WO2012170977A1 - Modulation of pancreatic beta cell proliferation - Google Patents
Modulation of pancreatic beta cell proliferation Download PDFInfo
- Publication number
- WO2012170977A1 WO2012170977A1 PCT/US2012/041804 US2012041804W WO2012170977A1 WO 2012170977 A1 WO2012170977 A1 WO 2012170977A1 US 2012041804 W US2012041804 W US 2012041804W WO 2012170977 A1 WO2012170977 A1 WO 2012170977A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- agent
- peptide
- functional portion
- protein
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
- A61K48/005—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the 'active' part of the composition delivered, i.e. the nucleic acid delivered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/575—Hormones
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/18—Drugs for disorders of the alimentary tract or the digestive system for pancreatic disorders, e.g. pancreatic enzymes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/04—Anorexiants; Antiobesity agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
- A61P3/10—Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P5/00—Drugs for disorders of the endocrine system
- A61P5/48—Drugs for disorders of the endocrine system of the pancreatic hormones
- A61P5/50—Drugs for disorders of the endocrine system of the pancreatic hormones for increasing or potentiating the activity of insulin
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/5005—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells
- G01N33/5008—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells for testing or evaluating the effect of chemical or biological compounds, e.g. drugs, cosmetics
- G01N33/502—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells for testing or evaluating the effect of chemical or biological compounds, e.g. drugs, cosmetics for testing non-proliferative effects
- G01N33/5023—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells for testing or evaluating the effect of chemical or biological compounds, e.g. drugs, cosmetics for testing non-proliferative effects on expression patterns
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/74—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving hormones or other non-cytokine intercellular protein regulatory factors such as growth factors, including receptors to hormones and growth factors
Definitions
- Beta cells are a type of pancreatic cell located in the islets of Langerhans which make and secrete insulin, a hormone that controls the level of glucose in the blood. Beta cells can respond quickly to spikes in blood glucose by releasing stored insulin while
- Impaired function and/or diminished numbers of beta cells are implicated in metabolic diseases including diabetes, obesity, and other disorders.
- Diabetes is a disease derived from multiple causative factors and characterized by elevated levels of plasma glucose (hyperglycemia) in the fasting state.
- hyperglycemia plasma glucose
- Type 1 diabetes is caused by insulin deficiency resulting from loss of pancreatic beta cells, typically as a result of autoimmune destruction of the islets of
- therapeutic agent (s) capable of stimulating beta cell regeneration advantageously combined with therapeutic agent (s) capable of stimulating beta cell regeneration.
- Type 2 diabetic patients liver and muscle cells lose their normal ability to respond to normal blood insulin levels (insulin resistance) , resulting in high blood glucose levels. Additionally, Type II diabetic patients exhibit impairment of beta cell function and an increase in beta cell apoptosis, causing a reduction in total beta cell mass over time. Eventually, the
- Work described herein provides, in one embodiment, a method for increasing proliferation or replication of pancreatic beta cells in a subject in need thereof, comprising administering to said subject an effective amount of an agent that increases the level or activity of hepatocellular carcinoma-associated protein TD26 (TD26) , thereby increasing proliferation or replication of
- TD26 hepatocellular carcinoma-associated protein
- pancreatic beta cells Such an agent may function by, for example, increasing the level of active TD26 in the subject or by increasing the functional activity of TD26 in the subj ect .
- Described herein, in one embodiment, is a method for treating or preventing a disorder associated with a reduced level of endogenous insulin in a subject comprising administering to said subject an effective amount of an cicj ⁇ nt thcit increases the level or activity of
- TD26 hepatocellular carcinoma-associated protein TD26
- the agent is a TD26 protein or functional portion thereof or a nucleotide sequence encoding TD26 or a functional portion thereof.
- Also described is a method for treating or preventing a disorder associated with resistance to endogenous insulin in a subject comprising administering to said subject an effective amount of an agent that increases the level or activity of hepatocellular carcinoma-associated protein TD26 (TD26) , thereby increasing proliferation of pancreatic beta cells and increasing the level of endogenous insulin in said subject.
- the agent is a TD26 protein or functional portion thereof or a nucleotide sequence encoding TD26 or a functional portion thereof.
- the administered agent increases the level of endogenous TD26 in said subject.
- the agent increases expression of TD26.
- the agent increases secretion of TD26.
- the agent increases the stability of, or prevents or otherwise slows the degradation of TD26. It should be appreciated that the present invention
- the agent is TD26 protein or a functional portion thereof (e.g., a coiled-coil domain or a TD26 protein which lacks a native signal sequence) .
- the TD26 protein comprises SEQ ID NO:
- a functional portion can be, for example, a polypeptide which is less that the entire TD26 amino acid sequence, lacks the native signal sequence, and comprises the amino acid sequence of amino acids 22-76, 48-76, or 77-
- the agent is a nucleic acid encoding TD26 protein or a functional portion of TD26.
- the nucleic acid comprises all or a portion of SEQ ID NO: 14 or SEQ ID NO: 15.
- the agent is an insulin receptor antagonist.
- the agent can be selected from the group consisting of S661, a functional portion of S661, S961, a functional portion of S961, RB537, and a functional portion of RB537.
- the agent comprises all or a functional portion of SEQ ID NO: 16.
- the insulin receptor antagonist is administered at a dose which preferably causes little or no increase in blood glucose levels, or causes only a
- the insulin receptor antagonist may, in some instances, be administered to said subject at a dose of less than about 10 ⁇ /Kg/week (e.g., less than about 9 ⁇ ⁇ /Kg/week, about 8 ⁇ /Kg/week, about 7 ⁇ ⁇ /Kg/week, about 6 ⁇ /Kg/week, about 5 ⁇ ⁇ /Kg/week, about 4 ⁇ /Kg/week, about 3 ⁇ /Kg/week, about 2 ⁇ ⁇ /Kg/week, about 1 ⁇ /Kg/week, about 0.90
- the insulin receptor antagonist is administered to said subject at a dose of about 1 ⁇ ⁇ /Kg/week.
- the disorder is selected from the group consisting of diabetes (e.g., Type I diabetes or Type II diabetes), metabolic syndrome, glucose intolerance, and obesity.
- diabetes e.g., Type I diabetes or Type II diabetes
- metabolic syndrome e.g., glucose intolerance, and obesity.
- Also disclosed is a method of identifying a candidate therapeutic agent for treatment of a disorder associated with a reduced level of endogenous insulin comprising contacting a suitable cell with a test agent; and determining the effect of said test agent on level or activity of TD26, wherein a test agent which increases TD26 level or activity is a candidate therapeutic agent for treatment of a disorder associated with a reduced level of endogenous insulin.
- a test agent which increases TD26 level or activity is a candidate therapeutic agent for treatment of a disorder associated with a reduced level of endogenous insulin.
- the effect of said test agent on level or activity of TD26 is assessed by comparing the effect of said test agent against the effect of a therapeutic agent which is known to increase TD26 level or activity.
- One such therapeutic agent identified by work described herein is S961, for example.
- the effect of said test agent on level or activity of TD26 is assessed by
- Suitable antagonists may, for example,
- Insulin receptor antagonists may, for example, increase the level or activity of TD26, preferably without markedly increasing blood glucose levels or only doing so transiently.
- methods of treating diabetes by administering one or more insulin receptor antagonists are described herein.
- Figs. 1A-1D show that the insulin receptor antagonist S961 induces beta cell replication.
- Fig. 1A shows
- Fig. IB shows treatment for 10 days with S961 (triple immunofluorescent staining using DAPI as marker for cell nuclei in blue, anti-insulin antibody staining as marker for beta cells in green, and anti-Ki67 (a marker of replication and cell proliferation) labeling the nuclei of proliferating cells in red) .
- the white arrows point to replicating beta cells.
- Fig. 1C is a bar graph showing Ki 67+/insulin+ % after treatment for 7 days with increasing doses (from 0.125 ⁇ /Kg/week to 1 ⁇ /Kg/week) of S961.
- Fig. ID is a bar graph showing significant increase in beta cell
- Figs. 2A-2F show that the gene TD26, which is induced by the insulin receptor antagonist S961, is highly
- FIG. 2A shows gene expression microarray analysis of liver tissue after 7 days of treatment with S961. Genes close to the diagonal line show similar expression values in treated and untreated liver. Dots outside of the area between the thin red lines labeled "3 folds" represent genes significantly up- or down-regulated under treatment conditions. One of the upregulated genes, indicated by the black arrow, is EG624219 (the mouse ortholog of TD26) .
- Fig. 2B shows relative expression of TD26 mRNA in mice treated with insulin receptor antagonist S961 for 7 days. TD26
- Fig. 2C shows the predicted exon structure for the mouse ortholog of TD26.
- Fig. 2D shows an alignment of the sequences of TD26 protein with mouse and rat orthologs (human (Homo sapiens, SEQ ID NO: 1), mouse (Mus musculus, SEQ ID NO: 2) and rat (Rattus norvegicus, SEQ ID NO: 3)) along with a consensus sequence (SEQ ID NO: 4). The presumptive signal peptide is included at the N-terminus.
- Fig. 1 shows the predicted exon structure for the mouse ortholog of TD26.
- Fig. 2D shows an alignment of the sequences of TD26 protein with mouse and rat orthologs (human (Homo sapiens, SEQ ID NO: 1), mouse (Mus musculus, SEQ ID NO: 2) and rat (Rattus norvegicus, SEQ ID NO: 3)) along with a consensus sequence (SEQ ID NO: 4).
- FIG. 2E shows that Myc-tagged EG624219 (the mouse ortholog of TD26) and TD26 are expressed in Hepal-6 cells (mouse hepatoma cells) .
- Hepal-6 cells have been transfected with a plasmid carrying the gene for TD26 fused to a Myc-tag. The cells were stained with myc antibody.
- Fig. 2F is a western blot illustrating, in 293T cells, that a myc-tagged mouse EG624219 (mouse TD26 protein) and a myc-tagged TD26 is secreted into the supernatant after 48 hrs, indicating that both the mouse ortholog of TD26 and human TD26 are secreted proteins .
- Figs. 3A and 3B show the expression of TD26 in human (Fig, 3A) and mouse (Fig. 3B) tissue based on tissue microarray data from the BioGPS online database
- Fig. 3A shows high expression in human liver
- Fig. 3B shows high expression in mouse brown adipose tissue, in liver and in pancreas.
- Figs. 4A-4C show that in vivo administration of
- EG624219 DNA via injection into tail vein on day 1 increases beta cell replication.
- Figs. 4A control (green fluorescent protein (GFP) )
- Figs. 4B control (green fluorescent protein (GFP)
- EG624219 show the results on day 9; Ki67 is a marker of replication.
- the green stain for insulin shows islets nested within the exocrine pancreas.
- the red dots in the islets show replicating beta cells.
- Fig. 4C is a bar graph showing Ki67+/insulin+ % with control (GFP) as compared to EG624219.
- GFP control
- EG624219 injected animals demonstrated a 26 fold increase in beta cell replication compared to control injected animals (i.e., an average of 5.76% for EG624219 injected animals versus 0.22% for control injected
- Fig. 5 shows predicted sequence homologies for TD26 in various species including mouse (Mus musculus) , dog (Canis familiaris) , chicken (Gallus gallus) , frog (Xenopus
- TD26 appears to be a gene specific to mammals, as it is not found in chicken, frog, or fish.
- Fig. 6 shows the sequence homology of human TD26 ("query,” including portion of predicted signal sequence) with human angiopoietin-related protein 3 precursor
- TD26 (SEQ ID NO: 5) shows 22% identity and 49% homology to angiopoietin-related 3 precursor (SEQ ID NO: 6) .
- Fig. 7 shows the sequence homology of mouse TD26 ortholog ("query,” EG624219; SEQ ID NO: 7, which includes a portion of the predicted signal sequence) with Mus musculus angiopoietin-related protein 3 precursor ("Sbjct,” SEQ ID NO: 8) .
