued pattern of relapse a continued pattern of relapse.
  • B cells do not express CD20, and thus many B-cell disorders are not treatable using anti-CD20 antibody therapy.
  • Chronic lymphocytic leukemia also known as “chronic lymphoid leukemia” or “CLL”
  • CLL chronic lymphocytic leukemia
  • the malignant lymphocytes may look normal and mature, but they are not able to cope effectively with infection.
  • CLL is the most common form of leukemia in adults. Men are twice as likely to develop CLL as women.
  • the key risk factor is age. Over 75% of new cases are diagnosed in patients over age 50. More than 10,000 cases are diagnosed every year and the mortality is almost 5,000 a year (American Cancer Society, 2006; and SEER Cancer Statistics Review).
  • CLL is an incurable disease but progresses slowly in most cases. Many people with CLL lead normal and active lives for many years. Because of its slow onset, early-stage CLL is generally not treated since it is believed that early CLL intervention does not improve survival time or quality of life. Instead, the condition is monitored over time.
  • Initial CLL treatments vary depending on the exact diagnosis and the progression of the disease. There are dozens of agents used for CLL therapy. Combination chemotherapy regimens such as FCR (fludarabine, cyclophosphamide and rituximab), and BR (bendamustine and rituximab) are effective in both newly-diagnosed and relapsed CLL. Allogeneic bone marrow (stem cell) transplantation is rarely used as a first-line treatment for CLL due to its risk.
  • ALL acute lymphoblastic leukemia
  • ALL is characterised by the overproduction and continuous multiplication of malignant and immature white blood cells (also known as lymphoblasts) in the bone marrow.
  • 'Acute' refers to the undifferentiated, immature state of the circulating lymphocytes ("blasts"), and that the disease progresses rapidly with life expectancy of weeks to months if left untreated.
  • ALL is most common in childhood with a peak incidence of 4-5 years of age. Children of age 12- 16 die more easily from it than others. Currently, at least 80% of childhood ALL are considered curable. Under 4,000 cases are diagnosed every year and the mortality is almost 1 ,500 a year (American Cancer Society, 2006; and SEER Cancer Statistics Review).
  • the human CD 19 molecule is a structurally distinct cell surface receptor expressed on the surface of human B cells, including, but not limited to, pre-B cells, B cells in early development ⁇ i.e., immature B cells), mature B cells through terminal differentiation into plasma cells, and malignant B cells.
  • CD 19 is expressed by most pre-B acute lymphoblastic leukemias (ALL), non-Hodgkin's lymphomas, B cell chronic lymphocytic leukemias (CLL), pro-lymphocytic leukemias, hairy cell leukemias, common acute lymphocytic leukemias, and some Null-acute lymphoblastic leukemias (Nadler et al, J.
  • CD 19 Oncol's tumors
  • differentiated B cell tumors such as multiple myeloma, plasmacytomas, Waldenstrom's tumors (Grossbard et al., Br. J. Haematol, 102:509- 15(1998); Treon et al, Semin. Oncol,
  • the CD 19 antigen is a target for immunotherapy in the treatment of non-Hodgkin's lymphoma (including each the subtypes described herein), chronic lymphocytic leukemia and/or acute lymphoblastic leukemia.
  • CD19 has also been suggested as a target for immunotherapy in the treatment of autoimmune disorders in WO2000074718, which is incorporated by reference in its entirety.
  • T cells expressing an anti-CD19 chimeric antigen receptor (CAR) including both the CDS- ⁇ and CD28 molecules were administered to a patient having follicular lymphoma.
  • CAR chimeric antigen receptor
  • Kochenderfer et al. Eradication of B lineage cell and regression of lymphoma in a patient treated with autologous T cells genetically engineered to recognize CD19, Blood, vol. 1 16, no: 20 (November 2010).
  • Sadelain et al. The promise and potential pitfalls of chimeric antigen receptors, Current Opinion in Immunology, Elsevier, vol. 21 , no.2, 2 April 2009, which is incorporated by reference in its entirety, also describes anti-CD19 chimeric antigen receptors (CARs).
  • Fludarabine as a therapy in the treatment of CLL was described in Montserrat et al., Chronic lymphocytic leukemia treatment, Blood Review, Churchill Livingstone, vol. 7, no. 3 (1 Sept. 1993), but does not suggest the antibody specific for CD19 in combination with fludrabine as exemplified herein.
  • WO2007076950 which is incorporated by reference in its entirety, along with the cursory mention of fludarabine within a long list of potential combination partners, but fails either to teach the exemplified antibody or suggest the synergistic effects of the combination in the treatment of non-Hodgkin's lymphoma, chronic lymphocytic leukemia and/or acute lymphoblastic leukemia as exemplified herein.
  • CD19 antibody in leukemias and lymphomas is discussed in WO2005012493, which is incorporated by reference in its entirety, along with the cursory mention of fludarabine within a long list of potential combination partners, but fails either to teach the exemplified antibody or suggest the synergistic effects of the combination in the treatment of non-Hodgkin's lymphoma, chronic lymphocytic leukemia and/or acute lymphoblastic leukemia as exemplified herein.
  • CD19 antibody in CLL, NHL and ALL is described in Scheuermann et al., CD19 Antigen in Leukemia and Lymphoma Diagnosis and Immunotherapy, Leukemia and Lymphoma, Vol. 18, 385-397 (1995), which is incorporated by reference in its entirety, but fails to suggest the combination exemplified herein.
  • WO2010151341 (US 13/377,514) (The Feinstein Institute); US5686072 (University of Texas), and WO2002022212 (PCT/US01/29026) (IDEC Pharmaceuticals), which are all incorporated by reference in their entireties.
  • the present disclosure relates to a synergistic combination of an antibody specific for CD19 and a purine analog.
  • Such combinations are useful in the treatment of B cell malignancies, such as, non-Hodgkin's lymphoma, chronic lymphocytic leukemia and/or acute lymphoblastic leukemia.
  • the inventors found that the combination of a particular antibody specific for CD19 and fludarabine synergistically inhibited tumor growth and synergistically increased median survival days, both in Burkitt's lymphoma SCID mouse models, in comparison to the antibody and fludarabine alone. These in vivo models are indicative of how the combination will work in the treatment of non-Hodgkin's lymphoma in humans.
  • the combination of the exemplified anti-CD19 antibody and fludarabine behaved synergistically in models relevant to NHL and CLL. As both NHL and CLL are B cell related disorders and CD19 is highly expressed on B-cells, the exemplified combination would have the same mechanism of action and should also behave synergistically in the treatment of other B cell related disorders, e.g. ALL.
  • the combination of the exemplified antibody specific for CD19 and fludarabine will be effective in the treatment of humans in non-Hodgkin's lymphoma, chronic lymphocytic leukemia and/or acute lymphoblastic leukemia.
  • the antibody specific to CD19 exemplified in the present specification has already entered into clinical trials, where such combinations can be confirmed in humans.
  • fludarabine and other purine analogs are similar, as purine analogs interfere with the synthesis of nucleic acids, it is believed that synergy should also be seen when treating humans having non-Hodgkin's lymphoma, chronic lymphocytic leukemia and/or acute lymphoblastic leukemia with a combination of the exemplified anti-CD19 antibody and a purine analog other than fludarabine.
  • anti-CD19 antibody and other anti-CD19 antibodies bind CD19, it is believed that synergy should also be seen when treating humans having non-Hodgkin's lymphoma, chronic lymphocytic leukemia and/or acute lymphoblastic leukemia with a combination of any anti-CD19 antibody and a purine analog, e.g., fludarabine.
  • a purine analog e.g., fludarabine
  • antibodies that cross-compete with the exemplified antibody or bind to the same epitope as the exemplified antibody should also behave synergistically when treating humans having non-Hodgkin's lymphoma, chronic lymphocytic leukemia and/or acute lymphoblastic leukemia in combination with a purine analog, e.g., fludarabine.
  • An aspect of the present disclosure comprises a synergistic combination wherein the antibody specific for CD19 comprises an HCDR1 region of sequence SYVMH (SEQ ID NO: 1 ), an HCDR2 region of sequence NPYNDG (SEQ ID NO: 2), an HCDR3 region of sequence
  • GTYYYGTRVFDY (SEQ ID NO: 3), an LCDR1 region of sequence RSSKSLQNVNGNTYLY (SEQ ID NO: 4), an LCDR2 region of sequence RMSNLNS (SEQ ID NO: 5), and an LCDR3 region of sequence MQHLEYPIT (SEQ ID NO: 6) and fludarabine.
  • the combination is used for the treatment of non-Hodgkin's lymphoma, chronic lymphocytic leukemia and/or acute lymphoblastic leukemia.
  • Figure 1 shows the cytotoxicity effects of MOR208 and fludarabine alone and in combination on MEC-1 cells.
  • Figure 2 shows the ADCC dose reponse curves of the combination of MOR208 and fludarabine in MEC-1 cells.
  • Figure 3 shows the amino acid sequence of the variable domains of MOR208.
  • Figure 4 shows the amino acid sequence of the Fc regions of MOR208.
  • Figure 5 shows the normalized specific killing of MEC-1 target cells pretreated with Fludarabine (Flu) for 72 h.
  • the data represents a pool of 3 independent experiments with 3 different effector cell donors.
  • Figure 6 shows the mean tumor growth of the MOR208, FLU, and combination (MOR208/FLU) groups of the SCID mouse model described in Example 2.
  • Figure 7 shows median survival time of the MOR208, FLU, and combination (MOR208/FLU) groups of the SCID mouse model described in Example 3.
  • “Synergy”, “synergism” or “synergistic” mean more than the expected additive effect of a combination.
  • the “synergy”, “synergism” or “synergistic” effect of a combination is determined herein by the methods of Chou et al., Clarke et al., and/or Webb et al. See Ting-Chao Chou, Theoretical Basis, Experimental Design, and Computerized Simulation of Synergism and
  • antibody means monoclonal antibodies, including any isotype, such as, IgG, IgM, IgA, IgD and IgE.
  • An IgG antibody is comprised of two identical heavy chains and two identical light chains that are joined by disulfide bonds. Each heavy and light chain contains a constant region and a variable region. Each variable region contains three segments called
  • CDRs complementarity-determining regions
  • CDR1 complementarity-determining regions
  • CDR2 complementarity-determining regions
  • CDR3 hypervariable regions
  • the more highly conserved portions of the variable regions outside of the CDRs are called the "framework regions”.
  • An “antibody fragment” means an Fv, scFv, dsFv, Fab, Fab' F(ab')2 fragment, or other fragment, which contains at least one variable heavy or variable light chain, each containing CDRs and framework regions.
  • a purine analog is an antimetabolite, which mimics the structure of metabolic purines, thereby interfering with the synthesis of nucleic acids.
  • Fludarabine for example, may be incorporated into RNA and DNA by substituting for the purine nucleotides, adenine and guanine.
  • Purine analogs inhibit growth of fast proliferating cells of an individual, e.g. cancer cells, bone marrow cells or cells present in the gastrointestinal tract.
  • Purine analogs include mercaptopurine, azathioprine, thioguanine and fludarabine.
  • Mercaptopurine is used in the treatment of acute leukemias, lymphomas, rheumatoid arthritis, and inflammatory bowel disease, such as Crohn's Disease and ulcerative colitis, respectively.
