WO2012058393A2 - Dkk1 antibodies and methods of use - Google Patents

Dkk1 antibodies and methods of use Download PDF

Info

Publication number
WO2012058393A2
WO2012058393A2 PCT/US2011/058025 US2011058025W WO2012058393A2 WO 2012058393 A2 WO2012058393 A2 WO 2012058393A2 US 2011058025 W US2011058025 W US 2011058025W WO 2012058393 A2 WO2012058393 A2 WO 2012058393A2
Authority
WO
WIPO (PCT)
Prior art keywords
antibody
antibodies
bone
seq
fragment
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2011/058025
Other languages
English (en)
French (fr)
Other versions
WO2012058393A3 (en
Inventor
William Gleason Richards
Hsieng Sen Lu
Hua Zhu Ke
Chaoyang Li
Frederick W. Jacobsen
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Amgen Inc
Original Assignee
Amgen Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to US13/878,619 priority Critical patent/US9879072B2/en
Priority to AU2011319843A priority patent/AU2011319843C1/en
Priority to MX2017013617A priority patent/MX382826B/es
Priority to EP20213270.0A priority patent/EP3838922A1/en
Priority to EP17169408.6A priority patent/EP3219725B1/en
Priority to CA2815181A priority patent/CA2815181C/en
Priority to MX2013004726A priority patent/MX354481B/es
Priority to JP2013536812A priority patent/JP6066912B2/ja
Application filed by Amgen Inc filed Critical Amgen Inc
Priority to EP11779531.0A priority patent/EP2632951B1/en
Publication of WO2012058393A2 publication Critical patent/WO2012058393A2/en
Publication of WO2012058393A3 publication Critical patent/WO2012058393A3/en
Anticipated expiration legal-status Critical
Priority to US15/841,065 priority patent/US10800839B2/en
Priority to US17/015,212 priority patent/US12297260B2/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/3955Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00Drugs for skeletal disorders
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00Drugs for skeletal disorders
    • A61P19/08Drugs for skeletal disorders for bone diseases, e.g. rachitism, Paget's disease
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00Drugs for skeletal disorders
    • A61P19/08Drugs for skeletal disorders for bone diseases, e.g. rachitism, Paget's disease
    • A61P19/10Drugs for skeletal disorders for bone diseases, e.g. rachitism, Paget's disease for osteoporosis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/22Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against growth factors ; against growth regulators
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • A61K2039/507Comprising a combination of two or more separate antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/21Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/34Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value

Definitions

  • sequence listing is provided as a file entitled A-1574-WO-PCT_seqlist.txt, created September 21 , 201 1 , which is 72.1kb in size.
  • the information in the electronic format of the sequence listing is incorporated herein by reference in its entirety.
  • the invention relates to selective binding agents for dickkopf-1 (DK 1) protein, and more particularly, to antibodies and antigen binding domains and CDR regions that mediate selective binding to DK 1 proteins.
  • DK 1 dickkopf-1
  • the first phase occurs in both men and women and proceeds to attainment of a peak bone mass. This is achieved through linear growth of the endochondral growth plates and radial growth due to a rate of periosteal apposition.
  • the second phase begins around age 30 for trabecular bone (flat bones more commonly found in the vertebrae and pelvis) and about age 40 for cortical bone (e.g., predominantly found in long bones such as in the limbs) and continues to old age.
  • This phase is characterized by slow bone loss and occurs in both men and women.
  • a third phase of bone loss also occurs, most likely due to postmenopausal estrogen deficiencies. During this phase alone, women may lose an additional bone mass from the cortical bone and from the trabecular compartment (see Riggs, supra).
  • Osteoporosis is a debilitating disease in humans and is characterized by marked decreases in skeletal bone mass and mineral density, structural deterioration of bone, including degradation of bone microarchitecture and corresponding increases in bone fragility (i.e., decreases in bone strength), and susceptibility to fracture in afflicted individuals. Osteoporosis in humans is generally preceded by clinical osteopenia (bone mineral density that is greater than one standard deviation but less than 2.5 standard deviations below the mean value for young adult bone), a condition found in
  • osteoporosis defined as bone mineral content greater than 2.5 standard deviations below that of mature young adult bone.
  • the frequency of osteoporosis in the human population increases with age.
  • osteoporosis is predominant in women who, in the United States, comprise 80% of the osteoporosis patient pool.
  • the increased fragility and susceptibility to fracture of skeletal bone in the aged is aggravated by the greater risk of accidental falls in this population.
  • Fractured hips, wrists, and vertebrae are among the most common injuries associated with osteoporosis. Hip fractures in particular are extremely uncomfortable and expensive for the patient, and for women, correlate with high rates of mortality and morbidity.