- Fig. 8 shows the sequence homology of angiopoietin- related protein 3 precursor (Homo sapiens; referred to as “angptl-3 Hs”) (SEQ ID NO: 9), angiopoietin-related protein 3 precursor (Mus musculus ; referred to as “angptl-3 Mm”) (SEQ ID NO: 10) , angiopoietin-related protein 4 precursor ⁇ Homo sapiens; referred to as “angptl-4 Hs”) (SEQ ID NO: 11) , angiopoietin-related protein 4 precursor [Mus
- angptl-4 Mm TD26 ortholog ⁇ Mus musculus; EG624219
- human TD26 SEQ ID NO: 1 .
- Fig. 9 shows that both mouse and human TD26 proteins are predicted to have a signal sequence.
- Fig. 10 shows that human TD26 is predicted to have a coiled-coiled structure.
- Fig. 11 is a graph illustrating blood glucose levels (mg/dL) as a function of time after administration of various concentrations of S961, indicating that beta cell replication is increased upon administration of S961 without substantially impacting blood glucose levels.
- Fig. 12 is a bar graph showing beta cell replication after repeated dosing of S661 in the pancreas of normal mice. Increased replication is shown as a fold increase compared to vehicle rate. Replication was analyzed by immunohistochemistry . The control in these experiments is a vehicle without S661.
- Fig. 13 is a bar graph showing beta cell replication after repeated dosing of S661 in normal mice. Increased beta cell replication with S661 treatment is shown as a percentage of replication. Replication was analyzed by flow cytometry. The control in these experiments is a vehicle without S661. (*** p ⁇ 0.001; Student's T-Test)
- Figures 14A-14C show that in vivo administration of S661 increases beta cell replication in diet-induced obesity (DIO) mice.
- Fig. 14 (A) shows increased replication of beta cells and
- Fig. 14 (B) shows replication of non-beta cells after repeated dosing of S661 in pancreas in mice with diet-induced obesity.
- Increased beta cell replication with S661 treatment is shown as percent replication; there was no effect on non-beta cell replication.
- Fig. 14 (C) demonstrates that S661 treatment caused an increase in islet area relative to total pancreas area.
- Fig. 15 shows induction of beta cell replication by in vivo administration of plasmids encoding mouse TD26 polypeptide fragments via injection into tail vein.
- the control in these experiments was GFP-encoding plasmid.
- Embodiments of the invention described herein arise from the observation that hepatocellular carcinoma- associated protein TD26 (herein referred to as "TD26") induces pancreatic beta cell proliferation, as well as the observation that the insulin receptor antagonist S961 also induces pancreatic beta cell proliferation at low doses.
- TD26 hepatocellular carcinoma- associated protein
- S961 insulin receptor antagonist
- the ability to modulate, and particularly to increase, beta cell function and cell mass, thereby increasing insulin secretion provides modalities for treatment of, e.g., diabetes.
- work described herein provides methods of modulating pancreatic beta cell proliferation, serum insulin levels, levels of fatty acids, and blood glucose levels, as well as methods for treating and/or preventing disorders including diabetes, obesity and metabolic syndrome.
- pancreatic ⁇ -cell include primary pancreatic ⁇ -cells, pancreatic ⁇ -like cells derived from dedifferentiated cells, e.g. from induced pluripotent stem cells (iPSCs), or pancreatic ⁇ -like cells that have been directly
- a ⁇ -cell is not an immortalized cell line (i.e., the ⁇ -cell does not proliferate indefinitely in culture) . In one embodiment, the ⁇ -cell is not a
- transformed cell i.e., the ⁇ -cell does not exhibit a transformation property, such as growth in soft agar, or absence of contact inhibition, to name just two examples.
- endogenous pancreatic beta cell refers to an insulin producing cell of the pancreas of a mammal, or a cell of a pancreatic beta cell (beta cell) phenotype of a mammal.
- pancreatic beta cell The phenotype of a pancreatic beta cell is well known by persons of ordinary skill in the art, and include, for example, secretion of insulin in response to an increase in glucose level, expression of markers such as c-peptide, PDX-1 polypeptide and Glut 2, as well as distinct morphological characteristics such as, but not necessarily, organized in islets in pancreas in vivo, and typically have small spindle like cells of about 9-15 m diameter.
- Endogenous pancreatic beta cells can be found in the islets of Langerhans.
- the primary pancreatic beta cells can be contacted in vitro as part of the islets of Langerhans.
- insulin producing cell includes primary beta cells as that term is described herein, as well as pancreatic beta-like cells as that term is described herein, that synthesize (i.e., transcribe the insulin gene, translate the proinsulin mRNA, and modify the proinsulin mRNA into the insulin protein), express (i.e., manifest the phenotypic trait carried by the insulin gene), or secrete (release insulin into the extracellular space) insulin in a constitutive or inducible manner.
- synthesize i.e., transcribe the insulin gene, translate the proinsulin mRNA, and modify the proinsulin mRNA into the insulin protein
- express i.e., manifest the phenotypic trait carried by the insulin gene
- secrete release insulin into the extracellular space
- the methods comprise contacting a cell with or administering to a subject a compound or agent that modulates TD26 protein level or activity.
- upregulation activation or increasing activity
- downregulation inhibition of protein level, activity or function.
- the modulation occurs by directly increasing or inhibiting the activity of a protein, i.e., via direct physical interaction with the protein.
- the activity of the protein is modulated indirectly, for example, in signaling, by activating or inhibiting an upstream effector of the protein activity.
- desirable compounds or agents increase levels or activity (e.g., by increasing expression and/or secretion) of TD26.
- Suitable compounds /agents include, but are not limited to, chemical compounds and mixtures of chemical compounds, e.g., small organic or inorganic molecules; saccharides; oligosaccharides;
- polysaccharides e.g., peptides, proteins, and peptide analogs and derivatives;
- a compound/agent can be a nucleic acid RNA or DNA, and can be either single or double stranded.
- Example nucleic acid compounds include, but are not limited to, a nucleic acid encoding a protein activator or inhibitor (e.g.
- oligonucleotides e.g. peptide- nucleic acid (PNA) , pseudo-complementary PNA (pc-PNA) , locked nucleic acid (LNA) etc.), antisense molecules, ribozymes, small inhibitory or activating nucleic acid sequences (e.g., RNAi, shRNAi, siRNA, micro RNAi (mRNAi), antisense oligonucleotides etc.)
- a protein and/or peptide agent can be any protein that modulates gene expression or protein activity. Non-limiting examples include mutated proteins; therapeutic proteins and truncated proteins, e.g. wherein the protein is normally absent or expressed at lower levels in the target cell. Proteins can also be selected from genetically engineered proteins, peptides, synthetic peptides, recombinant proteins, chimeric
- a compound or agent that increases expression of a gene or increases the level or activity of a protein encoded by a gene is also known as an activator or activating compound.
- a compound or agent that decreases expression of a gene or decreases the level or activity of a protein encoded by a gene is also known as an inhibitor or inhibiting compound.
- agents that increase TD26 levels or activity include, but are not limited to, TD26 proteins or polypeptides (including both human TD26 and homologs thereof, and orthologous polypeptides and proteins from non-human species, e.g., mouse) and functional fragments thereof; nucleic acid molecules encoding TD26 proteins and polypeptides and functional fragments thereof; and insulin receptor antagonists.
- insulin receptor antagonists may be agents that interfere with the ability of insulin to interact with the insulin receptor, as well as agents that are capable of neutralizing the biological effects of insulin, preferably without markedly increasing blood glucose levels or only doing so
- suitable insulin receptor antagonists are those which interfere with insulin signaling and are capable of increasing beta cell replication. In some embodiments, such insulin receptor antagonists increase the level or activity of TD26, preferably without markedly increasing blood glucose levels or doing so only transiently. It should be understood that suitable insulin receptor antagonists include, but are not limited to, any of the suitable compounds /agents described above that are capable of increasing the level or activity of TD26 and increasing beta cell replication, preferably without a marked non- transient increase in blood glucose levels, when
- an insulin receptor antagonist that increases beta cell replication can be a protein or peptide.
- a protein or peptide insulin receptor antagonist increases the level or activity of TD26. It will be understood by those of skill in the art that the peptide insulin receptor antagonists of the present invention can be administered in their peptide form or as nucleic acids which encode the peptides and are capable of being translated in vivo to produce a peptide having the desired biological activity.
- a peptide insulin receptor antagonist comprises a first functional portion, a second functional portion, and a linker therebetween, preferably engineered for flexibility and/or solubility.
- the first and second functional portions can comprise, for example, amino acid sequences which exhibit an affinity for the insulin receptor that is greater than or equal to the affinity of insulin for the insulin receptor (e.g., affinity-optimized sites) .
- the first functional portion comprises a peptide having the amino acid sequence of SEQ ID NO: 18. In some embodiments, the first functional portion comprises a peptide having an amino acid sequence that is at least 80% identical to SEQ ID NO: 18, and retains the desired biological activity.
- the linker comprises a flexible linker. In some embodiments, the linker comprises a soluble linker. In some embodiments, the linker comprises an amino acid linker. In some embodiments, the amino acid linker has one or more amino acid residues. In other embodiments, the amino acid linker has up to seven amino acid residues. In some embodiments, the linker comprises one or more glycine residues and one or more serine residues. In some embodiments, the linker comprises one or more GGS repeats (e.g., GGS, GGSGGS, GGSGGSGGS, etc.). In one embodiment, a flexible linker comprises SEQ ID NO: 19.
- the flexible linker comprises an ethylene glycol-based linker as described in Schaffer et al., (Schaffer et al., PNAS 100 ( 8 ): 4435-4439 (2003), incorporated herein by reference in its entirety) .
- the linker comprises a triethylene glycol-based linker .
- the second functional portion comprises a peptide having the amino acid sequence of SEQ ID NO: 20. In some embodiments, the second functional portion comprises a peptide having an amino acid sequence that is at least 80% identical to SEQ ID NO: 20, and retains the desired biological activity. In some
- the second functional portion comprises a peptide having amino acid sequence SLEEEWAQIQCEVWGRGCPSY (SEQ ID NO: 23) .
- the second amino acid sequence SLEEEWAQIQCEVWGRGCPSY SEQ ID NO: 23.
- the functional portion comprises a peptide having an amino acid sequence that is at least 80% identical to SEQ ID NO: 23, and retains the desired biological activity.
- the second functional portion comprises a peptide having amino acid sequence L-Xaa-Xaa-EWA-Xaa-Xaa- QCEV-Xaa-GRGCPS (SEQ ID NO: 24), wherein Xaa is any amino acid.
- the second functional portion comprises a peptide having an amino acid sequence that is at least 80% identical to SEQ ID NO: 24, and retains the desired biological activity.
- a peptide insulin receptor antagonist that increases beta cell replication comprises peptide S961 (SEQ ID NO: 16, with an acid C-terminus) .
- peptide S961 increases the level or activity of TD26, preferably without markedly increasing blood glucose levels, or doing so only transiently.
- the peptide S961 (or a functional portion thereof) or a nucleic acid encoding peptide S961 comprises a variant sequence.
- the variant sequence can include one or more sequence variations provided that such variations do not eliminate the effect of increasing beta cell replication.
- the sequence variations comprise conservative variations.
- a nucleic acid encoding a S961 peptide of the present invention comprises a nucleotide sequence at least 80% identical to a nucleic acid encoding S961.
- a S961 peptide of the present invention comprises an amino acid sequence at least 80% identical to a S961 peptide.
- said S961 peptide comprises an amino acid sequence at least 80% identical to SEQ ID NO: 16.
- said peptide comprises an amino acid sequence at least 80% identical to SEQ ID NO: 18.