  • Azathioprine is the main immunosuppressive cytotoxic substance. It is widely used in transplantations to control rejection reactions. It is nonenzymatically cleaved to 6-mercaptopurine that acts as a purine analogue and an inhibitor of DNA synthesis. By preventing the clonal expansion of lymphocytes in the induction phase of the immune response, it affects both the cell and the humoral immunity. It also successfully suppresses autoimmunity. Azathioprine has the following
  • Thioguanine has the following structure:
  • Fludarabine or fludarabine phosphate is a chemotherapy drug used in the treatment of chronic lymphocytic leukemia and indolent non-Hodgkins lymphomas. Fludarabine is a purine analog. Fludarabine inhibits DNA synthesis by interfering with ribonucleotide reductase and DNA polymerase and and is S phase-specific (since these enzymes are highly active during DNA re lication). Fludarabine has the following structure:
  • FLU when used herein means fludarabine.
  • VH refers to the variable region of an immunoglobulin heavy chain of an antibody, or antibody fragment.
  • VL refers to the variable region of the immunoglobulin light chain of an antibody, or antibody fragment.
  • CD19 refers to the protein known as CD19, having the following synonyms: B4, B-lymphocyte antigen CD19, B-lymphocyte surface antigen B4, CVID3, Differentiation antigen CD19, MGC12802, and T-cell surface antigen Leu-12.
  • Human CD19 has the amino acid sequence of:
  • SIRGQPGPNHEEDADSYENMDNPDGPDPAWGGGGRMGTWSTR (SEQ ID NO: 7)
  • MOR208 is an anti-CD19 antibody.
  • the amino acid sequence of the variable domains is provided in Figure 3.
  • the amino acid sequence of the heavy and light chain Fc regions of MOR208 is provided in Figure 4.
  • “MOR208” and “XmAb 5574” are used as synonyms to describe the antibody shown in Figures 3 and 4.
  • the MOR208 antibody is described in US patent application serial number 12/377,251 , which is incorporated by reference in its entirety.
  • Fc region means the constant region of an antibody, which in humans may be of the lgG1 , 2, 3, 4 subclass or others.
  • the sequences of human Fc regions are available at IMGT, Human IGH C-REGIONs, http://www.imgt.org/IMGTrepertoire/Proteins
  • RefmAb33 is an antibody whose amino acid sequence is as follows:
  • RefmAb33 is specific for RSV, and is used as isotype control, as it shares the same Fc region as MOR208.
  • a “combination” means more than one item, e.g. a compound such as an antibody and fludarabine.
  • the present disclosure also relates to combinations, pharmaceuticals, and pharmaceutical compositions containing the described combinations.
  • the two components of the synergistic combination of the present invention e.g. the antibody specific for CD19 and fludarabine
  • the two components may be administered together, simultaneously or separately.
  • the two components may be formulated together in one pharmaceutical composition, which may include a pharmaceutical acceptable carrier or excipient.
  • the two components might also be formulated in different pharmaceutical compositions. In this case the two components can be administered simultaneously or subsequently.
  • fludarabine is administered prior to and/or separately from the administration of the antibody specific for CD19, e.g. MOR208.
  • a pharmaceutical composition includes an active agent, eg. an antibody for therapeutic use in humans.
  • a pharmaceutical composition may include acceptable carriers or excipients.
  • "Administered” or “administration” includes but is not limited to delivery by an injectable form, such as, for example, an intravenous, intramuscular, intradermal or subcutaneous route or mucosal route, for example, as a nasal spray or aerosol for inhalation or as an ingestable solution, capsule or tablet.
  • a “therapeutically effective amount” of a compound or combination refers to an amount sufficient to cure, alleviate or partially arrest the clinical manifestations of a given disease or disorder and its complications.
  • the amount that is effective for a particular therapeutic purpose will depend on the severity of the disease or injury as well as on the weight and general state of the subject. It will be understood that determination of an appropriate dosage may be achieved, using routine experimentation, by constructing a matrix of values and testing different points in the matrix, all of which is within the ordinary skills of a trained physician or clinical scientist.
  • CDRs herein are defined by either Chothia et al or Kabat et al. See Chothia C, Lesk AM. (1987) Canonical structures for the hypervariable regions of immunoglobulins. J Mol Biol., 196(4):901 -17, which is incorporated by reference in its entirety. See Kabat E.A, Wu T.T., Perry H.M., Gottesman K.S. and Foeller C. (1991 ). Sequences of Proteins of Immunological Interest. 5th edit., NIH Publication no. 91 -3242, US Dept. of Health and Human Services, Washington, DC, which is incorporated by reference in its entirety.
  • Cross competes means the ability of an antibody or other binding agent to interfere with the binding of other antibodies or binding agents to CD19 in a standard competitive binding assay. The ability or extent to which an antibody or other binding agent is able to interfere with the binding of another antibody or binding molecule to CD19, and, therefore whether it can be said to
  • cross-compete according to the invention can be determined using standard competition binding assays.
  • One suitable assay involves the use of the Biacore technology (e.g. by using the BIAcore 3000 instrument (Biacore, Uppsala, Sweden)), which can measure the extent of interactions using surface plasmon resonance technology.
  • Another assay for measuring cross-competing uses an ELISA-based approach.
  • a high throughput process for "epitope binning" antibodies based upon their cross-competition is described in International Patent Application No. WO 2003/48731
  • epitope includes any protein determinant capable of specific binding to an antibody or otherwise interacting with a molecule.
  • Epitopic determinants generally consist of chemically active surface groupings of molecules such as amino acids or carbohydrate or sugar side chains and can have specific three-dimensional structural characteristics, as well as specific charge characteristics.
  • An epitope may be "linear” or “conformational.”
  • linear epitope refers to an epitope with all of the points of interaction between the protein and the interacting molecule (such as an antibody) occur linearally along the primary amino acid sequence of the protein (continuous).
  • formational epitope refers to an epitope in which discontinuous amino acids that come together in three dimensional conformation. In a conformational epitope, the points of interaction occur across amino acid residues on the protein that are separated from one another.
  • “Binds the same epitope as” means the ability of an antibody or other binding agent to bind to CD19 and having the same epitope as the exemplified antibody.
  • the epitopes of the exemplified antibody and other antibodies to CD19 can be determined using standard epitope mapping techniques.
  • Epitope mapping techniques well known in the art. include Epitope Mapping Protocols in Methods in Molecular Biology, Vol. 66 (Glenn E.Morris, Ed., 1996) Humana Press, Totowa, New Jersey.
  • linear epitopes may be determined by e.g., concurrently synthesizing large numbers of peptides on solid supports, the peptides corresponding to portions of the protein molecule, and reacting the peptides with antibodies while the peptides are still attached to the supports.
  • Such techniques are known in the art and described in, e.g., U.S. Patent No. 4,708,871 ; Geysen et al, (1984) Proc. Natl. Acad. Sci. USA 8:3998-4002; Geysen et al, (1985) Proc. Natl. Acad. Sci. USA 82:78-182; Geysen et al, (1986) Mol. Immunol.
  • conformational epitopes are readily identified by determining spatial conformation of amino acids such as by, e.g., hydrogen/deuterium exchange, x-ray crystallography and two-dimensional nuclear magnetic resonance. See, e.g., Epitope Mapping Protocols, supra.
  • Antigenic regions of proteins can also be identified using standard antigenicity and hydropathy plots, such as those calculated using, e.g., the Omiga version 1.0 software program available from the Oxford Molecular Group. This computer program employs the Hopp/Woods method, Hopp et al, (1981 ) Proc. Natl. Acad. Sci USA
  • An aspect of the present disclosure comprises a combination of an antibody specific for CD19 and a purine analog for use in the treatment of non-Hodgkin's lymphoma, chronic lymphocytic leukemia and/or acute lymphoblastic leukemia.
  • the combination is synergistic.
  • the combination of the exemplified anti-CD19 antibody and fludarabine behaved synergistically in in vitro and in vivo models relevant to NHL and CLL.
  • NHL and CLL are B cell related disorders and CD19 is highly expressed on B-cells
  • the exemplified combination should have the same mechanism of action and should also behave synergistically in the treatment of other B cell related disorders, e.g. ALL. Therefore, the combination of the exemplified antibody specific for CD19 and fludarabine will be effective in the treatment of humans in non-Hodgkin's lymphoma, chronic lymphocytic leukemia and/or acute lymphoblastic leukemia.
  • fludarabine and other purine analogs are similar, in that purine analogs interfere with the synthesis of nucleic acids, it is believed that synergy should also be seen when treating humans having non-Hodgkin's lymphoma, chronic lymphocytic leukemia and/or acute lymphoblastic leukemia with a combination of the exemplified anti-CD19 antibody and a purine analog other than fludarabine, e.g., mercaptopurine, azathioprine, and thioguanine.
  • a purine analog other than fludarabine e.g., mercaptopurine, azathioprine, and thioguanine.
  • anti-CD19 antibody and other anti-CD19 antibodies bind to the CD19 antigen
  • synergy should also be seen when treating humans having non-Hodgkin's lymphoma, chronic lymphocytic leukemia and/or acute lymphoblastic leukemia with a combination of any anti-CD19 antibody and a purine analog
  • the anti-CD19 antibody is, for example, described in US patent application serial number 12/377,251 (Xencor), WO2005012493, WO2010053716 (Immunomedics); WO2007002223 (Medarex); WO2008022152 (Xencor); WO2008031056 (Medimmune); WO 2007/076950 (Merck Patent GmbH); WO 2009/052431 (Seattle Genetics); and WO2010095031 (Glenmark Pharmaceuticals), all of which are incorporated by reference in their entireties.
  • the antibody specific for CD19 comprises an antibody that cross-competes with the antibody comprising an HCDR1 region of sequence SYVMH (SEQ ID NO: 1 ), an HCDR2 region of sequence NPYNDG (SEQ ID NO: 2), an HCDR3 region of sequence GTYYYGTRVFDY (SEQ ID NO: 3), an LCDR1 region of sequence RSSKSLQNVNGNTYLY (SEQ ID NO: 4), an LCDR2 region of sequence RMSNLNS (SEQ ID NO: 5), and an LCDR3 region of sequence MQHLEYPIT (SEQ ID NO: 6).
  • SYVMH SEQ ID NO: 1
  • an HCDR2 region of sequence NPYNDG SEQ ID NO: 2
  • an HCDR3 region of sequence GTYYYGTRVFDY SEQ ID NO: 3
  • an LCDR1 region of sequence RSSKSLQNVNGNTYLY SEQ ID NO: 4
  • an LCDR2 region of sequence RMSNLNS SEQ ID NO: 5
  • the antibody specific for CD19 comprises an antibody that binds to the same epitope as an antibody comprising an HCDR1 region of sequence SYVMH (SEQ ID NO: 1 ), an HCDR2 region of sequence NPYNDG (SEQ ID NO: 2), an HCDR3 region of sequence
  • GTYYYGTRVFDY (SEQ ID NO: 3), an LCDR1 region of sequence RSSKSLQNVNGNTYLY (SEQ ID NO: 4), an LCDR2 region of sequence RMSNLNS (SEQ ID NO: 5), and an LCDR3 region of sequence MQHLEYPIT (SEQ ID NO: 6).
  • the antibody specific for CD19 comprises an HCDR1 region of sequence SYVMH (SEQ ID NO: 1 ), an HCDR2 region of sequence NPYNDG (SEQ ID NO: 2), an HCDR3 region of sequence GTYYYGTRVFDY (SEQ ID NO: 3), an LCDR1 region of sequence
  • RSSKSLQNVNGNTYLY SEQ ID NO: 4
  • an LCDR2 region of sequence RMSNLNS SEQ ID NO: 5
  • an LCDR3 region of sequence MQHLEYPIT SEQ ID NO: 6