  • Dickkopf-1 is a member of the dickkopf family of proteins that have been shown to be negative regulators of Wnt-signaling, which has a central role in bone development and formation (see, e.g., Glinka et al, Nature 391 :357-62 (1998); Fedi et al, J Biol
  • DK 1 inhibits Wnt signaling through its interaction with the Wnt co- receptors LRP5 or LRP6 and the kremen proteins (see, for example, Bafico et al., Nature Cell Biol 3:683 (2001); Mao et al, Nature 411(17):321 (2001); Mao et al, Nature 417:664 (2002); and Semenov et al., Curr Biol 11 :951-61 (2001).
  • DK 1 By binding LRP5 (LRP6) and kremen proteins, DK 1 prevents LRP5 or LRP6 from associating with members of the Wnt pathway and thus prevents Wnt-mediated signal transduction, which in turn results in the inhibition of bone formation.
  • the DK 1 receptor LRP5/6 is a key protein in regulating bone mass (see, for example, Gong et al, Cell 107:513-23 (2001); Patel, N Eng J Med 346(20): 1572 (2002)).
  • An autosomal recessive disorder characterized by low bone mass (osteoporosis-pseudoglioma syndrome, or "OPPG") has been identified as being caused by loss-of-function mutations in LRP5 (Gong et al., 2001).
  • OPPG osteoporosis-pseudoglioma syndrome
  • gain-of- function mutations in LRP5 have been shown to result in autosomal dominant high bone mass in humans (Little et al, Am J Human Genetics. 70(1): 11-19, 2002).
  • DK 1 is appropriately characterized as being a negative regulator of bone deposition.
  • Sclerostin the product of the SOST gene, is absent in sclerosteosis, a skeletal disease illustrated by bone overgrowth and strong dense bones (Brunkow et al, Am. J. Hum. Genet, 68:577 589, 2001; Balemans et al, Hum. Mol. Genet., 10:537 543, 2001).
  • Inhibitors of sclerostin have been shown to increase the rate of bone mineralization, and thus bone mineral density (Padhi et al, J Bone Miner Res. 2010 Jun; epublished ahead of print).
  • DK 1 has been shown to be involved in the regulation of bone formation, particularly in bone fracture repair, and its role in various other diseases that are associated with bone loss (e.g., cancer and diabetes).
  • novel DK 1 inhibitors that are effective in treating conditions requiring increased bone building, for example, fracture repair or bone loss associated with pathological conditions, such as multiple myeloma.
  • combinations of agents that increase bone anabolism including combinations of DK 1 and sclerostin inhibitors. These combinations can be used for treatment of, for example,
  • the combination can be two separate inhibitors, for example, an anti-sclerostin antibody and an anti-DK l antibody, or can be a single molecular entity, for example, a bispecific molecule including a bispecific antibody.
  • the anti-DKKl agents may also block or reduce binding between DKKl and LRP5 and/or LRP6, thereby stimulating at least one activity associated with Wnt signaling.
  • the agents can be an antibody or an immunologically functional fragment thereof and thus include antibodies with a naturally occurring structure, as well as polypeptides that have an antigen binding domain (e.g., a domain antibody).
  • the antibodies and fragments can be used to treat a variety of different diseases including preventing or treating conditions relating to loss of bone mass or to stimulate production of new bone, as well as various non-bone related disorders.
  • Nucleic acids molecules, vectors, and host cells useful in the production of the antibodies and selective binding agents are also provided.
  • Some of the antibodies and immunologically functional fragments that are provided include one or more of the following light chain (LC) complementary determining regions (CDRs): (i) a LC CDR1 with at least 80% sequence identity to SEQ ID NO: 97, 103, 109, 115, 121, 127, 133, 139, 145, 151, 157, 163, 169, 175, 181, 187, 193, 199, 205, 211, 217, or 223; (ii) a LC CDR2 with at least 80% sequence identity to SEQ ID NO: 98, 104, 110, 116, 122, 128, 134, 139, 146, 152, 158, 164, 170, 176, 182, 188, 194, 200, 206, 212, 218, or 224; and (iii) a LC CDR3 with at least 80% sequence identity to SEQ ID NO: 99, 105, 111, 117, 123, 129, 13
  • Some of the antibodies and immunologically functional fragments that are provided include one or more of the preceding LC CDRs and/or one or more of the following heavy chain (HC) complementary determining regions (CDRs): (i) a HC CDR1 with at least 80% sequence identity to SEQ ID NO: 100, 106, 112, 118, 124, 130, 136, 142, 148, 154, 160, 166, 172, 178, 184, 190, 196, 202, 208, 214, 220, or 226; (ii) a HC CDR2 with at least 80% sequence identity to SEQ ID NO: 101, 107, 113, 119, 125, 131, 137, 143, 149, 155, 161, 167, 173, 179, 185, 191, 197, 203, 209, 215, 221, or 227; and (iii) a HC CDR3 with at least 80% sequence identity to SEQ ID NO: 102, 108,
  • Such antibodies or fragments can specifically bind a DK 1 polypeptide.
  • Certain antibodies or fragments include one, two, three, four, five or all six of the forgoing CDRs.