- said peptide comprises an amino acid sequence at least 80% identical to SEQ ID NO:
- said peptide comprises an amino acid sequence at least 80% identical to, in order from N- terminus to C-terminus, SEQ ID NO: 18, SEQ ID NO: 19 and SEQ ID NO: 23, with an acid C-terminus.
- a peptide insulin receptor antagonist that increases beta cell replication comprises peptide S661 (SEQ ID NO: 16, with an amide C-terminus) .
- peptide S661 increases the level or activity of TD26, preferably without markedly increasing blood glucose levels or doing so only transiently.
- the peptide S661 (or a functional portion thereof) or a nucleic acid encoding peptide S661 comprises a variant sequence provided that such variations do not eliminate the effect of increasing beta cell replication.
- the sequence variations comprise conservative variations.
- a nucleic acid encoding a S661 peptide of the present invention comprises a nucleotide sequence at least 80% identical to a nucleic acid encoding S661.
- a S661 peptide of the present invention comprises an amino acid sequence at least 80% identical to a S661 peptide.
- said S661 peptide comprises an amino acid sequence at least 80% identical to SEQ ID NO: 16.
- said peptide comprises an amino acid sequence at least 80% identical to SEQ ID NO: 18.
- said peptide comprises an amino acid sequence at least 80% identical to SEQ ID NO: 23.
- said peptide comprises an amino acid sequence at least 80% identical to, in order from N- terminus to C-terminus, SEQ ID NO: 18, 19 and 23, with an amide C-terminus .
- a peptide insulin receptor antagonist that increases beta cell replication comprises peptide RB537 (SEQ ID NO: 17).
- peptide RB537 increases the level or activity of TD26, preferably without markedly increasing blood glucose levels, or doing so only transiently.
- the peptide RB537 (or a functional portion thereof) or a nucleic acid encoding peptide RB537 comprises a variant sequence provided that such variations do not eliminate the effect of increasing beta cell replication.
- the sequence variations comprise conservative variations.
- a nucleic acid encoding a RB537 peptide of the present invention comprises a nucleotide sequence at least 80% identical to a nucleic acid encoding RB537.
- a RB537 peptide of the present invention comprises an amino acid sequence at least 80% identical to a RB537 peptide.
- said RB537 peptide comprises an amino acid sequence at least 80% identical to SEQ ID NO: 17.
- said RB537 peptide comprises an amino acid sequence at least 80% identical to SEQ ID NO: 18.
- said RB537 peptide comprises an amino acid sequence at least 80% identical to SEQ ID NO: 20.
- said RB537 peptide comprises an amino acid sequence at least 80% identical, from N-terminus to C-terminus, to SEQ ID NO: 18, SEQ ID NO: 19, and SEQ ID NO: 20.
- an insulin receptor antagonist that increases beta cell replication comprises an antibody.
- an insulin receptor antagonist that increases beta cell replication comprises an antibody that binds to the insulin receptor.
- an insulin receptor antagonist antibody increases the level or activity of TD26, preferably without markedly increasing blood glucose levels or doing so only transiently.
- antibody is used in the broadest sense and includes fully assembled antibodies, tetrameric antibodies, monoclonal antibodies, polyclonal antibodies, multispecific antibodies (e.g., bispecific antibodies), antibody
- fragments that can bind an antigen e.g., Fab', F'(ab)2, Fv, single chain antibodies, diabodies
- an antigen e.g., Fab', F'(ab)2, Fv, single chain antibodies, diabodies
- recombinant peptides comprising any of the above as long as they exhibit the desired biological activity.
- immunoglobulin or "tetrameric antibody” is a tetrameric glycoprotein that consists of two heavy chains and two light chains, each comprising a variable region and a constant region.
- Antigen-binding portions may be produced by recombinant DNA techniques or by enzymatic or chemical cleavage of intact antibodies.
- Antibody fragments or antigen-binding portions include Fab, Fab', F ( ab ' ) .
- dAb domain antibody
- CDR complementarity determining region
- scFv single chain antibody fragments
- chimeric antibodies diabodies, triabodies, tetrabodies, minibody, linear antibody; chelating recombinant antibody, a tribody or bibody, an intrabody, a nanobody, a small modular immunopharmaceutical (SMIP) , a antigen-binding- domain immunoglobulin fusion protein, a camelized antibody, a VHH containing antibody, or a variant or a derivative thereof, and polypeptides that contain at least a portion of an immunoglobulin that is sufficient to confer specific antigen binding to the polypeptide, such as one, two, three, four, five or six CDR sequences, as long as the antibody retains the desired biological activity.
- SMIP small modular immunopharmaceutical
- Antibody variant refers to an antibody polypeptide sequence that contains at least one amino acid substitution, deletion, or insertion in the variable region of the natural antibody variable region domains. Variants may be substantially homologous or substantially identical to the unmodified antibody.
- a “chimeric antibody” refers to an antibody containing sequence derived from two different antibodies (see, e.g., U.S. Pat. No. 4,816,567) which typically originate from different species. Most typically, chimeric antibodies comprise human and rodent antibody fragments, generally human constant and mouse variable regions.
- insulin receptor antagonists which may be suitable for use in the present invention, in some examples, in some
- embodiments may include anti-insulin receptor antibodies reported in the literature (see, e.g., Roth et al . , J Biol Chem. 1983 Oct 25 ; 258 (20 ) : 12094-7 ; Morgan et al., Proc Natl Acad Sci U S A. 1986 Jan; 83 (2 ) : 328-32 ; Taylor et al . , Biochem J. 1987 Feb 15;242(1 ) : 123-9; Nagy et al.,
- anti-insulin receptor antibodies may increase the level or activity of TD26, preferably without markedly increasing blood glucose levels, or doing so only transiently.
- the present invention is a present invention.
- polynucleotides encoding antibodies and peptides of the invention.
- the present invention also contemplates vectors comprising such polynucleotides, host cells comprising such polynucleotides or vectors, and methods of producing antibodies and polypeptides of the invention comprising growing such host cells in culture medium under suitable conditions and optionally isolating the encoded antibody or polypeptide from the host cells or culture medium, optionally followed by further purification of the antibody or polypeptide.
- Antibody isolation and purification methods are well within the level of ordinary skill in the art.
- an insulin receptor antagonist that is capable of increasing beta cell replication comprises a chemical compound, such as a low molecular weight organic molecule, for example.
- the chemical compound increases the level or activity of TD26.
- activate are all used herein to generally mean an increase by a significant amount.
- level or activity of the TD26 protein is increased by at least 5%, at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 1-fold, at least 1.1-fold, at least 1.5-fold, at least 2-fold, at least 3-fold, at least 4-fold, at least 5-fold, or more relative to a control.
- the activator of protein activity has an EC50 of less than or equal to 500n , less than or equal to 250nM, less than or equal to ⁇ , less than or equal to 50n , less than or equal to ⁇ , less than or equal to InM, less than or equal to O.lnM, less than or equal to O.OlnM, or less than or equal to O.OOlnM.
- Protein activity can be measured by means well known to those of skill in the art and may be measured by different methods or assays depending on context .
- desirable compounds or agents decrease levels or activity (e.g., by decreasing expression and/or secretion) of TD26. Decreasing expression and/or secretion of TD26 may be desirable for treating disorders characterized by excessive insulin levels, which may be exacerbated by increased TD26 levels or activity, such as insulinomas, for example.
- level or activity of the protein encoded by the gene is inhibited or lowered by at least 5%, at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 98%, or 100% (e.g. complete loss of activity) relative to a control.
- the inhibitor has an IC50 of less than or equal to 500nM, less than or equal to 250n , less than or equal to ⁇ , less than or equal to 50nM, less than or equal to ⁇ , less than or equal to InM, less than or equal to 0.
- InM less than or equal to O.OlnM, or less than or equal to O.OOlnM.
- Compounds that decrease TD26 levels or activity include, for example, anti-TD26 antibodies, antisense molecules which target TD26, and siRNA molecules which target TD26.
- TD26 proteins and polypeptides suitable for use in the present invention include, for example, human TD26 proteins and polypeptides.
- a human TD26 protein sequence has been deposited with GENBANKTM as Accession No. NP_061157.3.
- the amino acid sequence of human TD26 protein is:
- the methods described herein include contacting a cell or culture medium with or administering to a subject the polypeptide of SEQ ID NO: 1 or a fragment, e.g., a functional portion, thereof (or a nucleic acid encoding the polypeptide or fragment) .
- a functional portion or fragment of TD26 is one which increases beta cell replication, for example, upon administration to a mammal or in a test animal.
- Suitable fragments include, for example, the polypeptide of SEQ ID NO: 1 lacking a native signal sequence and
- polypeptide portions of SEQ ID NO: 1 comprising a coiled- coil domain (CCD) .
- CCD coiled- coil domain
- a functional portion of a TD26 polypeptide or protein useful for increasing the level or activity of TD26 and/or increasing beta cell replication in vivo lacks one or more domains (with reference to SEQ ID NO: 1, for example) .
- a functional portion of TD26 lacks an LPL domain. In some embodiments, a functional portion of TD26 lacks one or more CCD (for example, lacks the first and/or second CCD) . In certain aspects the polypeptide may lack the entire domain, while in other aspects the polypeptide may lack an intact (complete) domain (i.e., may contain a portion of the domain) . In certain aspects the polypeptide may lack a functional domain (e.g., a functional LPL domain or a functional CCD).
- polypeptide or protein useful for increasing the level or activity of TD26 and/or beta cell replication in vivo comprises one or more domains (e.g., an intact domain or a functional domain) of the TD26 protein.
- domains e.g., an intact domain or a functional domain
- a functional portion of TD26 comprises the LPL domain. In some embodiments, a functional portion of TD26 comprises one or more CCD (e.g., the first CCD and/or the second CCD) . In certain embodiments a functional portion of TD26 comprises some or all of the amino acid sequence between the first and second CCD of TD26 ("the intervening sequence" or " IVS " ) .
- a functional portion of TD26 does not comprise the native signal sequence or the complete amino acid sequence or nucleotide sequence of TD26 or the functional portion does not include the complete amino acid sequence of TD26 lacking its signal peptide or a nucleic acid encoding the complete amino acid sequence of
- TD26 lacking its signal peptide. It will be understood that in many secreted proteins the signal sequence is cleaved and is not part of the polypeptide sequence of the final protein .
- a functional portion of a TD26 polypeptide or protein useful for increasing beta cell replication in vivo comprises a peptide of amino acid 22 to 76 of the polypeptide of SEQ ID NO: 1.
- a functional portion of a TD26 polypeptide or protein comprises a peptide of amino acid 22 to 76 of the polypeptide of SEQ ID NO: 1 comprising one or more
- a functional portion of a TD26 polypeptide or protein useful for increasing beta cell replication in vivo comprises an LPL domain, but lacks a CCD1, IVS, and CCD2.
- a functional portion of a TD26 polypeptide or protein useful for increasing beta cell replication in vivo comprises a predicted LPL domain, but lacks a predicted CCDl, a predicted IVS, and a predicted CCD2.
- a functional portion of a TD26 polypeptide or protein useful for increasing beta cell replication in vivo comprises a peptide of amino acid 48 to 76 of the polypeptide of SEQ ID NO: 1.
- a functional portion of a TD26 polypeptide or protein comprises a peptide of amino acid 48 to 76 of the polypeptide of SEQ ID NO: 1 comprising one or more
- a functional portion of a TD26 polypeptide or protein useful for increasing beta cell replication in vivo lacks an intact LPL domain as well as a CCD1, a IVS, and a CCD2.
- a functional portion of a TD26 polypeptide or protein useful for increasing beta cell replication in vivo comprises an amino acid of SEQ ID NO: 1 lacking an intact LPL domain, a CCD1, a IVS, and a CCD2.