  • the antibody specific for CD19 comprises a variable heavy chain of the sequence EVQLVESGGGLVKPGGSLKLSCAASGYTFTSYVMHWVRQAPGKGLEWIGYINPY NDGTKYNEKFQGRVTISSDKSISTAYMELSSLRSEDTAMYYCARGTYYYGTRVFDYWG QGTLVTVSS (SEQ ID NO: 10) and a variable light chain of the sequence
  • the antibody specific for CD19 comprises a heavy chain constant domain of the sequence
  • the antibody specific for CD19 comprises a light chain constant domain of the sequence
  • the purine analog is fludarabine.
  • the components of the combination, the antibody specific for CD19 and fludarabine are administered separately.
  • fludarabine is administered prior to administration of the antibody specific for CD19.
  • the combination is a pharmaceutical composition.
  • the composition comprises an acceptable carrier.
  • the combination is administered in an effective amount.
  • an antibody specific for CD19 comprising an HCDR1 region of sequence SYVMH (SEQ ID NO: 1 ), an HCDR2 region of sequence NPYNDG (SEQ ID NO: 2), an HCDR3 region of sequence GTYYYGTRVFDY (SEQ ID NO: 3), an LCDR1 region of sequence RSSKSLQNVNGNTYLY (SEQ ID NO: 4), an LCDR2 region of sequence RMSNLNS (SEQ ID NO: 5), and an LCDR3 region of sequence MQHLEYPIT (SEQ ID NO: 6) and fludarabine is able to mediate killing of MEC-1 cells by ADCC in the presence of isolated human PBMCs with an at least two-fold, three-fold, four-fold, or five-fold better efficacy than fludarabine alone.
  • An aspect of the present disclosure comprises a synergistic combination of an antibody specific for CD19 comprising an HCDR1 region of sequence SYVMH (SEQ ID NO: 1 ), an HCDR2 region of sequence NPYNDG (SEQ ID NO: 2), an HCDR3 region of sequence GTYYYGTRVFDY (SEQ ID NO: 3), an LCDR1 region of sequence RSSKSLQNVNGNTYLY (SEQ ID NO: 4), an LCDR2 region of sequence RMSNLNS (SEQ ID NO: 5), and an LCDR3 region of sequence MQHLEYPIT (SEQ ID NO: 6) and fludarabine for the treatment of non-Hodgkin's lymphoma, chronic lymphocytic leukemia and/or acute lymphoblastic leukemia.
  • the non-Hodgkin's lymphoma is selected from the group consisting of follicular lymphoma, small lymphocytic lymphoma, mucosa-associated lymphoid tissue, marginal zone, diffuse large B cell, Burkitt's, and mantle cell.
  • Another aspect comprises a method of treating non-Hodgkin's lymphoma, chronic lymphocytic leukemia and/or acute lymphoblastic leukemia in an individual in need thereof, which method comprises administration of an antibody specific for CD19 and a purine analog.
  • the antibody specific for CD19 comprises an HCDR1 region of sequence SYVMH (SEQ ID NO: 1 ), an HCDR2 region of sequence NPYNDG (SEQ ID NO: 2), an HCDR3 region of sequence GTYYYGTRVFDY (SEQ ID NO: 3), an LCDR1 region of sequence RSSKSLQNVNGNTYLY (SEQ ID NO: 4), an LCDR2 region of sequence RMSNLNS (SEQ ID NO: 5), and an LCDR3 region of sequence MQHLEYPIT (SEQ ID NO: 6).
  • the purine analog is fludarabine.
  • Example 1 Inhibition of proliferation of MEC-1 cells using MOR208 and fludarabine alone and in combination
  • MEC-1 cells chronic B-cell leukemia cell line DSMZ# ACC497; Cell Medium: Iscove's Modified Dulbecco's Medium (IMDM) with GlutaMAXTM, Invitrogen, Cat No.: 31980-048, 20% FCS; PBMCs: RPMI1640, with stabile Glutamine, PAN Biotech GmbH, Cat No.: P04-13500 supplemented with 10% FCS; Biocoll: Biochrome AG CAT No.: L61 15 LOT No.: 1050T; Fludarabine: Bayer, 25 mg/ml in ddH20, LOT No.: 9100ST; and RefmAb33 (anti-RSV) with same Fc region as MOR208.
  • IMDM Iscove's Modified Dulbecco's Medium
  • PBMCs RPMI1640, with stabile Glutamine, PAN Biotech GmbH, Cat No.: P04-13500 supplemented with 10% FCS
  • Biocoll Biochro
  • MOR208 The cytotoxicity of MOR208 and fludarabine alone and in combination was tested in MEC-1 cells.
  • FLU is a purine analog, therefore, functions via direct cytoxicity in MEC-1 cells.
  • MOR208 targets CD19 and additionally functions via ADCC in killing MEC-1 cells.
  • MEC-1 cell killing was measured: FLU at 18 g/ml; MOR208 at 66pm and the combination of MOR208 at 66pm and FLU at 18 g/ml. These concentrations were chosen as they are near or at the EC50 for MOR208 and FLU.
  • the MEC-1 cells were pre-incubated with FLU for 72 hours prior to the ADCC assay measurements.
  • the MEC-1 cells were stained using 1 mg/ml Calcein AM then counted and adjusted to 2X10 5 /ml.
  • the PBMCs were counted and adjusted to 6X10 6 /ml.
  • the ADCC assays were done as follows: Using 96 well plates, a 100 ⁇ cell suspension of MEC-1 cells was added per well, then 100 ⁇ cell suspension of PBMCs was added to each well resulting in an E:T ratio of 30:1.
  • the antibodies were diluted to 1 Mg/ml in medium. Cells were centrifuged and re-suspended.
  • Table 1 and Figure 1 show the raw data.
  • the values represent % dead cells.
  • Each experiment represents PBMCs from different donors.
  • the contol used for Experiments 1 and 2 was RefMab33.
  • the control used for Experiment 3, was PBMCs alone.
  • Table 2 shows the raw data of Table 1 normalized for specific killing and the results of the Chou calculations done in the determination of synergism.
  • Table 2 The values shown in Table 2 are calculated as follows: 1 ) from the raw data (% dead cells) shown in Table 1 , the background (controls) were subtracted, resulting in the specific killing for each treatment group; then 2) the specific killing values were normalized by setting the combination of MOR208 + FLU to 1. The averages of Table 2 are depicted in Figure 5.
  • Example ADCC dose response curves used in the Chou factor calculations of the MOR208 + FLU combination are shown in Figure 2.
  • Chou Index (CI) calculations were completed in order to determine synergy of the combination of the exemplified anti-CD19 antibody and fludarabine as compared to MOR208 and FLU alone. The calculations are described in Ting-Chao Chou, Theoretical Basis, Experimental Design, and Computerized Simulation of Synergism and Antagonism in Drug Combination Studies, Pharmacol Rev 58:621-681 (2006), which is incorporated by reference in its entirety and Chou TC, Talalay P, Quantitative analysis of dose-effect relationships: the combined effects of multiple drugs or enzyme inhibitors. Adv Enzyme Regul 22: 27-55 (1984), which is incorporated by reference in its entirety. The methods of Chou-Talalay are carried out using the Cl-isobol method.
  • the constant m determines the shape of the dose-effect curve.
  • the effects of the combination on MEC-1 cells is measured % cell death as described above.
  • the fraction F u to be the ratio of % cell death of the treated cell line to the % cell death of the cell line exposed to a control. That is:
  • F u % cell death(treated cell line)/ % cell death (non-treated cell line)
  • the % cell death of a cell line is the constant D50 in the median effect equation, which can be estimated by the linear regression described above.
  • the Cl-isobol method provides a quantitative assessment of synergism between drugs.
  • a combination index (CI) is estimated from dose-effect data of single and combined drug treatments.
  • Drug interaction is more pronounced the farther a CI value is from 1.
  • the combination index (CI) of a combined drug treatment is defined as
  • D1 and D2 are the doses of drug 1 and drug 2 of the combination, respectively; and Dx1 , and Dx2 is the dose of a treatment with only drug 1 and drug 2 that would give the same effect as that of the combination.
  • the doses Dx1 and Dx2 need to be estimated from the dose-effect data of single drug treatments. Essentially, a median effect equation is fitted to the data of each drug. From the median effect equation of a drug, we can estimate the dose (i.e. D) necessary to produce an effect (i.e. Fa, Fu). The further a point lies from the additive line, the bigger the different between 1 and its CI, thus the stronger the (synergistic or antagonistic) effect is.
  • the Chou index values indicate clear synergism of the combination of MOR208 and fludarabine in the specific killing of MEC-1 cells as compared to MOR208 and fludarabine alone. This conclusion is based upon the Chou calculations of 0.03, 0.3 and 0.3 in each of the three experiments, respectively, with an average of 0.21 , where a CI ⁇ 1 indicates synergism. Therefore, the combination of MOR208 and fludarabine will also behave synergistically in the treatment of non-Hodgkin's lymphoma (NHL), chronic lymphoid leukemia (CLL), and/or acute lymphoblastic leukemia (ALL) in humans.
  • NHL non-Hodgkin's lymphoma
  • CLL chronic lymphoid leukemia
  • ALL acute lymphoblastic leukemia
  • the Bonferroni's Multiple Comparison Test shows that the combination treatment of FLU + MOR208 is statistically more effective in the specific killing of MEC-1 cells than the treatment of FLU and MOR208 alone.
  • Example 2 MOR208 and FLU alone and in combination in subcutaneously (SC)-implanted human Ramos Burkitt's B-cell lymphoma tumor growth model.
  • RAMOS human Burkitt's lymphoma cells ATCC number CRL-1596, lot# 3953138; Vehicle control: 0.9% sodium chloride, 25mg/ml mannitol, pH 7.0;; SCID Mice (University of Sydney, Waite Campus, Urrbaraie, SA, Australia, Strain C.B.-17-lgh-1 b -Prkdc scid ).
  • mice Six-to-seven-week old female C.B-17 SCID mice were implanted sub-cutaneously with RAMOS cells ( ⁇ 5 x 10 6 cells/mouse). 14 days after inoculation, the mice were separated into ten groups of eight, where each group had tumor volumes of relatively the same size. Treatment began on Day 14. The treatment regimens are provided in Table 4. The study duration was 63 days.
  • MOR208, fludarabine, and the vehicle were administered in a volume of 0.1 mL/10 g of body weight.
  • the initial readout was tumor growth, specifically tumor volume at study day 38.
  • Tumor weights were calculated using the equation (I x w2)/2, where I and w refer to the larger and smaller dimensions collected at each measurement. The results are shown in Table 5 and the averages are depicted in Figure 6.
  • Both of the endpoints are a measure of inhibition of tumor growth and in both endpoints, reduced tumor growth (%) at study day 38 and increased time (%) to 4000mg, the combination of MOR208 + FLU125 showed clear synergism in comparision to MOR208 and FLU alone.
  • MOR208 and fludarabine will also behave synergistically in the treatment of non-Hodgkin's lymphoma (NHL), chronic lymphoid leukemia (CLL), and acute lymphoblastic leukemia (ALL) in humans.
  • NHL non-Hodgkin's lymphoma
  • CLL chronic lymphoid leukemia
  • ALL acute lymphoblastic leukemia
  • Cyclophosphamide (Fluka, Buchs Switzerland, Lot. No. 07551661 ); Vehicle Control: 0.9% sodium chloride, 25mg/ml mannitol, pH 7.0; SCID Mice (University of Sydney, Waite Campus, Urrbaraie, SA, Australia, Strain C.B.-17-lgh-1 b -Prkdc scid ); RAMOS human lymphoma cells (ATCC number CRL-2638).
  • SCID mice were pre-treated with Cyclophosphamide (18 mg/kg, i.p., twice daily) for two days prior to RAMOS cell inoculation (Day -5 and -4).
  • Cyclophosphamide 18 mg/kg, i.p., twice daily
  • Day -3 the mice were separated into ten groups of eight mice each, and inoculated with 1 x 10 6 RAMOS cells each intravenously into the tail vein.
  • the dosing regimen for each group is shown in Table 9 and commenced on Day 0. The study duration was three weeks. Table 9: Dosing regimen
  • the readout was median survival time in days.
  • the methods of Clark et al. were used.
  • Table 10 shows that the combination of MOR208 and Fludarabine 125 mg/kg synergistically increased the median survival time in the Burkitt's lymphoma SCID mouse model as compared to both MOR208 and Fludarabine alone. This increase of median survival time of the combination of MOR208 and Fludarabine 125 mg/kg in vivo was confirmed to be statistically significant as compared to both MOR208 and Fludarabine alone, as shown in Table 1 1 . Therefore, the combination of MOR208 and fludarabine will also behave synergistically in the treatment of non-Hodgkin's lymphoma (NHL), chronic lymphoid leukemia (CLL), and acute lymphoblastic leukemia (ALL) in humans.
  • NHL non-Hodgkin's lymphoma
  • CLL chronic lymphoid leukemia
  • ALL acute lymphoblastic leukemia