  • CDR1 has the amino acid sequence as set forth in SEQ ID NOs: 97, 103, 109, 115, 121, 127, 133, 139, 145, 151, 157, 163, 169, 175, 181, 187, 193, 199, 205, 211, 217, or 223,
  • CDR2 has the amino acid sequence as set forth in SEQ ID NOs: 98, 104, 110, 116, 122, 128, 134, 139, 146, 152, 158, 164, 170, 176, 182, 188, 194, 200, 206, 212, 218, or 224 and/or CDR3 has the amino acid sequence as set forth in SEQ ID NOs: 99, 105, 111, 117, 123, 129, 135, 140, 147,
  • Some antibodies and fragments may also have a heavy chain in which CDR1 has the amino acid sequence as set forth in SEQ ID NOs: 100, 106, 112, 118, 124, 130, 136, 142, 148, 154, 160, 166, 172, 178, 184, 190, 196, 202, 208, 214, 220, or 226,
  • CDR2 has the amino acid sequence as set forth in SEQ ID NOs: 101, 107, 113, 119, 125, 131, 137, 143, 149, 155, 161,
  • HC CDR3 has the amino acid sequence as set forth in SEQ ID NOs: 102, 108, 114, 120, 126, 132, 138, 144, 150, 156, 162,
  • Certain antibodies or fragments include a light chain CDR3 with the amino acid sequence of SEQ ID NOs: 99, 105, 111, 117, 123, 129, 135, 140, 147, 153, 159, 165, 171, 177, 183, 189, 195, 201, 207, 213, 219, or 225 and/or a heavy chain CDR3 with the amino acid sequence of SEQ ID NOs: 102, 108, 114, 120, 126, 132, 138, 144, 150, 156, 162, 168, 174, 180, 186, 192, 198, 204, 210, 216, 222 or 228.
  • VL light chain variable region
  • VH heavy chain variable region
  • Other antibodies or fragments are similar in structure but the VL has at least 90%
  • the VL has at least 98%> sequence identity with SEQ ID NO: 84, 28 or 32; and the VH has at least 98% sequence identity with SEQ ID NO: 10, 14, 18, 22, 26, 30, 34, 38, 42, 46, 50, 54, 58, 62, 66, 70, 74, 78, 82, 86, 90, or 94.
  • Still other antibodies or fragments are ones that include a VL that has the amino acid sequence of SEQ ID NO: 10, 14, 18, 22, 26, 30, 34, 38, 42, 46, 50, 54, 58, 62, 66, 70, 74, 78, 82, 86, 90, or 94, and/or a VH that has the amino acid sequence of SEQ ID NOs: 12, 16, 20, 24, 28, 32, 36, 40, 44, 48, 52, 56, 60, 64, 68, 72, 76, 80, 84, 88, 92, or 96.
  • Some antibodies or fragments include a light chain that comprises or consists of the amino acid sequence of SEQ ID NOs: 10, 14, 18, 22, 26, 30, 34, 38, 42, 46, 50, 54, 58, 62, 66, 70, 74, 78, 82, 86, 90, or 94 and/or a heavy chain that comprises or consists of the amino acid sequence of SEQ ID NOs: 12, 16, 20, 24, 28, 32, 36, 40, 44, 48, 52, 56, 60, 64, 68, 72, 76, 80, 84, 88, 92, or 96.
  • isolated antibodies or an immunologically functional fragments thereof that specifically bind a mature human DKK1 protein expressed from the sequence depicted in SEQ ID NO: 1, wherein said antibody binds to an epitope comprising two loops, said loops being formed by disulfide bonds between amino acids 220 and 237 of SEQ ID NO: 2 and between cysteine residues 245 and 263 of SEQ ID NO:2.
  • antibodies or fragments that are disclosed compete with an antibody such as those described above for specific binding to a DKK1 polypeptide.
  • some antibodies and fragments compete with an antibody that consists of two identical heavy chains and two identical light chains, wherein the heavy chains comprise SEQ ID NO: 42 and said light chains comprise SEQ ID NO: 44.
  • the various antibodies and fragments that are provided may include a single light and/or heavy chain or a single variable light domain and/or a single variable heavy domain.
  • antibodies and fragments include two light and/or two heavy chains. In those instances in which the antibody or fragment includes two light and/or heavy chains, the two light chains in some instances are identical to one another; likewise, the two heavy chains in some instances are identical.
  • the antibodies that are provided may include, for example, monoclonal antibodies, a human antibody, a chimeric antibody, or a humanized antibody.
  • the immunologically functional fragments may include, but are not limited to, a scFv, a Fab, a Fab', a F(ab') 2 , or a domain antibody. In certain instances, the antibody or fragment dissociates from a DK 1 polypeptide with a kd (k 0 ff) of 5x10 ⁇ 4 or less.