- a functional portion of a TD26 polypeptide or protein useful for increasing beta cell replication in vivo lacks an intact predicted LPL domain as well as a predicted CCD1, a predicted IVS, and a predicted CCD2.
- a functional portion of a TD26 polypeptide or protein useful for increasing beta cell replication in vivo comprises a peptide of amino acid 77 to 135 of the polypeptide of SEQ ID NO: 1.
- a functional portion of a TD26 polypeptide or protein comprises a peptide of amino acid 77 to 135 of the polypeptide of SEQ ID NO: 1 comprising one or more
- a functional portion of a TD26 polypeptide or protein useful for increasing beta cell replication in vivo comprises a CCD1, but lacks a CCD2, a IVS, and a LPL domain.
- a functional portion of a TD26 polypeptide or protein useful for increasing beta cell replication in vivo comprises a predicted CCDl, but lacks a predicted CCD2, a predicted IVS, and a predicted LPL domain.
- a functional polypeptide of SEQ ID NO: 1 comprises a protein sequence in which the signal sequence is replaced with a sequence that is capable of directing secretion of the polypeptide, such as a human growth hormone signal peptide, for example.
- polypeptides and proteins suitable for use in the invention include the polypeptides of SEQ ID NO: 2, SEQ ID NO: 3, and SEQ ID NO: 4, as well as functional fragments thereof.
- polypeptides and proteins can be identified by comparison with the amino acid sequence of human TD26 to identify polypeptides and proteins sharing significant sequence identity or homology with human TD26. Identity or homology may be present across the entire protein or polypeptide or may be present only or primarily across particular domains of the protein or polypeptide
- Computerized algorithms for conducting such sequence comparisons are known in the art, and exemplary methods have been used in the work described herein.
- computer algorithm analysis of amino acid sequence (and nucleic acid sequence) homology may include the utilization of any number of available software packages, such as, for example, the BLAST, DOMAIN, BEAUTY (BLAST Enhanced
- nucleic acid molecules and their encoded polypeptides refer to all forms of nucleic acids of a respective gene (e.g., gene, pre-mRNA, mRNA) or proteins, their polymorphic variants, alleles, mutants, and
- interspecies homologs that (as applicable to nucleic acid or protein) : (1) have an amino acid sequence that has greater than about 80% amino acid sequence identity, or greater than about 85%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% or greater amino acid sequence identity, preferably over a region of at least about 20, 25, 30, 35, 40, 45, 50, 75 or more amino acids, to a polypeptide described herein; (2) specifically bind to antibodies, e.g., polyclonal antibodies, raised against an immunogen comprising a reference amino acid sequence, immunogenic fragments thereof, and conservatively modified variants thereof; (3) specifically hybridize under
- nucleic acid sequence that has greater than about 80%, preferably greater than about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or higher nucleotide sequence identity, preferably over a region of at least about 20, 25, 30, 35, 40, 45, 50, 75, 100, 200 or more nucleotides, to a reference nucleotide sequence described herein.
- the reference nucleotide sequence will lack the portion encoding the signal sequence.
- the TD26 nucleic acid i.e., a nucleic acid encoding a TD26 polypeptide or functional portion thereof
- TD26 protein sequence comprises a variant sequence.
- the variant sequence can include one or more naturally occurring sequence variations .
- Naturally occurring sequence variations include one or more of the single nucleotide polymorphisms, or amino acid variations, identified in Table 1 below.
- TD26 sequences of the invention can comprise naturally occurring (as well as non-naturally occurring) variations provided that such variations do not eliminate the beta cell proliferative effect of the TD 26 sequence.
- the sequence variations comprise conservative variations.
- a nucleic acid encoding a TD26 protein of the present invention comprises a nucleotide sequence at least 80% identical to a TD26 nucleic acid.
- said nucleic acid comprises a nucleotide sequence at least 80% identical to SEQ ID NO:
- said nucleic acid comprises a
- nucleotide sequence at least 80% identical to SEQ ID NO:
- said nucleic acid comprises one or more naturally occurring single nucleotide polymorphisms.
- a TD26 protein of the present invention comprises an amino acid sequence at least 80% identical to a TD26 protein. In some embodiments a TD26 protein of the invention comprises an amino acid sequence at least 80% identical to the secreted portion of a TD26 protein (i.e., a portion excluding the signal sequence) . In some aspects, said protein comprises an amino acid sequence at least 80% identical to SEQ ID NO: 1. In some aspects, said protein comprises an amino acid sequence at least 80% identical to SEQ ID NO: 2. In some aspects, said protein comprises an amino acid sequence at least 80% identical to SEQ ID NO: 3. In some aspects, said protein comprises an amino acid sequence at least 80% identical to SEQ ID NO: 4. In some aspects, said protein sequence comprises one or more naturally occurring amino acid variations .
- nucleic acids or proteins typically be from a mammal including, but not limited to, primate, e.g., human; rodent, e.g., rat, mouse, hamster; cow, pig, horse, sheep, or any mammal. Truncated forms of these referenced nucleic acids or proteins are included in the definition.
- polypeptide refers, in one embodiment, to a protein or, in another embodiment, to protein fragment or fragments or, in another embodiment, to a string of amino acids. In one embodiment, reference to "peptide" or
- polypeptide is meant to include native peptides (either degradation products, synthetically synthesized peptides or recombinant peptides) and peptidomimetics (typically, synthetically synthesized peptides) , such as peptoids and semipeptoids which are peptide analogs, which may have, for example, modifications rendering the peptides more stable while in a body or more capable of penetrating into cells. Such modifications include, but are not limited to N- terminal, C-terminal or peptide bond modifications, including, but not limited to, backbone modifications, and residue modification. Methods for preparing peptidomimetic compounds are known in the art and are specified, for example, in Quantitative Drug Design, C.A. Ramsden Gd . , Chapter 17.2, F. Choplin Pergamon Press (1992).
- methods of the invention comprise administration of one or more nucleic acid molecules encoding TD26 proteins and polypeptides or encoding functional fragments thereof.
- a nucleic acid molecule encoding human TD26 polypeptide has been deposited under NCBI Reference Sequence NM_018687.6 and is shown below :
- polypeptides and these nucleotide sequences are within the scope of the invention. Moreover, the skilled artisan will readily be able to determine portions of the nucleotide sequences which encode desirable portions of TD26
- polypeptides For example, the skilled artisan will be able to identify the portion of SEQ ID NO: 14 which encodes a CCD domain of the corresponding TD26 polypeptide.
- the nucleic acids can be in the form of naked DNA or the nucleic acids can be in a vector utilized for delivering the nucleic acids to the cells, for example, retroviral vectors, adenoviral vectors, adeno-associated viral (AAV) vectors, lentiviral vectors, pseudotyped retroviral vectors.
- the vector can be a commercially available preparation, such as an adenovirus vector (Quantum
- the present invention also provides a vector comprising a nucleic acid agent, either of which can be in a pharmaceutically acceptable carrier.
- a nucleic acid agent either of which can be in a pharmaceutically acceptable carrier.
- nucleic acids and vectors can be used in gene therapy protocols to treat a subject in accordance with the methods of the invention.
- the nucleic acid of this invention can be administered to the cell in a liposome.
- delivery can be via commercially available liposome preparations such as LIPOFECTIN, LIPOFECTAMINE (GIBCO-BRL, Inc., Gaithersburg, Md.), SUPERFECT (Qiagen, Inc. Hilden, Germany) and TRANSFECTA (Promega Biotec, Inc., Madison, Wis . ) , as well as other liposomes developed according to procedures standard in the art.
- the nucleic acid or vector of this invention can be delivered in vivo by electroporation, the technology for which is available from Genetronics, Inc.
- the cell can be any cell which can take up and express exogenous nucleic acid; said cell may be present in vivo or ex vivo (e.g., in culture medium) .
- cells or tissues can be removed and maintained outside the body according to standard protocols well known in the art.
- the nucleic acids of this invention can be introduced into the cells via any gene transfer mechanism, such as, for example, virus- mediated gene delivery, calcium phosphate mediated gene delivery, electroporation, microinjection or
- the transduced cells can then be infused (e.g., in a pharmaceutically acceptable carrier) or transplanted back into the subject per standard methods for the cell or tissue type. Standard methods are known for transplantation or infusion of various cells into a subj ect .
- vectors may be introduced into stem cells taken from the patient and clonally propagated for autologous transplant back into that same patient.
- Delivery by transfection and by liposome injections may be achieved using methods which are well known in the art.
- the nucleic acids encoding the TD26 polypeptides of the present invention comprise a synthetic modified mRNA produced by in vitro transcription.
- such mRNA can include, for example, from 5' to 3', a 5' guanine cap, a 5' untranslated region (UTR) containing a strong Kozak seguence for translation
- the mode of administration of the nucleic acid or vector can vary predictably according to the disease being treated and the tissue being targeted.
- the nucleic acid or vector may be administered orally, parenterally (e.g., intravenously) , by intramuscular injection, by
- nucleic acid or vector administered intraperitoneal injection, transdermally, extracorporeally, topically or the like, although intravenous administration is typically preferred.
- the exact amount of the nucleic acid or vector required will vary from subject to subject, depending on the species, age, weight and general condition of the subject, the severity of the disorder being treated, the particular nucleic acid or vector used, its mode of administration and the like.
- nucleic acid or vector of the present invention if used, is generally characterized by injection.
- injectables can be prepared in conventional forms, either as liquid solutions or
- administration involves use of a slow release or sustained release system such that a constant dosage is maintained.
- methods of increasing beta cell replication can be effected by administration of one or more insulin receptor antagonists.
- the present invention contemplates the use of an insulin receptor antagonist to increase beta cell replication, for example, by interfering with the ability of insulin to interact with the insulin receptor, as well as by neutralizing the biological effects of insulin.
- the present invention also contemplates the use of an insulin receptor antagonist that is capable of interfering with the ability of insulin to bind to the insulin receptor, as well as any agent that is capable of neutralizing the biological effects of insulin.
- the insulin receptor antagonist is capable of increasing the level or activity of TD26, preferably without markedly increasing in blood glucose levels or only doing so transiently.
- Insulin receptor antagonists include peptide antagonists such as S661, S961 or RB537.
- S661, S961 and RB537 are peptide mimetics of insulin that bind the insulin receptor but do not transmit the signal that insulin effects (see, e.g., 02007039606, the entirety of which is incorporated herein by reference) .
- S661 and S961 are 43 amino acid peptides that share the amino acid sequence
- GSLDESFYDWFERQLGGGSGGSSLEEEWAQIQCEVWGRGCPSY (SEQ ID NO: 16) .
- the C-terminus of S661 is an amide, whereas the C- terminus of S961 is an acid.
- RB537 has the amino acid sequence :
- a functional portion of RB537 includes at least an affinity- optimized first peptide having the amino acid sequence
- GSLDESFYDWFERQLG (SEQ ID NO: 18) linked via a 6 amino acid sequence GGSGGS (SEQ ID NO: 19) to an affinity-optimized second peptide having the amino acid sequence
- the functional portion of RB537 can further include a first peptide-flanking epitope tag (e.g., FLAG (DYKDDDDK) (SEQ ID NO: 21)) at the N-terminus and a second peptide-flanking epitope E-Tag ( GAPVPYPDPLEPR) (SEQ ID NO: 22) at the C- terminus .
- a first peptide-flanking epitope tag e.g., FLAG (DYKDDDDK) (SEQ ID NO: 21)
- GAPVPYPDPLEPR GAPVPYPDPLEPR
- low doses of S961 will typically be less than 1 ⁇ /Kg/week, preferably from 0.125 ⁇ /Kg/week to 0.5 ⁇ /Kg/week . However it will be understood that increased doses may be useful as well, particularly if utilized in conjunction with an anti-hyperglycemic agent.