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Immunology (AREA)
  • General Health & Medical Sciences (AREA)
  • Organic Chemistry (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Molecular Biology (AREA)
  • Epidemiology (AREA)
  • Genetics & Genomics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biophysics (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Biochemistry (AREA)
  • Hematology (AREA)
  • Oncology (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Microbiology (AREA)
  • Mycology (AREA)
  • Endocrinology (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Peptides Or Proteins (AREA)
PCT/EP2012/065904 2011-08-16 2012-08-14 Combination therapy with an anti - cd19 antibody and a purine analog Ceased WO2013024095A1 (en)

Priority Applications (26)

Application Number Priority Date Filing Date Title
CN201280036572.4A CN103703027B (zh) 2011-08-16 2012-08-14 使用抗cd‑19抗体和嘌呤类似物的联合治疗
JP2014525432A JP6114273B2 (ja) 2011-08-16 2012-08-14 抗−cd19抗体とプリン類似体の併用治療
AU2012296905A AU2012296905B2 (en) 2011-08-16 2012-08-14 Combination therapy with an anti - CD19 antibody and a purine analog
US14/127,217 US20140227277A1 (en) 2011-08-16 2012-08-14 Combination therapy with an anti-CD19 antibody and a purine analog
RU2014103490A RU2664462C9 (ru) 2011-08-16 2012-08-14 Комбинированная терапия с помощью антитела к CD19 и аналога пурина
BR112013033916-0A BR112013033916B1 (pt) 2011-08-16 2012-08-14 Uso de um anticorpo específico para cd19
DK12745883.4T DK2744826T3 (da) 2011-08-16 2012-08-14 Kombinationsterapi med et anti-cd19-antistof og en purin-analog
MX2013014935A MX353589B (es) 2011-08-16 2012-08-14 Terapia de combinacion con un anticuerpo anti-cd19 y un analogo de purina.
RS20220314A RS63121B1 (sr) 2011-08-16 2012-08-14 Kombinovana terapija sa anti-cd19 antitelom i analogom purina
PL12745883T PL2744826T3 (pl) 2011-08-16 2012-08-14 Terapia skojarzona przeciwciałem anty-cd19 i analogiem puryny
LTEPPCT/EP2012/065904T LT2744826T (lt) 2011-08-16 2012-08-14 Kombinuota terapija su anti-cd19 antikūnu ir purino analogu
ES12745883T ES2909720T3 (es) 2011-08-16 2012-08-14 Terapia de combinación con un anticuerpo anti-CD19 y un análogo de purina
SI201231992T SI2744826T1 (sl) 2011-08-16 2012-08-14 Kombinirana terapija s protitelesom proti CD19 in analogom purina
KR1020147006942A KR20140071368A (ko) 2011-08-16 2012-08-14 항cd19 항체 및 퓨린 유사체를 이용한 병용 요법
KR1020207014644A KR20200060779A (ko) 2011-08-16 2012-08-14 항cd19 항체 및 퓨린 유사체를 이용한 병용 요법
NZ617771A NZ617771B2 (en) 2011-08-16 2012-08-14 Combination therapy with an anti - cd19 antibody and a purine analog
EP12745883.4A EP2744826B1 (en) 2011-08-16 2012-08-14 Combination therapy with an anti-cd19 antibody and a purine analog
SM20220160T SMT202200160T1 (it) 2011-08-16 2012-08-14 Terapia in combinazione con un anticorpo anti-cd19 e un analogo delle purine
HRP20220224TT HRP20220224T1 (hr) 2011-08-16 2012-08-14 Kombinacijska terapija s protutijelom anti-cd19 i dušičnim alkilirajućim agensom
KR1020197022418A KR102117202B1 (ko) 2011-08-16 2012-08-14 항cd19 항체 및 퓨린 유사체를 이용한 병용 요법
EP22155604.6A EP4083071A3 (en) 2011-08-16 2012-08-14 Combination therapy with an anti-cd19 antibody and a purine analog
CA2841738A CA2841738C (en) 2011-08-16 2012-08-14 Combination therapy with an anti-cd19 antibody and a purine analog
IL230295A IL230295B (en) 2011-08-16 2014-01-02 Combined treatment with an anti-19cd antibody and a furin analog
ZA2014/01835A ZA201401835B (en) 2011-08-16 2014-03-12 Combination therapy with an anti-cd19 antibody and a purine analog
US16/839,903 US20200352975A1 (en) 2011-08-16 2020-04-03 Combinations and uses thereof
US18/581,959 US20240424012A1 (en) 2011-08-16 2024-02-20 Combinations and uses thereof