  • compositions that include any of the foregoing antibodies and immunologically active fragments are also provided. Such compositions typically also include a buffer, a pharmaceutically acceptable diluent, a carrier, a solubilizer, an emulsifier or a preservative. The use of the foregoing antibodies and immunologically active fragments in the preparation of a pharmaceutical composition or medicament is also provided.
  • nucleic acids for instance, encode (a) a light chain CDR with the amino acid sequence as set forth in SEQ ID NOs: 9, 13, 17, 21, 25, 29, 33, 37, 41, 45, 49, 53, 57, 61, 65, 69, 73, 77, 81, 85, 89, and/or 93; and/or (b) a heavy chain CDR with the amino acid sequence as set forth in SEQ ID NOs: 11, 15, 19, 23, 27, 31, 35, 39, 43, 47, 51, 55, 59, 63, 67, 71, 75, 79, 83, 87, 91 and/or 95, such that the encoded CDR(s) encode an antibody or an immunologically functional fragment thereof that can specifically bind a DKK1 polypeptide.
  • Certain other nucleic acids comprise or consist of a sequence that encodes a variable light region (VL) and/or a variable heavy region (VH) of an antibody or immunologically active fragment, wherein the VL has at least 80%, 90% or 95% sequence identity with SEQ ID NOs: 9, 13, 17, 21, 25, 29, 33, 37, 41, 45, 49, 53, 57, 61, 65, 69, 73, 77, 81, 85, 89, or 93 and the VH has at least 80% 90%, or 95% sequence identity with SEQ ID NOs: 11, 15, 19, 23, 27, 31, 35, 39, 43, 47, 51, 55, 59, 63, 67, 71, 75, 79, 83, 87, 91 or 95.
  • VL variable light region
  • VH variable heavy region
  • nucleic acids include a sequence that encodes a VL that comprises or consists of SEQ ID NOs: 9, 13, 17, 21, 25, 29, 33, 37, 41, 45, 49, 53, 57, 61, 65, 69, 73, 77, 81, 85, 89, or 93 and/or a sequence that encodes a VH that comprises or consists of SEQ ID NOs: 11, 15, 19, 23, 27, 31, 35, 39, 43, 47, 51, 55, 59, 63, 67, 71, 75, 79, 83, 87, 91 or 95.
  • Expression vectors comprising the foregoing nucleic acids are also disclosed herein, as are cells (e.g., CHO cells) that comprise such expression vectors. Methods of producing an antibody or an immunologically active fragment thereof by culturing cells that contain such expression vectors are also described.
  • binding agents e.g., antibodies, or immunologically functional fragments or combination thereof in the treatment of a variety of diseases.
  • Certain methods involve administering to a patient in need thereof an effective amount of an antibody or immunologically active fragment or combinations as described herein to bone trauma including but not limited to orthopedic procedures, dental procedures, implant surgery, joint replacement, bone grafting, bone cosmetic surgery and bone repair such as fracture healing, nonunion healing, delayed union healing and facial
  • compositions may be administered before, during and/or after the procedure, replacement, graft, surgery or repair.or other disorders associated with bone damage.
  • an antibody or immunologically functional fragment thereof as described herein e.g., an antibody or immunologically functional fragment that comprises at least one light chain CDR selected from the group consisting of amino acids depicted in SEQ ID NOs: 97, 103, 109, 115, 121, 127, 133, 139, 145, 151, 157, 163, 169, 175, 181, 187, 193, 199, 205, 211, 217, or 223, or amino acids depicted in SEQ ID NOs: 98, 104, 110, 116, 122, 128, 134, 139, 146, 152, 158, 164, 170, 176, 182, 188, 194, 200, 206, 212, 218, or 224 and the amino acids depicted in SEQ ID NOs: 99, 105, 111, 117, 123,
  • the patient is one who suffers from cancer that metastasizes to bone, and in another aspect, the patient is one who suffers from multiple myeloma.
  • the patient is selected from patients who have osteoporosis, osteopenia, Paget's disease, periodontitis, rheumatoid arthritis, and bone loss due to immobilization.
  • the patient is selected from those who have bone damage that may or may not result from an underlying loss of bone mass such as that caused by osteoporosis or osteolytic lesions associated with cancer (e.g., multiple myeloma).
  • bone damage examples include but are not limited to orthopedic procedures, dental procedures, implant surgery, joint replacement (e.g., hip replacement, knee replacement, etc.), bone grafting, bone cosmetic surgery and bone repair such as fracture healing, nonunion healing, delayed union healing and facial reconstruction.
  • One or more compositions may be administered before, during and/or after the procedure, replacement, graft, surgery or repair.
  • the patient is selected from those who have bone loss that may or may not result from a condition such as that caused by osteoporosis, osteolytic lesions associated with cancer (e.g., multiple myeloma).
  • FIG. 1 Epitope sites of human DKK1 antibodies. Trypsin sites are indicated with solid arrows and AspN sites with dotted line arrows. Trypsin sites are in solid arrows and AspN sites in dotted arrows.