- Insulin receptor antagonists may be administered either as a monotherapy or as a combination therapy with other "pharmaceutical agents. For example, they may be administered together with other pharmaceutical agents suitable for the treatment or prevention of diabetes and/or obesity and/or metabolic syndrome.
- a combination therapy includes co-administration of an insulin receptor antagonist and an additional agent.
- co-administration refers to administration of two or more biologically active compounds
- Co-administration can be any combination of substances to a subject.
- Co-administration can be any combination of substances to a subject.
- a combination therapy of the present invention comprises coadministration of an insulin receptor antagonist with one or more blood glucose lowering agents or agents that are beneficial to beta cells.
- agents include, but are not limited to, Metformin or other Biguanides, DPP4 inhibitors, Sulfonylureas or Metiglitinides , SGLT2 inhibitors,
- Glucokinase activators Thiazolidinediones , PPARdelta agonists, non-activating PPARgamma modulators, Glp-1 analogs, GIP analogs, Glp-l-receptor agonists, combined Glp-l/GIP receptor agonists, FGF21, agonistic FGFR
- Oxyntomodulin analogs IAPP analogs, Leptin or Leptin analogs, Adiponectin or Adiponectin analogs, Insulin or Insulin analogs, proton pump inhibitors or gastrin receptor agonists, Reg family proteins/Reg family protein derived peptides or alpha-glucosidase inhibitors.
- pharmaceutical agents which have an immunosuppressive or immunomodulatory activity, e.g., antibodies, polypeptides and/or peptidic or non-peptidic low molecular weight substances .
- TD26 levels or activity include, for example, TD26 antibodies or fragments thereof or a nucleic acid that is complementary to a nucleic acid encoding a TD26 polypeptide (e.g., antisense
- oligonucleotides oligonucleotides, ribozymes or siRNA
- Production of suitable antibodies is well known in the art, and may comprise methods as described in, for example, Harlow and Lane, Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory, New York, 1988.
- siRNA is a double stranded RNA molecule which prevents translation of a target mRNA. Standard techniques of introducing siRNA into a cell are used, including those in which DNA is a template from which an siRNA is
- the siRNA includes a sense TD26 nucleic acid sequence, an antisense TD26 nucleic acid sequence or both.
- the siRNA is constructed such that a single transcript has both the sense and complementary antisense sequences from the target gene, e.g., a hairpin.
- the length of the oligonucleotide is typically at least about 10 nucleotides and may be as long as the naturally-occurring TD26 transcript.
- the oligonucleotide is 19-25 nucleotides in length.
- the oligonucleotide is less than 75, 50, 25 nucleotides in length.
- compositions suitable for administration can be incorporated into pharmaceutical compositions suitable for administration.
- Such compositions typically comprise the agent and a pharmaceutically acceptable carrier.
- pharmaceutically acceptable carrier is intended to include any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like, compatible with pharmaceutical administration. Suitable carriers are described in the most recent edition of Remington's
- Preferred examples of such carriers or diluents include, but are not limited to, water, saline, finger's solutions, dextrose solution, and 5% human serum albumin. Liposomes and non-aqueous vehicles such as fixed oils may also be used. The use of such media and agents for
- compositions are well known in the art. Except insofar as any conventional media or agent is incompatible with the active compound, use thereof in the compositions is contemplated. Supplementary active compounds can also be incorporated into the compositions.
- effectors/modulators thereof may be administered either as a monotherapy or as a combination therapy with other pharmaceutical agents.
- they may be administered either as a monotherapy or as a combination therapy with other pharmaceutical agents.
- they may be administered either as a monotherapy or as a combination therapy with other pharmaceutical agents.
- they may be administered either as a monotherapy or as a combination therapy with other pharmaceutical agents.
- they may be administered either as a monotherapy or as a combination therapy with other pharmaceutical agents.
- they may be
- a combination therapy includes co-administration of TD26 and an additional agent.
- co-administration refers to administration of two or more biologically active substances to a subject. Coadministration can be simultaneous or sequential. The two or more biologically active substances can be part of a single composition or separate compositions.
- a combination therapy of the present invention comprises co-administration of a TD26 polypeptide with one or more blood glucose lowering agents or agents that are beneficial to beta cells. These agents include, but are not limited to, Metformin or other Biguanides, DPP4 inhibitors, Sulfonylureas or Metiglitinides , SGLT2 inhibitors,
- Glucokinase activators Thiazolidinediones, PPARdelta agonists, non-activating PPARgamma modulators, Glp-1 analogs, GIP analogs, Glp-l-receptor agonists, combined Glp-l/GIP receptor agonists, FGF21, agonistic FGFR
- Oxyntomodulin analogs IAPP analogs, Leptin or Leptin analogs, Adiponectin or Adiponectin analogs, Insulin or Insulin analogs, proton pump inhibitors or gastrin receptor agonists, Reg family proteins/Reg family protein derived peptides or alpha-glucosidase inhibitors.
- pharmaceutical agents which have an immunosuppressive activity, e.g., antibodies, polypeptides and/or peptidic or non-peptidic low molecular weight substances.
- a pharmaceutical composition of the invention is formulated to be compatible with its intended route of administration.
- routes of administration include parenteral, e.g., intravenous, intradermal, subcutaneous, oral (e.g., inhalation), transdermal
- Solutions or suspensions used for parenteral, intradermal, or subcutaneous application can include the following components: a sterile diluent such as water for injection, saline solution, fixed oils, polyethylene glycols,
- glycerine propylene glycol or other synthetic solvents
- antibacterial agents such as benzyl alcohol or methyl parabens
- antioxidants such as ascorbic acid or sodium bisulfite
- chelating agents such as
- ethylenediaminetetraacetic acid ethylenediaminetetraacetic acid
- buffers such as acetates, citrates or phosphates
- agents for the adjustment of tonicity such as sodium chloride or dextrose.
- the pH can be adjusted with acids or bases, such as hydrochloric acid or sodium hydroxide.
- the parenteral preparation can be enclosed in ampoules, disposable syringes or multiple dose vials made of glass or plastic.
- compositions suitable for injectable use include sterile aqueous solutions (where water soluble) or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersion.
- suitable carriers include physiological saline, bacteriostatic water, Cremophor ELTM (BASF, Parsippany, N.J.) or phosphate buffered saline (PBS) .
- the composition should be sterile and should be fluid to the extent that easy syringeability exists. It should be stable under the conditions of manufacture and storage and should be preserved against the contaminating action of microorganisms such as bacteria and fungi.
- the carrier can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, and liquid
- polyethylene glycol, and the like polyethylene glycol, and the like) , and suitable mixtures thereof.
- the proper fluidity can be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants.
- Prevention of the action of microorganisms can be achieved by various antibacterial and antifungal agents, for example, parabens, chlorobutanol , phenol, ascorbic acid, thimerosal, and the like.
- isotonic agents for example, sugars, or polyalcohois such as manitol, sorbitol, and sodium chloride in the
- Prolonged absorption of the injectable compositions can be brought about by including in the composition an agent which delays absorption, for example, aluminum monostearate and gelatin.
- Sterile injectable solutions can be prepared by incorporating the active compound in the required amount in an appropriate solvent with one or a combination of ingredients enumerated above, as required, followed by filtered sterilization.
- dispersions are prepared by incorporating the active compound into a sterile vehicle that contains a basic dispersion medium and the required other ingredients from those enumerated above.
- methods of preparation are vacuum drying and freeze drying that yields a powder of the active ingredient plus any additional desired ingredient from a previously sterile filtered solution thereof.
- Oral compositions generally include an inert diluent or an edible carrier. They can be enclosed in gelatin capsules or compressed into tablets. For the purpose of oral therapeutic administration, the active compound can be incorporated with excipients and used in the form of tablets, troches, or capsules. Oral compositions can also be prepared using a fluid carrier for use as a mouthwash, wherein the compound in the fluid carrier is applied orally and swished and expectorated or swallowed.
- compositions can contain any of the following ingredients, or compounds of a similar nature: a binder such as microcrystalline cellulose, gum tragacanth or gelatin; an excipient such as starch or lactose, a disintegrating agent such as alginic acid, Primogel, or corn starch; a lubricant such as magnesium stearate or Sterotes; a glidant such as colloidal silicon dioxide; a sweetening agent such as sucrose or saccharin; or a flavoring agent such as peppermint, methyl salicylate, or orange flavoring.
- a binder such as microcrystalline cellulose, gum tragacanth or gelatin
- an excipient such as starch or lactose, a disintegrating agent such as alginic acid, Primogel, or corn starch
- a lubricant such as magnesium stearate or Sterotes
- a glidant such as colloidal silicon dioxide
- a sweetening agent such as sucrose or saccharin
- the compounds are delivered in the form of an aerosol spray from pressured container or dispenser which contains a suitable
- propellant e.g., a gas such as carbon dioxide, or a nebulizer .
- Systemic administration can also be by transmucosal or transdermal means.
- penetrants appropriate to the barrier to be permeated are used in the formulation.
- penetrants are generally known in the art, and include, for example, for transmucosal administration, detergents, bile salts, and fusidic acid derivatives.
- Transmucosal administration can be accomplished through the use of nasal sprays or
- the active compounds are formulated into ointments, salves, gels, or creams as generally known in the art.
- the compounds can also be prepared in the form of suppositories (e.g., with conventional suppository bases such as cocoa butter and other glycerides) or retention enemas for rectal delivery.
- the active compounds are prepared with carriers that will protect the compound against rapid elimination from the body, such as a controlled release formulation, including implants and microencapsulated delivery systems.
- Biodegradable, biocompatible polymers can be used, such as ethylene vinyl acetate,
- polyanhydrides polyglycolic acid, collagen,
- Liposomal suspensions can also be used as pharmaceutically acceptable carriers. These can be prepared according to methods known to those skilled in the art, for example, as described in U.S. Pat. No. 4,522,811, incorporated fully herein by reference.
- Dosage unit form refers to physically discrete units suited as unitary dosages for the subject to be treated; each unit containing a predetermined quantity of active compound calculated to produce the desired therapeutic effect in association with the required pharmaceutical carrier.
- the specification for the dosage unit forms of the invention are dictated by and directly dependent on the unique characteristics of the active compound and the particular therapeutic effect to be achieved.
- the pharmaceutical compositions and agents described herein can be included in a container, pack, or dispenser together with instructions for administration.
- pancreatic beta cell degeneration is intended to mean loss of beta cell function (particularly insulin production and/or secretion), beta cell
- beta cells such as necrosis or apoptosis of beta cells.
- treating is defined as the application or administration of a therapeutic agent to a patient, or application or administration of a therapeutic agent to an isolated tissue or cell line from a patient, said patient having a disease, a symptom of disease or a predisposition toward a disease, with the purpose to cure, heal, alleviate, relieve, alter, remedy, ameliorate, improve or affect the disease, the symptoms of disease or the predisposition toward disease.
- treating may include suppressing, inhibiting, preventing, treating, or a combination thereof. Treating refers, inter alia, to increasing time to sustained progression, expediting remission, inducing remission, augmenting remission, speeding recovery, increasing efficacy of or decreasing resistance to alternative therapeutics, or a combination thereof.
- “Suppressing” or “inhibiting” refers, inter alia, to delaying the onset of symptoms, preventing relapse to a disease, decreasing the number or frequency of relapse episodes, increasing latency between symptomatic episodes, reducing the severity of symptoms, reducing the severity of an acute episode, reducing the number of symptoms, reducing the incidence of disease-related symptoms, reducing the latency of symptoms, ameliorating symptoms, reducing secondary symptoms, reducing secondary infections,
- symptoms are primary, while in another embodiment symptoms are secondary.
- Primary refers to a symptom that is a direct result of a disorder, e.g., diabetes
- secondary refers to a symptom that is derived from or consequent to a primary cause.
- Symptoms may be any manifestation of a disease or pathological
- pancreatic beta cell mass can be increased by administering to an animal (e.g., a human) a compound that increases TD26 level or activity in a tissue or cell (e.g., TD26 protein) .