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US201161523862P 2011-08-16 2011-08-16
EP11177660.5 2011-08-16
EP11177660 2011-08-16
US61/523,862 2011-08-16

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US14/127,217 A-371-Of-International US20140227277A1 (en) 2011-08-16 2012-08-14 Combination therapy with an anti-CD19 antibody and a purine analog
US16/839,903 Continuation US20200352975A1 (en) 2011-08-16 2020-04-03 Combinations and uses thereof

Publications (1)

Publication Number Publication Date
WO2013024095A1 true WO2013024095A1 (en) 2013-02-21

Family

ID=47714800

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2012/065904 Ceased WO2013024095A1 (en) 2011-08-16 2012-08-14 Combination therapy with an anti - cd19 antibody and a purine analog

Country Status (25)

Country Link
US (3) US20140227277A1 (https=)
EP (2) EP4083071A3 (https=)
JP (1) JP6114273B2 (https=)
KR (3) KR20200060779A (https=)
CN (1) CN103703027B (https=)
AU (1) AU2012296905B2 (https=)
BR (1) BR112013033916B1 (https=)
CA (1) CA2841738C (https=)
CY (1) CY1125148T1 (https=)
DK (1) DK2744826T3 (https=)
ES (1) ES2909720T3 (https=)
HR (1) HRP20220224T1 (https=)
HU (1) HUE058855T2 (https=)
IL (1) IL230295B (https=)
LT (1) LT2744826T (https=)
MX (1) MX353589B (https=)
PL (1) PL2744826T3 (https=)
PT (1) PT2744826T (https=)
RS (1) RS63121B1 (https=)
RU (1) RU2664462C9 (https=)
SG (1) SG10201606788VA (https=)
SI (1) SI2744826T1 (https=)
SM (1) SMT202200160T1 (https=)
WO (1) WO2013024095A1 (https=)
ZA (1) ZA201401835B (https=)