  • the binding region for Ab 5.25.1 includes two discontinuous portions, the first from amino acids 98 to 104 and a region from amino acids 107-121 and 127- 140. The last three disulfide bonds form a major epitope region where all tryptic sites can be protected by Ab 5.25.1.
  • ARG102 is also protected from trypsin digestion. Removal of amino acids position 121-125 by CNBr treatment does not cause loss of binding. The region noted as resistant to AspN digestion may not be accessed for antibody binding.
  • FIG. 2 Panel A lane 1 only LRP6-His is included; lane 2 rhDKKl-Flag; lane 3 hLRP6-His + hDKKl-Flag; lane 4 hLRP6-His + hDKKl-Flag + 5.80.1; lane 5 hLRP6-His + hDKKl-Flag + 6.37.5; lane 6 hLRP6-His + hDKKl-Flag + rl 1H10; lane 7 hLRP6-His+hDKKl - Flag + 5.25.1; lane 8 hLRP6-His + hDKKl-Flag + 5.77.1.
  • Figure 3 Shows the percent change in tibia bone mineral density at three weeks for vehicle, PTH and different amounts of antibody 2.40.2. The 20 mg/kg dose was significantly different from the vehicle.
  • FIG. 4 Antibody 5.32.1 from the 5.25.1 bin and 5.80.1 from the 11H10 bin were tested in vivo for their ability to increase osteocalcin. Eight- week-old male BDF-1 mice were injected subcutaneously over a two-week period with one of three doses of the purified monoclonal antibody (3, 10, or 30 mg/kg). Six mice were used per group. Negative control mice were injected with vehicle (PBS).
  • PBS vehicle
  • Figure 5 Mice were inj ected subcutaneously twice per week for three weeks with
  • mice 25 mg/kg of the respective antibodies (6.37.5 and 6.116.6). Ten mice were used per group. Control groups were injected with vehicle (twice per week) or PTH (100 ⁇ g/kg five times per week). The data are presented as percent change from baseline in bone mineral density of the lumbar vertebrae.
  • Figure 6 An additional study was conducted with the rat 11 H 10 bin antibody in a rat closed fracture healing model.
  • the fully rat 11H10 bin antibody rl 1H10 was utilized in this study as a surrogate molecule to the fully human antibodies described herein. Improvement in maximum load and BMD achieved with Anti-DK l treatment at the fracture callus indicating the acceleration of fracture healing.
  • FIG. 7 DK 1 in serum isolated from animal models of disease was detected and DK 1 protein levels are approximately five-fold elevated at 3-weeks after induction of kidney damage with the pharmacological agent.
  • DKKl as used herein includes, for example, rat, murine, cynomolgous and human native forms of DKKl .
  • Exemplary nucleotide sequences encoding human, murine, rat and cynomolgous DKKl proteins are shown, respectively, in SEQ ID NOs: 1, 3, 5 and 7; the corresponding amino acid sequences are shown, respectively, in SEQ ID NOs: 2, 4, 6, and 8.
  • the human DKKl protein (SEQ ID NO: 2) has a leader sequence consisting of amino acids 1-31 of SEQ ID NO: 2.
  • An exemplary rat DKKl protein sequence is listed in GenBank Accession XP219804.
  • the term also includes variants of such native sequences that are immunologically cross-reactive with these native proteins. These proteins can inhibit the interaction between LRP5 or LRP6 with Wnt.
  • the term can also refer to a fragment of a native or variant form of DKKl that contains an epitope to which an antibody can specifically bind.
  • polynucleotide or “nucleic acid” means single-stranded or double- stranded polymers.
  • the nucleotides comprising the polynucleotide can be ribonucleotides or deoxyribonucleotides or a modified form of either type of nucleotide.
  • Said modifications include base modifications such as bromouridine and inosine derivatives, ribose modifications such as 2',3'-dideoxyribose, and internucleotide linkage modifications such as phosphorothioate, phosphorodithioate, phosphoroselenoate, phosphorodiselenoate, phosphoroanilothioate, phoshoraniladate and phosphoroamidate.
  • base modifications such as bromouridine and inosine derivatives
  • ribose modifications such as 2',3'-dideoxyribose
  • internucleotide linkage modifications such as phosphorothioate, phosphorodithioate, phosphoroselenoate, phosphorodiselenoate, phosphoroanilothioate, phoshoraniladate and phosphoroamidate.
  • the term includes both single and double stranded forms.
  • oligonucleotide means a polynucleotide comprising 200 or fewer nucleotides. In some embodiments, oligonucleotides are 10 to 60 bases in length. In other embodiments, oligonucleotides are 12, 13, 14, 15, 16, 17, 18, 19, or 20 to 40 nucleotides in length. Oligonucleotides may be single stranded or double stranded, e.g., for use in the construction of a mutant gene.