- an animal e.g., a human
- a compound that increases TD26 level or activity in a tissue or cell e.g., TD26 protein
- beta cell proliferation and “beta cell replication” are used interchangeably.
- Increased beta cell mass occurs via increased proliferation or replication of beta cells, enhanced differentiation of precursor cells to a beta cell lineage, and/or or diminished beta cell turnover or death.
- the increase in ⁇ -cell mass can be at least 5%, 10%, 20%, 30%, 40%, 50%, 50%, 70%, 80%, 90%, 1-fold, 2-fold, 5-fold, 10-fold, 50-fold, 100-fold or more compared to the ⁇ -cell mass prior to onset of treatment.
- ⁇ -cell replication means that ⁇ -cells replicate at a faster rate and/or more frequently.
- ⁇ -cell replication is increased by at least 5%, 10%, 20%, 30%, 40%, 50%, 50%, 70%, 80%, 90%, 1- fold, 1.1-fold, 1.5-fold, 2-fold, 3-fold, 4-fold, 5-fold, 10-fold, 50-fold, 100-fold or more higher relative to an untreated control.
- the % or fold increase in ⁇ -cell replication can be determined by measuring number of replicating ⁇ -cells during or after treatment with a compound described herein relative to a control.
- Increase in replication can also be based on ratios of replicating cells to total number of cells in the respective treated and untreated control. In some embodiments, total numbers of cells in the treated and untreated controls are used to determine the replication frequency.
- "increasing ⁇ -cell replication” also includes an increase in ⁇ -cell number due to
- “increasing ⁇ -cell replication” does not include an increase in ⁇ -cell number due to differentiation of ⁇ -cell progenitors into ⁇ -cells.
- ⁇ -cell replication can be monitored by any method known in the art for measuring cell replication.
- ⁇ -cell replication can be determined by measuring the expression of at least one cell replication marker, e.g., Ki-67 or PH3.
- Ki-67 e.g., Ki-67 or PH3.
- a non-limiting example is the quantitative
- Increase in ⁇ -cell replication can also be based on an increase in the total number of ⁇ -cells in the treated versus untreated control. In some instances, increased ⁇ - cell replication can be based on the ratio of ⁇ -cells to total cells for the treated and untreated controls. ⁇ - cell replication can be measured by monitoring the number of cells co-expressing Ki-67 and/or PH3, and PDX-1.
- ⁇ -cell replication can be evaluated indirectly by measuring blood insulin levels.
- blood insulin level is an indirect measure of the number of ⁇ -cells, e.g., ⁇ -cell mass in the subject. Therefore, blood insulin levels before and after onset of treatment can indirectly provide a relative measure of number of ⁇ -cells in the subject before and after onset of treatment.
- ⁇ -cell mass in a subject can also be determined by measuring the fasting blood glucose concentration in the subject.
- [11C]DTBZ (dihydrotetrabenazine) , which specifically binds to V AT2, by ⁇ -cells can be measured by positron emission tomography (P.E.T.) scanning.
- P.E.T. positron emission tomography
- a therapeutically effective amount of a compound described herein can be administered to a subject.
- Methods of administering compounds to a subject are known in the art and easily available to one of skill in the art. Examples of such routes include
- Parenteral administration is usually by injection, and includes, without limitation, intravenous, intramuscular, intraarterial, intrathecal, intraventricular,
- Administration can be systemic administration, or localized, as determined necessary by the skilled practitioner .
- Cell proliferation may be determined via any number of methods well known in the art and as exemplified herein, for example via measuring uptake of a labeled substrate, such as tritiated thymidine.
- Tissues and cells may be in direct contact with agents and compositions of the invention, or exposed indirectly, through methods well described in the art.
- cells can be grown in culture media in vitro, wherein the media is supplemented with polypeptides, nucleic acids, vectors or other agents described herein.
- the cells being contacted are primary cultures.
- primary culture denotes a mixed cell population that permits interaction of many different cell types isolated from a tissue.
- a primary culture may be a purified cell population isolated from a tissue.
- the primary culture may be enriched for a particular population.
- enrichment may comprise cell sorting via means well known in the art, such as, for example fluorescent activated cell sorting (FACS), for cell populations, for example,
- FACS fluorescent activated cell sorting
- contacting a cell may include any route of administration to a subject, for example, oral or parenteral administration of a polypeptide, peptide, nucleic acid, vector or composition of this invention to a subject, wherein administration results in in vivo cellular exposure to these materials, within specific sites within a body.
- the methods comprise a step of administering the contacted cell to the subject, such as, for example, ex vivo cellular therapy.
- the cells administered to the subject are autologous or in another embodiment, allogenic with respect to the subject.
- blood insulin As further described herein, blood insulin
- concentration is increased by administering to a subject an agent that increases TD26 level or activity.
- blood glucose levels can be decreased by administering to a subject a compound that increases TD26 level or activity.
- blood glucose levels decrease to normal levels, i.e., to blood glucose levels of a healthy individual without a disease.
- the subject is a human subject or patient.
- the subject is suffering from or is susceptible to developing a disorder associated with aberrant insulin production or
- disorders include, but are not limited to, diabetes (e.g., Type I or Type II), gestational diabetes, prediabetes, obesity, hyperglycemia, glucose intolerance, insulin resistance, hyperinsulinemia, metabolic syndrome, or syndrome X.
- diabetes e.g., Type I or Type II
- gestational diabetes prediabetes
- obesity e.g., obesity
- hyperglycemia e.g., obesity
- glucose intolerance e.g., glucose intolerance
- insulin resistance e.g., hyperinsulinemia
- metabolic syndrome e.g., or syndrome X.
- syndrome X e.g., abetes
- Subjects suffering from or at risk of such disorder are identified by methods known in the art.
- diabetes can be diagnosed by art-recognized diagnosis and treatment recommendations, e.g., from the American Diabetes Association.
- Obesity is diagnosed for example, by body mass index.
- Body mass index (BMI) is measured (kg/m2 (or lb/in2 X 704.5)).
- waist circumference estimates fat distribution
- waist-to-hip ratio estimates fat distribution
- skinfold thickness if measured at several sites, estimates fat distribution
- bioimpedance based on principle that lean mass conducts current better than fat mass (i.e., fat mass impedes current) is measured.
- Overweight individuals are characterized as having a waist circumference of >94 cm for men or >80 cm for women and waist to hip ratios of > 0.95 in men and > 0.80 in women.
- Obese individuals are characterized as having a BMI of 30 to 34.9, being greater than 20% above "normal" weight for height, having a body fat percentage > 30% for women and 25% for men, and having a waist circumference >102 cm (40 inches) for men or 88 cm (35 inches) for women.
- Alleviation of one or more symptoms of the disorder indicates that the compound confers a clinical benefit.
- Any of the therapeutic methods described to above may be applied to any suitable subject including, for example, mammals such as dogs, cats, cows, horses, rabbits, monkeys, and most preferably, humans.
- treatment means delaying or preventing the onset of such a disease or disorder, reversing,
- the symptoms of a disease or disorder are alleviated by at least 5%, at least 10%, at least 20%, at least 30%, at least 40%, or at least 50%. In another embodiment, symptoms are alleviated such that the condition of the patient is close or equal to normal humans not suffering from the condition.
- Treatment of Diabetes is determined by standard medical methods .
- a goal of Diabetes treatment is to bring sugar levels down to as close to normal as is safely possible. Commonly set goals are 80-120 milligrams per deciliter (mg/dl) before meals and 100-140 mg/dl at bedtime. Treatment goals may also be defined via HbAlc levels.
- a particular physician may set different targets for the patient, depending on other factors, such as how often the patient has low blood sugar reactions.
- Useful medical tests include tests on the patient's blood and urine to determine blood sugar level, tests for
- HbAlc glycosylated hemoglobin level
- treatment program can also be determined by having fewer patients in the program with complications relating to Diabetes, such as diseases of the eye, kidney disease, or nerve disease.
- Other symptoms of diabetes include for example frequent urination, excessive thirst, extreme hunger, unusual weight loss, increased fatigue, irritability, or blurry vision.
- Delaying the onset of diabetes in a subject refers to delay of onset of at least one symptom of diabetes, e.g., hyperglycemia, hypoinsulinemia, diabetic retinopathy, diabetic nephropathy, blindness, memory loss, renal failure, cardiovascular disease (including coronary artery disease, peripheral artery disease, cerebrovascular disease, atherosclerosis, and hypertension) , neuropathy, autonomic dysfunction, hyperglycemic hyperosmolar coma, or combinations thereof, for at least 1 week, at least 2 weeks, at least 1 month, at least 2 months, at least 6 months, at least 1 year, at least 2 years, at least 5 years, at least 10 years, at least 20 years, at least 30 years, at least 40 years or more, and can include the entire lifespan of the subject.
- symptom of diabetes e.g., hyperglycemia, hypoinsulinemia, diabetic retinopathy, diabetic nephropathy, blindness, memory loss, renal failure, cardiovascular disease (including coronary artery disease
- the invention also provides methods of identifying a candidate therapeutic agent for treatment of a disorder associated with a reduced level of endogenous insulin or with insulin resistance comprising contacting a suitable cell with a test agent; and determining the effect of said test agent on level or activity of TD26, wherein a test agent which increases TD26 level or activity is a candidate therapeutic agent for treatment of a disorder associated with a reduced level of endogenous insulin.
- the invention provides a method of identifying a candidate therapeutic agent for treatment of a disorder associated with a reduced level of endogenous insulin comprising contacting a suitable cell with a test agent; and determining the effect of said test agent on level or activity of TD26, wherein a test agent which increases TD26 level or activity is a candidate therapeutic agent for treatment of a disorder associated with a reduced level of endogenous insulin.
- the invention provides a method of identifying a candidate therapeutic agent for treating or preventing a disorder associated with resistance to endogenous insulin comprising contacting a suitable cell with a test agent; and
- test agent which increases TD26 level or activity is a candidate therapeutic agent for treating or preventing a disorder associated with
- the effect of said test agent on level or activity of TD26 is assessed by determining the effect of said test agent on gene expression level of TD26. For example, gene
- expression can be assessed using a variety of methods known in the art, including PCR and microarray analysis.
- Candidate therapeutic agents can be further assessed using additional methods tailored to specific functional effects if desired.
- the present invention also contemplates methods of diagnosing TD26-related disorders in an individual
- TD26 levels in a sample obtained from an individual suspected of suffering from a TD26- related disorder.
- the determination of TD26 levels in a sample obtained from an individual can be used to determine how to care for the TD26-related disorder in the individual. For example, since reduced or decreased TD26 levels are associated with decreased beta cell proliferation, reduced endogenous insulin production, and/or resistance to endogenous insulin, e.g., diabetes, a health-care provider can use the information pertaining to TD26 levels to assist in
- the level of TD26 which is indicative of a TD26- related condition may be defined as the decreased level present in samples from individuals known to have a TD26- related disorder over the TD26 level in samples from individuals known to be free of a TD26-related disorder.
- the level of TD26 may be !, for example, at least 1, .1 fold,
- the TD26 protein is detected and/or quantified in the sample using any of a number of well recognized
- the TD26 protein in the sample can also be detected and quantified using immunoblot
- Immunoblotting generally comprises separating sample proteins by gel electrophoresis on the basis of molecular weight, transferring the separated proteins to a suitable solid support, (such as a
- antibodies specifically bind to TD26 on the solid support. These antibodies may be directly labeled or alternatively may be subsequently detected using labeled antibodies (e.g., labeled sheep anti-mouse antibodies) that
- quantitative assays of TD26 are deemed to show a positive result, e.g., elevated or decreased TD26 level, when the measured TD26 protein level is greater or less than the level measured or known for a control sample (e.g. either a level known or measured for a normal healthy individual or a "baseline/reference" level determined at a different time for the same individual.