Cited By (10)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
ES2523901A1 (es) * 2013-05-31 2014-12-02 Universidad Autónoma de Madrid Uso de la deguelina como terapia suplementaria de la leucemia linfoide crónica
WO2016189014A1 (en) 2015-05-26 2016-12-01 Morphosys Ag Combination of an anti-cd19 antibody and a bruton's tyrosine kinase inhibitor and uses thereof
WO2017032679A1 (en) 2015-08-21 2017-03-02 Morphosys Ag Combinations and uses thereof
JP2017519757A (ja) * 2014-06-16 2017-07-20 ゼンコー・インコーポレイテッドXencor、 Inc. 慢性リンパ球性白血病(cll)の処置
WO2018078123A1 (en) 2016-10-28 2018-05-03 Morphosys Ag Combination of anti cd19 antibody with a bcl-2 inhibitor and uses thereof
WO2018220040A1 (en) 2017-05-31 2018-12-06 Morphosys Ag Treatment paradigm for an anti-cd19 antibody and venetoclax combination treatment
WO2019011918A1 (en) 2017-07-10 2019-01-17 International - Drug - Development - Biotech TREATMENT OF LYMPHOCYTE B MALIGNANCIES USING AFUCOSYLATED PRO-APOPTOTIC ANTI-CD19 ANTIBODIES IN COMBINATION WITH ANTI-CD20 ANTIBODIES OR CHEMOTHERAPEUTIC AGENTS
JP2020055830A (ja) * 2014-06-16 2020-04-09 ゼンコー・インコーポレイテッドXencor、 Inc. 慢性リンパ球性白血病(cll)の処置
RU2802812C2 (ru) * 2017-05-31 2023-09-04 МорфоСис АГ Лечебный подход, предназначенный для лечения комбинацией антитела к CD19 и венетоклакса
US12491244B2 (en) 2018-09-12 2025-12-09 GC Cell Corporation Pharmaceutical combinations for treating tumor comprising anti-CD19 antibody and natural killer cell

Families Citing this family (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
GB2514591A (en) * 2013-05-30 2014-12-03 Mologen Ag Predictive biomarker for cancer therapy
RS62155B1 (sr) * 2016-05-30 2021-08-31 Morphosys Ag Postupci predviđanja terapijske koristi anti-cd19 terapije kod pacijenata
WO2020150513A1 (en) * 2019-01-17 2020-07-23 Fred Hutchinson Cancer Research Center Methods to enhance the selectivity and effectiveness of cancer treatments
TW202334231A (zh) * 2021-12-22 2023-09-01 德商莫菲西斯公司 抗cd19抗體療法的治療範例
CN121729431A (zh) 2023-07-13 2026-03-24 克里斯蒂安-阿尔伯特基尔大学 人源化抗cd7抗体

Citations (19)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11852A (en) 1854-10-31 Abraham bassford
US106A (en) 1915-08-24 Specipication
US4708871A (en) 1983-03-08 1987-11-24 Commonwealth Serum Laboratories Commission Antigenically active amino acid sequences
US5686072A (en) 1992-06-17 1997-11-11 Board Of Regents, The University Of Texas Epitope-specific monoclonal antibodies and immunotoxins and uses thereof
WO2000074718A1 (en) 1999-06-09 2000-12-14 Immunomedics, Inc. Immunotherapy of autoimmune disorders using antibodies which target b-cells
WO2002022212A2 (en) 2000-09-18 2002-03-21 Idec Pharmaceuticals Corporation Combination therapy for treatment of autoimmune diseases using b cell depleting/immunoregulatory antibody combination
WO2003048731A2 (en) 2001-12-03 2003-06-12 Abgenix, Inc. Antibody categorization based on binding characteristics
WO2005012493A2 (en) 2003-07-31 2005-02-10 Immunomedics, Inc. Anti-cd19 antibodies
WO2007002223A2 (en) 2005-06-20 2007-01-04 Medarex, Inc. Cd19 antibodies and their uses
WO2007064911A1 (en) * 2005-12-02 2007-06-07 Biogen Idec Inc. Anti-mouse cd20 antibodies and uses thereof
WO2007076950A1 (en) 2005-12-30 2007-07-12 Merck Patent Gmbh Anti-cd19 antibodies with reduced immunogenicity
WO2008022152A2 (en) 2006-08-14 2008-02-21 Xencor, Inc. Optimized antibodies that target cd19
WO2008031056A2 (en) 2006-09-08 2008-03-13 Medimmune, Llc Humanized anti-cd19 antibodies and their use in treatment of oncology, transplantation and autoimmune disease
WO2008150494A1 (en) 2007-05-30 2008-12-11 Xencor, Inc. Methods and compositions for inhibiting cd32b expressing cells
WO2009052431A2 (en) 2007-10-19 2009-04-23 Seattle Genetics, Inc. Cd19 binding agents and uses thereof
WO2010053716A1 (en) 2008-11-07 2010-05-14 Immunomedics, Inc. Improved anti-cd19 antibodies
WO2010095031A2 (en) 2009-02-23 2010-08-26 Glenmark Pharmaceuticals S.A. Humanized antibodies that bind to cd19 and their uses
WO2010151341A1 (en) 2009-06-24 2010-12-29 The Feinstein Institute For Medical Research Method for treating chronic lymphocytic leukemia
US20110104150A1 (en) 2005-02-15 2011-05-05 Duke University Anti-cd19 antibodies and uses in b cell disorders

Family Cites Families (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CA2340091C (en) * 1998-08-11 2013-02-05 Idec Pharmaceuticals Corporation Combination therapies for b-cell lymphomas comprising administration of anti-cd20 antibody
US20080260731A1 (en) * 2002-03-01 2008-10-23 Bernett Matthew J Optimized antibodies that target cd19
TWI409079B (zh) * 2009-08-14 2013-09-21 Roche Glycart Ag 非典型岩藻醣化cd20抗體與苯達莫斯汀(bendamustine)之組合療法
KR20120054069A (ko) * 2009-08-14 2012-05-29 로슈 글리카트 아게 플루다라빈 및/또는 미토잔트론과 어푸코실화된 cd20 항체의 복합 요법
CA2779424A1 (en) * 2009-11-06 2011-05-12 Infinity Pharmaceuticals, Inc. Oral formulations of a hedgehog pathway inhibitor

Patent Citations (22)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US106A (en) 1915-08-24 Specipication
US11852A (en) 1854-10-31 Abraham bassford
US4708871A (en) 1983-03-08 1987-11-24 Commonwealth Serum Laboratories Commission Antigenically active amino acid sequences
US5686072A (en) 1992-06-17 1997-11-11 Board Of Regents, The University Of Texas Epitope-specific monoclonal antibodies and immunotoxins and uses thereof
WO2000074718A1 (en) 1999-06-09 2000-12-14 Immunomedics, Inc. Immunotherapy of autoimmune disorders using antibodies which target b-cells
WO2002022212A2 (en) 2000-09-18 2002-03-21 Idec Pharmaceuticals Corporation Combination therapy for treatment of autoimmune diseases using b cell depleting/immunoregulatory antibody combination
WO2003048731A2 (en) 2001-12-03 2003-06-12 Abgenix, Inc. Antibody categorization based on binding characteristics
WO2005012493A2 (en) 2003-07-31 2005-02-10 Immunomedics, Inc. Anti-cd19 antibodies
US7109304B2 (en) 2003-07-31 2006-09-19 Immunomedics, Inc. Humanized anti-CD19 antibodies
US20110104150A1 (en) 2005-02-15 2011-05-05 Duke University Anti-cd19 antibodies and uses in b cell disorders
WO2007002223A2 (en) 2005-06-20 2007-01-04 Medarex, Inc. Cd19 antibodies and their uses
US8097703B2 (en) 2005-06-20 2012-01-17 Medarex, Inc. CD19 antibodies and their uses
WO2007064911A1 (en) * 2005-12-02 2007-06-07 Biogen Idec Inc. Anti-mouse cd20 antibodies and uses thereof
WO2007076950A1 (en) 2005-12-30 2007-07-12 Merck Patent Gmbh Anti-cd19 antibodies with reduced immunogenicity
WO2008022152A2 (en) 2006-08-14 2008-02-21 Xencor, Inc. Optimized antibodies that target cd19
WO2008031056A2 (en) 2006-09-08 2008-03-13 Medimmune, Llc Humanized anti-cd19 antibodies and their use in treatment of oncology, transplantation and autoimmune disease
WO2008150494A1 (en) 2007-05-30 2008-12-11 Xencor, Inc. Methods and compositions for inhibiting cd32b expressing cells
WO2009052431A2 (en) 2007-10-19 2009-04-23 Seattle Genetics, Inc. Cd19 binding agents and uses thereof
US7968687B2 (en) 2007-10-19 2011-06-28 Seattle Genetics, Inc. CD19 binding agents and uses thereof
WO2010053716A1 (en) 2008-11-07 2010-05-14 Immunomedics, Inc. Improved anti-cd19 antibodies
WO2010095031A2 (en) 2009-02-23 2010-08-26 Glenmark Pharmaceuticals S.A. Humanized antibodies that bind to cd19 and their uses
WO2010151341A1 (en) 2009-06-24 2010-12-29 The Feinstein Institute For Medical Research Method for treating chronic lymphocytic leukemia