  • An "isolated nucleic acid molecule” means a DNA or RNA of genomic, mRNA, cDNA, or synthetic origin or some combination thereof which is not associated with all or a portion of a polynucleotide in which the isolated polynucleotide is found in nature, or is linked to a polynucleotide to which it is not linked in nature.
  • a nucleic acid molecule comprising a particular nucleotide sequence does not encompass intact chromosomes.
  • Isolated nucleic acid molecules "comprising" specified nucleic acid sequences may include, in addition to the specified sequences, coding sequences for up to ten or even up to twenty other proteins or portions thereof, or may include operably linked regulatory sequences that control expression of the coding region of the recited nucleic acid sequences, and/or may include vector sequences.
  • polynucleotide sequence discussed herein is the 5' end; the left-hand direction of double-stranded polynucleotide sequences is referred to as the 5' direction.
  • the direction of 5' to 3' addition of nascent RNA transcripts is referred to as the transcription direction; sequence regions on the DNA strand having the same sequence as the RNA transcript that are 5' to the 5' end of the RNA transcript are referred to as "upstream sequences"; sequence regions on the DNA strand having the same sequence as the RNA transcript that are 3' to the 3' end of the RNA transcript are referred to as "downstream sequences".
  • control sequence refers to a polynucleotide sequence that can affect the expression and processing of coding sequences to which it is ligated. The nature of such control sequences may depend upon the host organism.
  • control sequences for prokaryotes may include a promoter, a ribosomal binding site, and a transcription termination sequence.
  • control sequences for eukaryotes may include promoters comprising one or a plurality of recognition sites for transcription factors, transcription enhancer sequences, and transcription termination sequence.
  • Control sequences according to the invention can include leader sequences and/or fusion partner sequences.
  • vector means any molecule or entity (e.g., nucleic acid, plasmid, bacteriophage or virus) used to transfer protein coding information into a host cell.
  • expression vector refers to a vector that is suitable for transformation of a host cell and contains nucleic acid sequences that direct and/or control (in conjunction with the host cell) expression of one or more heterologous coding regions operatively linked thereto.
  • An expression construct may include, but is not limited to, sequences that affect or control transcription, translation, and, if introns are present, affect RNA splicing of a coding region operably linked thereto.
  • "operably linked” means that the components to which the term is applied are in a relationship that allows them to carry out their inherent functions under suitable conditions. For example, a control sequence in a vector that is "operably linked" to a protein coding sequence is ligated thereto so that expression of the protein coding sequence is achieved under conditions compatible with the transcriptional activity of the control sequences.
  • the term "host cell” means a cell that has been transformed, or is capable of being transformed, with a nucleic acid sequence and thereby expresses a gene of interest.
  • the term includes the progeny of the parent cell, whether or not the progeny is identical in morphology or in genetic make-up to the original parent cell, so long as the gene of interest is present.
  • transduction means the transfer of genes from one bacterium to another, usually by bacteriophage. "Transduction” also refers to the acquisition and transfer of eukaryotic cellular sequences by retroviruses.
  • transfection means the uptake of foreign or exogenous DNA by a cell, and a cell has been "transfected" when the exogenous DNA has been introduced inside the cell membrane.
  • transfection techniques are well known in the art and are disclosed herein. See, e.g., Graham et al, 1973, Virology 52:456; Sambrook et al, 2001, Molecular Cloning: A Laboratory Manual, Id.; Davis et al., 1986, Basic Methods in Molecular Biology, Elsevier; and Chu et al, 1981, Gene 13: 197.
  • Such techniques can be used to introduce one or more exogenous DNA moieties into suitable host cells.
  • transformation refers to a change in a cell's genetic characteristics, and a cell has been transformed when it has been modified to contain new DNA or RNA.
  • a cell is transformed where it is genetically modified from its native state by introducing new genetic material via transfection, transduction, or other techniques.
  • the transforming DNA may recombine with that of the cell by physically integrating into a chromosome of the cell, or may be maintained transiently as an episomal element without being replicated, or may replicate independently as a plasmid.
  • a cell is considered to have been "stably transformed” when the transforming DNA is replicated with the division of the cell.
  • polypeptide or "protein” means a macromolecule having the amino acid sequence of a native protein, that is, a protein produced by a naturally-occurring and non- recombinant cell, or produced by a genetically-engineered or recombinant cell, and comprise molecules having the amino acid sequence of the native protein, or molecules having deletions from, additions to, and/or substitutions of one or more amino acids of the native sequence.
  • polypeptide and protein specifically encompass anti-DK l antibodies, or sequences that have deletions from, additions to, and/or substitutions of one or more amino acid of anti- DKKl antibody.
  • polypeptide fragment refers to a polypeptide that has an amino- terminal deletion, a carboxyl-terminal deletion, and/or an internal deletion as compared with the full-length native protein. Such fragments may also contain modified amino acids as compared with the native protein. In certain embodiments, fragments are about 5 to 500 amino acids long. For example, fragments may be at least 5, 6, 8, 10, 14, 20, 50, 70, 100, 110, 150, 200, 250, 300, 350, 400, or 450 amino acids long.