- the assay is deemed to show a positive result when the difference between sample and "control" is statistically significant (e.g. at the 85% or greater, preferably at the 90% or greater, more
- a method of diagnosing a TD26- related disorder in a test individual comprises
- a method of diagnosing a TD26- related disorder in an individual comprises detecting TD26 levels in a sample from said individual, wherein TD26 level that is decreased compared to a previous TD26 level in said individual is indicative of a TD26-related disorder.
- said TD-26 related disorder is characterized by one or more of decreased beta cell proliferation, reduced levels of endogenous insulin, and reduced sensitivity to endogenous insulin. In some aspects, said TD-26 related disorder is Type 1 or Type 2 diabetes .
- Fig. 1 beta cell replication
- Fig. 2 shows sequence information for mouse gene EG624219 and human TD26. Note that the sequence predicts a signal peptide, indicating that TD26 is a secreted protein.
- the results of a search of publicly available databases from experiments in which mRNA abundance is measured using transcriptional arrays are shown in Fig 3. Note the unusually specific expression of TD26 in human samples.
- mice were injected via tail vein with plasmid DNA containing a strong promoter driving the expression of a cDNA encoding EG624219 protein.
- Tail vein injection of DNA in mice causes the DNA to be expressed in liver cells (Rossmanith et al . , DNA and Cell Biology 21 ( 11 ) : 8 7-853 (2002)) . Liver expression was confirmed with controls showing green fluorescent protein (GFP) in liver following injection of DNA encoding GFP.
- GFP green fluorescent protein
- EG624319 appears to be a gene having orthologs found in mammals, for example human, rat, and mice, but not other vertebrates (Fig. 5).
- a preliminary sequence analysis fails to provide evidence for TD26 orthologs in chicks, frogs, fish, and other non-mammalian species.
- Mus musculus reference protein sequence database (Database ame: gp/10090.9559/mm_refp) was searched using the same blast program and parameters and NP__001074409.1 (mouse TD26 ortholog protein sequence) as probe.
- a multiple alignment of the protein sequences of TD26, Angptl3, and Angptl4 of Homo sapiens and Mus musculus was prepared using the w clustalw2" program (Larkin et al., Bioinformatics
- Both Angptl3 and Angptl4 are secreted proteins, having an N-terminal signal peptide, an N-terminal coiled-coil domain (CCD) , a short linker and a C-terminal fibrinogen-like domain (FLD) .
- the linker can be cleaved by proprotein convertases, releasing the CCD and the FLD as separate fragments into the circulation.
- TD26 The result for human TD26 is shown in Fig. 10.
- Fig. 10 There are two possible regions of coiled-coil structure, ranging from position 79 to 140 and from position 165 to 194. While the prediction is not unambiguous for the first region, it is conclusive for the second region. Overall the predicted structure strongly resembles the CCD of Angptl3 and 4 (Miida & Hirayama, Curr Opin Lipidol. 22(l) :70-75 (Feb. 2010) ) .
- TD26 is a secreted protein showing all structural features identified so far in the CCD fragments of Angptl3 and Angptl4. Both proteins, and especially their CCD fragments, have been shown to act as inhibitors of Lipoprotein Lipase (LPL) , affecting triglyceride-rich lipoprotein and HDL metabolism
- TD26 Since the amino acid residues of Angptl3 and Angptl4 involved in the inhibition of LPL activity are conserved in TD26, it is reasonable to assume that TD26 also plays a role in the regulation of LPL and triglyceride metabolism.
- S661 was administered subcutaneously in vehicle to C57B1/6 mice 3 times daily at the following doses 1 mg/kg 0.5 mg/kg; 0.25 mg/kg or 0.125 mg/kg bodyweight for a period of 4 days.
- BrdU was administered once daily at a dose of 100 mg/kg for the same period.
- the pancreas was removed and fixed in PFA. Paraffin embedded sections were stained for insulin, DAPI and BrdU.
- the incorporation of BrdU in replicating beta cells was analyzed using an automated script on images generated on a Zeiss Axioimager Z2.
- Fig. 12 shows that in comparison to vehicle alone, S661 treatment resulted in a 2-fold (3 times daily dose of S661 of 0.125 mg/kg) to a 5-fold (3 times daily dose of S661 of 1 mg/kg) increase in ⁇ -cell replication.
- S661 was administered subcutaneously in vehicle to C57B1/6 mice as once daily injections of 1 mg/kg bodyweight for a period of 4 days.
- BrdU was administered once daily at a dose of 100 mg/kg for the same period.
- pancreas was removed and the replication of beta cell was measured by flow
- Fig. 13 shows that S661 treatment resulted in about a 5 fold increase in the percentage of beta cell replication as compared to vehicle alone.
- C57B1/6 mice were fed a high fat diet for 17 weeks.
- S661 was administered subcutaneously in vehicle to DIO mice at doses of 3 times 1 mg/kg or 0.125 mg/kg bodyweight for a period of 4 days.
- BrdU was administered once daily at a dose of 100 mg/kg for the same period.
- the pancreas was removed and fixed in PFA.
- Deletion mutants of mouse TD26 polypeptide were each cloned into expression vectors containing a strong promoter driving the expression of a cDNA encoding the polypeptide and an N-terminus IgK signal peptide to facilitate secretion. It should be appreciated by those skilled in the art that the N-terminus IgK signal peptide is not present in the secreted deletion mutants. Plasmids were injected via tail vein into 8 week old male imprinting control region (ICR) mice. Ki67 was used as a marker for replication. The control was a plasmid encoding GFP, and beta ceil replication rates were analyzed after 6 days. As shown in Fig. 15, portions of the TD26 protein were able to elicit beta cell replication.
- ICR imprinting control region
- SEQ ID NO: 1 - human TD26 amino acid sequence (includes predicted signal sequence); GENBANKTM Accession No. NP_061157.3
- SEQ ID NO: 5 human TD26 amino acid sequence (includes portion of predicted signal sequence)
- SEQ ID NO: 6 human angiopoietin-related protein 3
- SEQ ID NO: 7 mouse TD26 ortholog (EG624219) amino acid sequence (includes portion of predicted signal sequence )
- SEQ ID NO: 8 mouse angiopoietin-related protein 3 precursor amino acid sequence
- SEQ ID NO: 9 human angiopoietin-related protein 3
- precursor amino acid sequence includes additional predicted signal sequence as compared with SEQ ID NO:
- SEQ ID NO: 10 mouse angiopoietin-related protein 3
- precursor amino acid sequence includes additional predicted signal sequence as compared with SEQ ID NO: 8.
- SEQ ID NO: 12 mouse angiopoietin-related protein 4
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Engineering & Computer Science (AREA)
- Chemical & Material Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Molecular Biology (AREA)
- Organic Chemistry (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Hematology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Diabetes (AREA)
- Biomedical Technology (AREA)
- Immunology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Urology & Nephrology (AREA)
- Endocrinology (AREA)
- Biotechnology (AREA)
- Biochemistry (AREA)
- Genetics & Genomics (AREA)
- Cell Biology (AREA)
- Pathology (AREA)
- Microbiology (AREA)
- Food Science & Technology (AREA)
- Physics & Mathematics (AREA)
- Analytical Chemistry (AREA)
- Toxicology (AREA)
- General Physics & Mathematics (AREA)
- Epidemiology (AREA)
- Obesity (AREA)
- Tropical Medicine & Parasitology (AREA)
- Gastroenterology & Hepatology (AREA)
- Biophysics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Zoology (AREA)
Priority Applications (6)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP12797387.3A EP2717924A4 (en) | 2011-06-10 | 2012-06-10 | MODULATION OF BETA CELL PROLIFERATION IN THE PANCREATIC GLAND |
| AU2012267492A AU2012267492A1 (en) | 2011-06-10 | 2012-06-10 | Modulation of pancreatic beta cell proliferation |
| JP2014514917A JP2014523871A (ja) | 2011-06-10 | 2012-06-10 | 膵臓ベータ細胞増殖の調整 |
| US14/125,276 US20140303078A1 (en) | 2011-06-10 | 2012-06-10 | Modulation of pancreatic beta cell proliferation |
| CA2838824A CA2838824A1 (en) | 2011-06-10 | 2012-06-10 | Modulation of pancreatic beta cell proliferation |
| CN201280036842.1A CN104039357A (zh) | 2011-06-10 | 2012-06-10 | 胰腺β-细胞增殖的调节 |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201161495868P | 2011-06-10 | 2011-06-10 | |
| US61/495,868 | 2011-06-10 | ||
| US201261613856P | 2012-03-21 | 2012-03-21 | |
| US61/613,856 | 2012-03-21 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2012170977A1 true WO2012170977A1 (en) | 2012-12-13 |
Family
ID=47296512
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2012/041804 Ceased WO2012170977A1 (en) | 2011-06-10 | 2012-06-10 | Modulation of pancreatic beta cell proliferation |
Country Status (7)
| Country | Link |
|---|---|
| US (1) | US20140303078A1 (enExample) |
| EP (1) | EP2717924A4 (enExample) |
| JP (1) | JP2014523871A (enExample) |
| CN (1) | CN104039357A (enExample) |
| AU (1) | AU2012267492A1 (enExample) |
| CA (1) | CA2838824A1 (enExample) |
| WO (1) | WO2012170977A1 (enExample) |
Cited By (11)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2014141165A1 (en) * | 2013-03-15 | 2014-09-18 | Universite De Geneve | Use of insulin signaling antagonists, optionally in combination of transfection of non-beta cells, for inducing insulin production |
| US20150376264A1 (en) * | 2013-01-11 | 2015-12-31 | The California Institute For Biomedical Research | Bovine fusion antibodies |
| WO2016054494A1 (en) * | 2014-10-03 | 2016-04-07 | Ngm Biopharmaceuticals, Inc. | Methods and compositions for treatment of conditions associated with elevated triglycerides |
| KR20160127133A (ko) * | 2014-03-12 | 2016-11-02 | 뉴리뮨 홀딩 아게 | 섬 아밀로이드 폴리펩티드(iapp) 유도된 베타-세포 부상 및 손상된 글루코오스 내성을 길항할 수 있는 신규한 화합물 |
| JP2016537008A (ja) * | 2013-09-06 | 2016-12-01 | プレジデント アンド フェローズ オブ ハーバード カレッジ | Cas9バリアントおよびその使用 |
| CN107922478A (zh) * | 2015-08-07 | 2018-04-17 | 瑞泽恩制药公司 | 抗angptl8抗体及其用途 |
| US10562980B2 (en) | 2012-01-09 | 2020-02-18 | The Scripps Research Institute | Humanized antibodies |
| US10640574B2 (en) | 2013-07-18 | 2020-05-05 | Taurus Biosciences, Llc | Humanized antibodies with ultralong complementary determining regions |
| US10774139B2 (en) | 2017-11-10 | 2020-09-15 | Ngm Biopharmaceuticals, Inc. | ANGPTL8-binding agents and methods of use thereof |