Non-Patent Citations (35)

* Cited by examiner, † Cited by third party
Title
"Epitope Mapping Protocols in Methods in Molecular Biology", vol. 66, 1996, HUMANA PRESS
ANDERSON ET AL., BLOOD, vol. 63, 1984, pages 1424 - 1433
BREAST CANCER RESEARCH AND TREATMENT, vol. 46, 1997, pages 255 - 278
CHOTHIA C; LESK AM: "Canonical structures for the hypervariable regions of immunoglobulins", J MOL BIOL., vol. 196, no. 4, 1987, pages 901 - 17, XP024010426, DOI: doi:10.1016/0022-2836(87)90412-8
CHOU TC; TALALAY P: "Quantitative analysis of dose-effect relationships: the combined effects of multiple drugs or enzyme inhibitors", ADV ENZYME REGUL, vol. 22, 1984, pages 27 - 55, XP023796270, DOI: doi:10.1016/0065-2571(84)90007-4
CHOU; CLARKE ET AL.: "Webb et al. See Ting-Chao Chou, Theoretical Basis, Experimental Design, and Computerized Simulation of Synergism and Antagonism in Drug Combination Studies", PHARMACOL REV, vol. 58, 2006, pages 621 - 681
CLARKE ET AL.: "Issues in experimental design and endpoint analysis in the study of experimental cytotoxic agents in vivo in breast cancer and other models", BREAST CANCER RESEARCH AND TREATMENT, vol. 46, 1997, pages 255 - 278
ESHHAR ET AL., PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES OF USA, NATIONAL ACADEMY OF SCIENCE, WASHINGTON, D.C, vol. 90, no. 2, 15 January 1993 (1993-01-15)
ESHHAR Z ET AL: "Specific activation and targeting of cytotoxic lymphocytes through chimeric single chains consisting of antibody-binding domains and the gamma or zeta subunits of the immunoglobulin and T-cell receptors", PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES OF USA, NATIONAL ACADEMY OF SCIENCE, WASHINGTON, DC; US, vol. 90, no. 2, 15 January 1993 (1993-01-15), pages 720 - 724, XP002579936, ISSN: 0027-8424, DOI: 10.1073/PNAS.90.2.720 *
GEYSEN ET AL., MOL. IMMUNOL., vol. 23, 1986, pages 709 - 715
GEYSEN ET AL., PROC. NATL. ACAD. SCI. USA, vol. 8, 1984, pages 3998 - 4002
GEYSEN ET AL., PROC. NATL. ACAD. SCI. USA, vol. 82, 1985, pages 78 - 182
GROSSBARD ET AL., BR. J. HAEMATOL, vol. 102, 1998, pages 509 - 15
HOPP ET AL., PROC. NATL. ACAD. SCI USA, vol. 78, 1981, pages 3824 - 3828
IMGT, HUMAN IGH C-REGIONS, 16 May 2011 (2011-05-16), Retrieved from the Internet <URL:http://www.imgt.org/IMGTrepertoire/Proteins /protein/human/IGH/IGHC/Hu_IGHCallgenes.html>
JAMES ET AL.: "Antibody-mediated B-cell depletion before adoptive immunotherapy with T cells expressing CD20-specific chimeric T-cell receptors facilitates eradication of leukemia in immunocompetent mice", BLOOD, vol. 114, no. 27, 30 October 2009 (2009-10-30), pages 5454 - 63
KABAT E.A; WU T.T.; PERRY H.M.; GOTTESMAN K.S.; FOELLER C: "Sequences of Proteins of Immunological Interest", 1991, US DEPT. OF HEALTH AND HUMAN SERVICES
KOCHENDERFER ET AL.: "Eradication of B lineage cell and regression of lymphoma in a patient treated with autologous T cells genetically engineered to recognize CD19", BLOOD, vol. 116, no. 20, November 2010 (2010-11-01)
KOCHENDERFER JAMES N ET AL: "Eradication of B-lineage cells and regression of lymphoma in a patient treated with autologous T cells genetically engineered to recognize CD19", BLOOD, vol. 116, no. 20, November 2010 (2010-11-01), pages 4099 - 4102, XP002667047 *
KYTE ET AL., J.MO. BIOL., vol. 157, 1982, pages 105 - 132
LOKEN ET AL., BLOOD, vol. 70, 1987, pages 1316 - 1324
MONTSERRAT E ET AL: "Chronic lymphocytic leukaemia treatment", BLOOD REVIEWS, CHURCHILL LIVINGSTONE, vol. 7, no. 3, 1 September 1993 (1993-09-01), pages 164 - 175, XP022954383, ISSN: 0268-960X, [retrieved on 19930901], DOI: 10.1016/0268-960X(93)90003-M *
MONTSERRAT ET AL.: "Chronic lymphocytic leukemia treatment", BLOOD REVIEW, CHURCHILL LIVINGSTONE, vol. 7, no. 3, 1 September 1993 (1993-09-01)
NADLER ET AL., J. IMMUNOL., vol. 131, 1983, pages 244 - 250
ROSENBERG ET AL., TREATMENT OF B CELL MALIGNANCIES WITH T CELLS EXPRESSING AN ANTI-CD19 CHIMERIC RECEPTOR: ASSESSMENT OF THE IMPACT OF LYMPHOCYTE DEPLETION PRIOR TO T CELL TRANSFER, September 2008 (2008-09-01), Retrieved from the Internet <URL:www.gemcris.od.nih.gov/ Abstracts/940_s.pdf>
ROSENBERG SA: "Treatment of B Cell Malignancies with T Cells Expressing an Anti-CD19 ChimericReceptor: Assessment of the Impact of Lymphocyte Depletion Prior to T CellTransfer", September 2008 (2008-09-01), XP002667046, Retrieved from the Internet <URL:http://www.gemcris.od.nih.gov/Abstracts/940_s.pdf> [retrieved on 20120113] *
SADELAIN ET AL.: "Current Opinion in Immunology", vol. 21, 2 April 2009, ELSEVIER, article "The promise and potential pitfalls of chimeric antigen receptors"
SADELAIN MICHEL ET AL: "The promise and potential pitfalls of chimeric antigen receptors", CURRENT OPINION IN IMMUNOLOGY, vol. 21, no. 2, April 2009 (2009-04-01), pages 215 - 223, XP002667114, ISSN: 0952-7915 *
SCHEUERMANN ET AL.: "CD19 Antigen in Leukemia and Lymphoma Diagnosis and Immunotherapy", LEUKEMIA AND LYMPHOMA, vol. 18, 1995, pages 385 - 397, XP009155469, DOI: doi:10.3109/10428199509059636
SCHEUERMANN R H ET AL: "CD19 antigen in leukemia and lymphoma diagnosis and immunotherapy.", LEUKEMIA & LYMPHOMA AUG 1995 LNKD- PUBMED:8528044, vol. 18, no. 5-6, August 1995 (1995-08-01), pages 385 - 397, XP009155469, ISSN: 1042-8194 *
SCHEUERMANN; LEUK, LYMPHOMA, vol. 18, 1995, pages 385 - 397
TING-CHAO CHOU: "Theoretical Basis, Experimental Design, and Computerized Simulation of Synergism and Antagonism in Drug Combination Studies", PHARMACOL REV, vol. 58, 2006, pages 621 - 681, XP055151376, DOI: doi:10.1124/pr.58.3.10
TREON ET AL., SEMIN. ONCOL, vol. 30, 2003, pages 248 - 52
UCKUN ET AL., BLOOD, vol. 71, 1988, pages 13 - 29
WEBB, J. L.: "Enzyme and Metabolic Inhibitors", 1963, ACADEMIC PRESS