  • Useful polypeptide fragments for this invention include immunologically functional fragments of antibodies, including binding domains. In the case of anti-DKKl antibody, useful fragments include but are not limited to a CDR region, a variable domain of a heavy or light chain, a portion of an antibody chain or just its variable region including two CDRs, and the like.
  • isolated protein means that a subject protein (1) is free of at least some other proteins with which it would normally be found, (2) is essentially free of other proteins from the same source, e.g., from the same species, (3) is expressed by a cell from a different species, (4) has been separated from at least about 50 percent of polynucleotides, lipids, carbohydrates, or other materials with which it is associated in nature, (5) is operably associated (by covalent or noncovalent interaction) with a polypeptide with which it is not associated in nature, or (6) does not occur in nature. Genomic DNA, cDNA, mRNA or other RNA, of synthetic origin, or any combination thereof may encode such an isolated protein.
  • the isolated protein is substantially free from proteins or polypeptides or other contaminants that are found in its natural environment that would interfere with its therapeutic, diagnostic, prophylactic, research or other use.
  • a "variant" of a polypeptide comprises an amino acid sequence wherein one or more amino acid residues are inserted into, deleted from and/or substituted into the amino acid sequence relative to another polypeptide sequence.
  • Variants of the invention include fusion proteins.
  • a "derivative" of a polypeptide is a polypeptide (e.g., an antibody) that has been chemically modified in some manner distinct from insertion, deletion, or substitution variants, e.g., via conjugation to another chemical moiety.
  • antibody refers to an intact immunoglobulin of any isotype, or a fragment thereof that can compete with the intact antibody for specific binding to the target antigen, and includes chimeric, humanized, fully human, and bispecific antibodies.
  • An intact antibody generally will comprise at least two full-length heavy chains and two full-length light chains, but in some instances may include fewer chains such as antibodies naturally occurring in camelids which may comprise only heavy chains.
  • Antibodies according to the invention may be derived solely from a single source, or may be "chimeric,” that is, different portions of the antibody may be derived from two different antibodies.
  • the CDR regions may be derived from a rat or murine source, while the framework region of the V region are derived from a different animal source, such as a human.
  • the antibodies or binding fragments of the invention may be produced in hybridomas, by recombinant DNA techniques, or by enzymatic or chemical cleavage of intact antibodies.
  • the term "antibody” includes, in addition to antibodies comprising two full-length heavy chains and two full-length light chains, derivatives, variants, fragments, and muteins thereof, examples of which are described below.
  • the term "light chain” includes a full-length light chain and fragments thereof having sufficient variable region sequence to confer binding specificity.
  • a full-length light chain includes a variable region domain, VL, and a constant region domain, CL.
  • the variable region domain of the light chain is at the amino-terminus of the polypeptide.
  • Light chains according to the invention include kappa chains and lambda chains.
  • the term "heavy chain” includes a full-length heavy chain and fragments thereof having sufficient variable region sequence to confer binding specificity.
  • a full-length heavy chain includes a variable region domain, VH, and three constant region domains, CHI, CH2, and CH3.
  • the VH domain is at the amino-terminus of the polypeptide, and the CH domains are at the carboxyl-terminus, with the CH3 being closest to the --COOH end.
  • Heavy chains according to the invention may be of any isotype, including IgG (including IgGl, IgG2, IgG3 and IgG4 subtypes), IgA (including IgAl and IgA2 subtypes), IgM and IgE.
  • immunoglobulin chain refers to a portion of an antibody light chain or heavy chain that lacks at least some of the amino acids present in a full-length chain but which is capable of binding specifically to an antigen.
  • fragments are biologically active in that they bind specifically to the target antigen and can compete with intact antibodies for specific binding to a given epitope.
  • such a fragment will retain at least one CDR present in the full-length light or heavy chain, and in some embodiments will comprise a single heavy chain and/or light chain or portion thereof.
  • Immunologically functional immunoglobulin fragments of the invention include, but are not limited to, Fab, Fab', F(ab')2, Fv, domain antibodies and single- chain antibodies, and may be derived from any mammalian source, including but not limited to human, mouse, rat, camelid or rabbit. It is contemplated further that a functional portion of the inventive antibodies, for example, one or more CDRs, could be covalently bound to a second protein or to a small molecule to create a therapeutic agent directed to a particular target in the body, possessing bifunctional therapeutic properties, or having a prolonged serum half-life.
  • a "Fab fragment” is comprised of one light chain and the CHI and variable regions of one heavy chain.
  • the heavy chain of a Fab molecule cannot form a disulfide bond with another heavy chain molecule.
  • An "Fc" region contains two heavy chain fragments comprising the CH2 and CH3 domains of an antibody and in some cases the lower hinge region.