| US10774132B2 (en) | 2012-01-09 | 2020-09-15 | The Scripps Research Instittue | Ultralong complementarity determining regions and uses thereof |
| US11161891B2 (en) | 2015-12-09 | 2021-11-02 | The Scripps Research Institute | Relaxin immunoglobulin fusion proteins and methods of use |
Families Citing this family (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2017062363A1 (en) * | 2015-10-05 | 2017-04-13 | Joslin Diabetes Center | Methods of use of betatrophin |
Citations (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20030195147A1 (en) * | 1998-09-02 | 2003-10-16 | Renuka Pillutla | Insulin and IGF-1 receptor agonists and antagonists |
| US20070203083A1 (en) * | 2003-06-13 | 2007-08-30 | Mootha Vamsi K | Methods Of Regulating Metabolism And Mitochondrial Function |
| US20090197805A1 (en) * | 2005-10-05 | 2009-08-06 | Novo Nordisk A/S | Insulin receptor antagonists and related compositions, uses and methods |
| US20090232893A1 (en) * | 2007-05-22 | 2009-09-17 | Bader Andreas G | miR-143 REGULATED GENES AND PATHWAYS AS TARGETS FOR THERAPEUTIC INTERVENTION |
| US20100048409A1 (en) * | 2006-09-13 | 2010-02-25 | Gerard Karsenty | Methods for identifying or assaying for agents that increase beta-cell proliferation, insulin secretion, insulin sensitivity, glucose tolerance and decrease fat mass |
| US20110097330A1 (en) * | 2005-03-11 | 2011-04-28 | Genentech, Inc. | Novel Gene Disruptions, Compostitions and Methods Relating Thereto |
Family Cites Families (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20070055056A1 (en) * | 1997-03-07 | 2007-03-08 | Rosen Craig A | 251 human secreted proteins |
| AU8555298A (en) * | 1997-08-01 | 1999-02-22 | Genset | 5' ests for secreted proteins expressed in endoderm |
| CN101130768B (zh) * | 2006-08-22 | 2010-05-12 | 复旦大学 | 核苷酸分子sr1b及其在制备抗糖尿病药物中的应用 |
-
2012
- 2012-06-10 EP EP12797387.3A patent/EP2717924A4/en not_active Withdrawn
- 2012-06-10 US US14/125,276 patent/US20140303078A1/en not_active Abandoned
- 2012-06-10 AU AU2012267492A patent/AU2012267492A1/en not_active Abandoned
- 2012-06-10 JP JP2014514917A patent/JP2014523871A/ja active Pending
- 2012-06-10 CA CA2838824A patent/CA2838824A1/en not_active Abandoned
- 2012-06-10 CN CN201280036842.1A patent/CN104039357A/zh active Pending
- 2012-06-10 WO PCT/US2012/041804 patent/WO2012170977A1/en not_active Ceased
Patent Citations (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20030195147A1 (en) * | 1998-09-02 | 2003-10-16 | Renuka Pillutla | Insulin and IGF-1 receptor agonists and antagonists |
| US20070203083A1 (en) * | 2003-06-13 | 2007-08-30 | Mootha Vamsi K | Methods Of Regulating Metabolism And Mitochondrial Function |
| US20110097330A1 (en) * | 2005-03-11 | 2011-04-28 | Genentech, Inc. | Novel Gene Disruptions, Compostitions and Methods Relating Thereto |
| US20090197805A1 (en) * | 2005-10-05 | 2009-08-06 | Novo Nordisk A/S | Insulin receptor antagonists and related compositions, uses and methods |
| US20100048409A1 (en) * | 2006-09-13 | 2010-02-25 | Gerard Karsenty | Methods for identifying or assaying for agents that increase beta-cell proliferation, insulin secretion, insulin sensitivity, glucose tolerance and decrease fat mass |
| US20090232893A1 (en) * | 2007-05-22 | 2009-09-17 | Bader Andreas G | miR-143 REGULATED GENES AND PATHWAYS AS TARGETS FOR THERAPEUTIC INTERVENTION |
Non-Patent Citations (6)
| Title |
|---|
| CLARK ET AL.: "The Secreted Protein Discovery Initiative (SPDI), a Large-Scale Effort to Identify Novel Human Secreted and Transmembrane Proteins: A Bioinformatics Assessment", GENOME RESEARCH, vol. 13, 1 September 2003 (2003-09-01), pages 2265 - 2270, XP001189293 * |
| POSPISILIK ET AL.: "Dipeptidyl Peptidase IV Inhibitor Treatment Stimulates Beta-Cell Survival and Islet Neogenesis in Streptozotocin-Induced Diabetic Rats", DIABETES, vol. 52, 1 March 2003 (2003-03-01), pages 741 - 750, XP002260040 * |
| REN ET AL.: "Identification of RIFL, a novel adipocyte-enriched insulin target gene with a role in lipid metabolism", AMERICAN JOUMAL OF PHYSIOLOGY - ENDOCRINOLOGY AND METABOLISM, vol. 303, 8 May 2012 (2012-05-08), pages E334 - E351, XP055135724 * |
| RHODES: "Type 2 Diabetes-a Matter of Beta-Cell Life and Death?", SCIENCE, vol. 307, 21 January 2005 (2005-01-21), pages 380 - 384, XP055135719 * |
| See also references of EP2717924A4 * |
| VIKRAM ET AL.: "S961, an Insulin Receptor Antagonist Causes Hyperinsulinemia, Insulin-Resistance, and Depletion of Energy Stores in Rats", BIOCHEMICAL AND BIOPHYSICAL RESEARCH COMMUNICATIONS, vol. 389, 19 June 2010 (2010-06-19), pages 260 - 265, XP027165651 * |
Cited By (22)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11390665B2 (en) | 2012-01-09 | 2022-07-19 | The Scripps Research Institute | Ultralong complementarity determining regions and uses thereof |
| US10774132B2 (en) | 2012-01-09 | 2020-09-15 | The Scripps Research Instittue | Ultralong complementarity determining regions and uses thereof |
| US10562980B2 (en) | 2012-01-09 | 2020-02-18 | The Scripps Research Institute | Humanized antibodies |
| US10259863B2 (en) * | 2013-01-11 | 2019-04-16 | The California Institute For Biomedical Research | Bovine fusion antibodies |
| US20150376264A1 (en) * | 2013-01-11 | 2015-12-31 | The California Institute For Biomedical Research | Bovine fusion antibodies |
| WO2014141165A1 (en) * | 2013-03-15 | 2014-09-18 | Universite De Geneve | Use of insulin signaling antagonists, optionally in combination of transfection of non-beta cells, for inducing insulin production |
| US11530493B2 (en) | 2013-07-18 | 2022-12-20 | Taurus Biosciences, Llc | Humanized antibodies with ultralong complementary determining regions |
| US10640574B2 (en) | 2013-07-18 | 2020-05-05 | Taurus Biosciences, Llc | Humanized antibodies with ultralong complementary determining regions |
| JP2016537008A (ja) * | 2013-09-06 | 2016-12-01 | プレジデント アンド フェローズ オブ ハーバード カレッジ | Cas9バリアントおよびその使用 |
| JP2017510571A (ja) * | 2014-03-12 | 2017-04-13 | ニューリミューン ホールディング エイジー | 膵島アミロイドポリペプチド(IAPP)誘導性のβ細胞損傷及び耐糖能障害に拮抗作用を示す新規化合物 |
| US10544213B2 (en) | 2014-03-12 | 2020-01-28 | Neurimmune Holding Ag | Compounds capable of antagonizing islet amyloid polypeptide (IAPP) induced beta-cell damage and impaired glucose tolerance |
| KR102342087B1 (ko) | 2014-03-12 | 2021-12-27 | 뉴리뮨 홀딩 아게 | 섬 아밀로이드 폴리펩티드(iapp) 유도된 베타-세포 부상 및 손상된 글루코오스 내성을 길항할 수 있는 신규한 화합물 |
| KR20160127133A (ko) * | 2014-03-12 | 2016-11-02 | 뉴리뮨 홀딩 아게 | 섬 아밀로이드 폴리펩티드(iapp) 유도된 베타-세포 부상 및 손상된 글루코오스 내성을 길항할 수 있는 신규한 화합물 |
| US20190060408A1 (en) * | 2014-10-03 | 2019-02-28 | Ngm Biopharmaceuticals, Inc. | Methods and compositions for treatment of conditions associated with elevated triglycerides |
| US10071139B2 (en) | 2014-10-03 | 2018-09-11 | Ngm Biopharmaceuticals, Inc. | Methods for treatment of conditions associated with elevated triglycerides with an ANGPTL8 polypeptide fragment |
| US10702587B2 (en) | 2014-10-03 | 2020-07-07 | Ngm Biopharmaceuticals, Inc. | Angiopoietin-like protein 8 polypeptide fragments and compositions thereof |
| WO2016054494A1 (en) * | 2014-10-03 | 2016-04-07 | Ngm Biopharmaceuticals, Inc. | Methods and compositions for treatment of conditions associated with elevated triglycerides |
| CN107922478A (zh) * | 2015-08-07 | 2018-04-17 | 瑞泽恩制药公司 | 抗angptl8抗体及其用途 |
| US11161891B2 (en) | 2015-12-09 | 2021-11-02 | The Scripps Research Institute | Relaxin immunoglobulin fusion proteins and methods of use |
| US12275771B2 (en) | 2015-12-09 | 2025-04-15 | The Scripps Research Institute | Relaxin immunoglobulin fusion proteins and methods of use |
| US10774139B2 (en) | 2017-11-10 | 2020-09-15 | Ngm Biopharmaceuticals, Inc. | ANGPTL8-binding agents and methods of use thereof |
| US11566067B2 (en) | 2017-11-10 | 2023-01-31 | Ngm Biopharmaceuticals, Inc. | Methods of lowering triglyceride levels with an ANGPTL8-binding antibody or antigen-binding fragment thereof |
Also Published As
| Publication number | Publication date |
|---|---|
| CA2838824A1 (en) | 2012-12-13 |
| AU2012267492A1 (en) | 2014-01-09 |
| US20140303078A1 (en) | 2014-10-09 |
| CN104039357A (zh) | 2014-09-10 |
| JP2014523871A (ja) | 2014-09-18 |
| EP2717924A4 (en) | 2015-04-22 |
| EP2717924A1 (en) | 2014-04-16 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20140303078A1 (en) | Modulation of pancreatic beta cell proliferation | |
| JP5299900B2 (ja) | 糖尿病関連肝臓由来分泌タンパク質の2型糖尿病または血管障害の診断または治療への利用 | |
| CN112168969B (zh) | Ddit4l及其功能小肽对胶质母细胞瘤的抑制作用 | |
| EP3151855B1 (en) | Methods for treating type 1 diabetes using glucagon receptor antagonistic antibodies | |
| EP2565275B1 (en) | Method of treatment of vascular complications using modulators of TRX and TRXNIP | |
| TWI363091B (en) | Uses of mammalian cytokine; related reagents | |
| US20170157110A1 (en) | Methods for inducing insulin production and uses thereof | |
| Pittenger et al. | Intramuscular injection of islet neogenesis-associated protein peptide stimulates pancreatic islet neogenesis in healthy dogs | |
| JP2023015235A (ja) | 新規なigfr様レセプター及びその使用 | |
| US10980857B2 (en) | Treatment with GDF11 prevents weight gain, improves glucose tolerance and reduces hepatosteatosis | |
| JP2017512068A (ja) | マイトフュージンの方法及び使用 | |
| TWI359271B (en) | Pharmaceutical composition for insulin resistance | |
| JP2010518821A (ja) | 脂肪細胞の分化を制御する分泌型タンパク質Ccdc80 | |
| US11999776B2 (en) | IGFR-like 2 receptor and uses thereof | |
| WO2022261357A2 (en) | Compositions and methods for islet cell transplants | |
| JP2023509222A (ja) | 糖尿病治療用の薬物の製造におけるgp73阻害剤の使用 | |
| US20230025525A1 (en) | Novel igfr-like receptor and uses thereof | |
| Lee | Insulin-Independent Regulation of Type 1 Diabetes via Large Brown Adipocyte-Secreted Proteins and the Novel Glucagon Regulator, Nidogen2 | |
| Boyes | Evaluating the Role of the Kappa Opioid Receptor Nalfurafine in Preclinical Models of Demyelination |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 12797387 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 2838824 Country of ref document: CA Ref document number: 2014514917 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2012267492 Country of ref document: AU Date of ref document: 20120610 Kind code of ref document: A |
|
| REEP | Request for entry into the european phase |
Ref document number: 2012797387 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 14125276 Country of ref document: US |