Cited By (29)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
ES2523901A1 (es) * 2013-05-31 2014-12-02 Universidad Autónoma de Madrid Uso de la deguelina como terapia suplementaria de la leucemia linfoide crónica
JP2017519757A (ja) * 2014-06-16 2017-07-20 ゼンコー・インコーポレイテッドXencor、 Inc. 慢性リンパ球性白血病(cll)の処置
JP2020055830A (ja) * 2014-06-16 2020-04-09 ゼンコー・インコーポレイテッドXencor、 Inc. 慢性リンパ球性白血病(cll)の処置
RU2756010C2 (ru) * 2015-05-26 2021-09-24 МорфоСис АГ Комбинация антитела к CD19 и ингибитора тирозинкиназы брутона и их применение
WO2016189014A1 (en) 2015-05-26 2016-12-01 Morphosys Ag Combination of an anti-cd19 antibody and a bruton's tyrosine kinase inhibitor and uses thereof
EP3603672A1 (en) 2015-05-26 2020-02-05 MorphoSys AG Combination of an anti-cd19 antibody and a bruton's tyrosine kinase inhibitor and uses thereof
US10617691B2 (en) 2015-05-26 2020-04-14 Morphosys Ag Combination of an anti-CD19 antibody and a Bruton's tyrosine kinase inhibitor and uses thereof
WO2017032679A1 (en) 2015-08-21 2017-03-02 Morphosys Ag Combinations and uses thereof
US12194095B2 (en) 2015-08-21 2025-01-14 Incyte Corporation Combinations and uses thereof
RU2767063C2 (ru) * 2015-08-21 2022-03-16 МорфоСис АГ Комбинации и их использование
EP3954388A1 (en) 2015-08-21 2022-02-16 MorphoSys AG Combinations and uses thereof
US11224654B2 (en) 2015-08-21 2022-01-18 Morphosys Ag Combinations and uses thereof
EP3903821A1 (en) 2016-10-28 2021-11-03 MorphoSys AG Combination of anti cd19 antibody with a bcl-2 inhibitor and uses thereof
AU2017348624B2 (en) * 2016-10-28 2024-09-26 Incyte Corporation Combination of anti CD19 antibody with a BCL-2 inhibitor and uses thereof
JP2019533682A (ja) * 2016-10-28 2019-11-21 モルフォシス・アーゲー 抗cd19抗体とbcl−2阻害剤との組み合わせおよびその使用
KR20190075942A (ko) * 2016-10-28 2019-07-01 모르포시스 아게 항-cd19 항체 및 bcl-2 억제제의 조합 및 이의 용도
IL301786B2 (en) * 2016-10-28 2025-09-01 Morphosys Ag Combination of anti-CD19 antibody with BCL-2 inhibitor and their uses
RU2756405C2 (ru) * 2016-10-28 2021-09-30 МорфоСис АГ Комбинация антитела CD19 с ингибитором BCL-2 и пути ее применения
JP7094950B2 (ja) 2016-10-28 2022-07-04 モルフォシス・アーゲー 抗cd19抗体とbcl-2阻害剤との組み合わせおよびその使用
KR102500868B1 (ko) 2016-10-28 2023-02-16 모르포시스 아게 항-cd19 항체 및 bcl-2 억제제의 조합 및 이의 용도
US12358983B2 (en) 2016-10-28 2025-07-15 Incyte Corporation Combination of anti CD19 antibody with a BCL-2 inhibitor and uses thereof
IL301786B1 (en) * 2016-10-28 2025-05-01 Morphosys Ag Combination of anti-CD19 antibody with BCL-2 inhibitor and their uses
WO2018078123A1 (en) 2016-10-28 2018-05-03 Morphosys Ag Combination of anti cd19 antibody with a bcl-2 inhibitor and uses thereof
WO2018220040A1 (en) 2017-05-31 2018-12-06 Morphosys Ag Treatment paradigm for an anti-cd19 antibody and venetoclax combination treatment
EP4268900A3 (en) * 2017-05-31 2024-03-06 MorphoSys AG Treatment paradigm for an anti-cd19 antibody and venetoclax combination treatment
EP4268900A2 (en) 2017-05-31 2023-11-01 MorphoSys AG Treatment paradigm for an anti-cd19 antibody and venetoclax combination treatment
RU2802812C2 (ru) * 2017-05-31 2023-09-04 МорфоСис АГ Лечебный подход, предназначенный для лечения комбинацией антитела к CD19 и венетоклакса
WO2019011918A1 (en) 2017-07-10 2019-01-17 International - Drug - Development - Biotech TREATMENT OF LYMPHOCYTE B MALIGNANCIES USING AFUCOSYLATED PRO-APOPTOTIC ANTI-CD19 ANTIBODIES IN COMBINATION WITH ANTI-CD20 ANTIBODIES OR CHEMOTHERAPEUTIC AGENTS
US12491244B2 (en) 2018-09-12 2025-12-09 GC Cell Corporation Pharmaceutical combinations for treating tumor comprising anti-CD19 antibody and natural killer cell

Also Published As

Publication number Publication date
KR20140071368A (ko) 2014-06-11
EP2744826B1 (en) 2022-02-09
DK2744826T3 (da) 2022-03-28
KR102117202B1 (ko) 2020-06-01
ZA201401835B (en) 2015-06-24
KR20200060779A (ko) 2020-06-01
CA2841738A1 (en) 2013-02-21
JP2014525925A (ja) 2014-10-02
RS63121B1 (sr) 2022-05-31
SMT202200160T1 (it) 2022-05-12
PL2744826T3 (pl) 2022-05-30
CA2841738C (en) 2022-12-06
RU2014103490A (ru) 2015-09-27
HRP20220224T1 (hr) 2022-04-29
NZ617771A (en) 2016-01-29
AU2012296905B2 (en) 2017-01-05
ES2909720T3 (es) 2022-05-10
EP4083071A2 (en) 2022-11-02
SI2744826T1 (sl) 2022-05-31
JP6114273B2 (ja) 2017-04-12
EP4083071A3 (en) 2023-02-22
CN103703027B (zh) 2018-01-12
RU2664462C9 (ru) 2018-09-28
MX2013014935A (es) 2014-07-09
SG10201606788VA (en) 2016-09-29
BR112013033916B1 (pt) 2022-11-16
RU2664462C2 (ru) 2018-08-17
US20140227277A1 (en) 2014-08-14
CN103703027A (zh) 2014-04-02
HUE058855T2 (hu) 2022-09-28
KR20190094478A (ko) 2019-08-13
PT2744826T (pt) 2022-05-19
BR112013033916A2 (pt) 2017-11-28
EP2744826A1 (en) 2014-06-25
LT2744826T (lt) 2022-04-25
CY1125148T1 (el) 2024-12-13
IL230295B (en) 2018-03-29
US20240424012A1 (en) 2024-12-26
US20200352975A1 (en) 2020-11-12
MX353589B (es) 2018-01-19

Similar Documents

Publication Publication Date Title
US20240424012A1 (en) Combinations and uses thereof
US20240009196A1 (en) Combination of an anti-cd19 antibody and a bruton&#39;s tyrosine kinase inhibitor and uses thereof
AU2012296905A1 (en) Combination therapy with an anti - CD19 antibody and a purine analog
US12194095B2 (en) Combinations and uses thereof
EP2744515B1 (en) Combination therapy with an anti-cd19 antibody and a nitrogen mustard
JP2014525925A5 (https=)
AU2012296907A1 (en) Combination therapy with an anti - CD19 antibody and a nitrogen mustard
HK40069168A (en) Combinations and uses thereof
HK40081594A (en) Combination therapy with an anti-cd19 antibody and a nitrogen mustard
HK40023127A (en) Combination of an anti-cd19 antibody and a bruton&#39;s tyrosine kinase inhibitor and uses thereof
NZ617771B2 (en) Combination therapy with an anti - cd19 antibody and a purine analog
HK1195322A (en) Combination therapy with an anti-cd19 antibody and a purine analog
HK1195322B (en) Combination therapy with an anti-cd19 antibody and a purine analog

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 12745883

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2012296905

Country of ref document: AU

Date of ref document: 20120814

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: MX/A/2013/014935

Country of ref document: MX

WWE Wipo information: entry into national phase

Ref document number: 14127217

Country of ref document: US

ENP Entry into the national phase

Ref document number: 2841738

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2014525432

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 20147006942

Country of ref document: KR

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2014103490

Country of ref document: RU

Kind code of ref document: A

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112013033916

Country of ref document: BR

REG Reference to national code

Ref country code: BR

Ref legal event code: B01E

Ref document number: 112013033916

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 112013033916

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20131230