  • the two heavy chain fragments are held together by two or more disulfide bonds (typically in the hinge region) and by hydrophobic interactions of the CH3 domains.
  • a "Fab' fragment” contains one light chain and a portion of one heavy chain that contains the VH domain and the CHI domain and also the region between the CHI and CH2 domains, such that an interchain disulfide bond can be formed between the two heavy chains of two Fab' fragments to form a F(ab') 2 molecule.
  • a "F(ab')2 fragment” contains two light chains and two heavy chains containing a portion of the constant region between the CHI and CH2 domains, such that an interchain disulfide bond is formed between the two heavy chains.
  • a F(ab')2 fragment thus is composed of two Fab' fragments that are held together by a disulfide bond between the two heavy chains.
  • the "Fv region” comprises the variable regions from both the heavy and light chains, but lacks the constant regions.
  • Single-chain antibodies are Fv molecules in which the heavy and light chain variable regions have been connected by a flexible linker to form a single polypeptide chain, which forms an antigen-binding region.
  • Single chain antibodies are discussed in detail in International Patent Application Publication No. WO 88/01649 and U.S. Pat. Nos. 4,946,778 and 5,260,203.
  • a "domain antibody” is an immunologically functional immunoglobulin fragment containing only the variable region of a heavy chain or the variable region of a light chain. In some instances, two or more VH regions are covalently joined with a peptide linker to create a bivalent domain antibody. The two VH regions of a bivalent domain antibody may target the same or different antigens.
  • a "bivalent antibody” comprises two antigen binding sites. In some instances, the two binding sites have the same antigen specificities. However, bivalent antibodies may be bispecific (see below).
  • a “multispecific antibody” is one that targets more than one antigen or epitope.
  • a "bispecific,” “dual-specific” or “bifunctional” antibody is a hybrid antibody having two different antigen binding sites.
  • Bispecific antibodies are a species of multispecific antibody and may be produced by a variety of methods including, but not limited to, fusion of hybridomas or linking of Fab' fragments. See, e.g., Songsivilai & Lachmann (1990), Clin. Exp. Immunol. 79:315-321; Kostelny et al. (1992), J. Immunol. 148: 1547-1553.
  • the two binding sites of a bispecific antibody will bind to two different epitopes, which may reside on the same or different protein targets.
  • neutralizing antibody refers to an antibody that binds to a ligand, prevents binding of the ligand to its binding partner and interrupts the biological response that otherwise would result from the ligand binding to its binding partner.
  • an antibody or fragment will substantially inhibit binding of a ligand to its binding partner when an excess of antibody reduces the quantity of binding partner bound to the ligand by at least about 20%, 30%, 40%, 50%, 60%, 70%, 80%, 85%, 90%, 95%, 97%, 99% or more (as measured in an in vitro competitive binding assay).
  • a neutralizing antibody will diminish the ability of DKK1 to bind LRP5 or LRP6, thereby inducing a measurable increase in Wnt activity.
  • Compet when used in the context of antibodies that compete for the same epitope means competition between antibodies is determined by an assay in which the antibody or immunologically functional fragment under test prevents or inhibits specific binding of a reference antibody to a common antigen (e.g., DKK1 or a fragment thereof).
  • a common antigen e.g., DKK1 or a fragment thereof.
  • Numerous types of competitive binding assays can be used, for example: solid phase direct or indirect radioimmunoassay (RIA), solid phase direct or indirect enzyme immunoassay (EIA), sandwich competition assay (see, e.g., Stahli et al.
  • RIA using 1-125 label see, e.g., Morel et al. (1988) Molec. Immunol. 25:7-15); solid phase direct biotin-avidin EIA (see, e.g., Cheung, et al. (1990) Virology 176:546-552); and direct labeled RIA (Moldenhauer et al. (1990) Scand. J. Immunol. 32:77-82).
  • an assay involves the use of purified antigen bound to a solid surface or cells bearing either of these, an unlabelled test immunoglobulin and a labeled reference immunoglobulin.
  • Competitive inhibition is measured by determining the amount of label bound to the solid surface or cells in the presence of the test immunoglobulin. Usually the test immunoglobulin is present in excess.
  • Antibodies identified by competition assay include antibodies binding to the same epitope as the reference antibody and antibodies binding to an adjacent epitope sufficiently proximal to the epitope bound by the reference antibody for steric hindrance to occur. Additional details regarding methods for determining competitive binding are provided in the examples herein. Usually, when a competing antibody is present in excess, it will inhibit specific binding of a reference antibody to a common antigen by at least 40%, 45%, 50%, 55%, 60%, 65%, 70% or 75%).
  • binding is inhibited by at least 80%>, 85%, 90%>, 95%, or 97% or more by a selective binding agent, such as an antibody, and additionally capable of being used in an animal to produce antibodies capable of binding to that antigen.
  • a selective binding agent such as an antibody
  • An antigen may possess one or more epitopes that are capable of interacting with different antibodies.
  • epitope includes any determinant capable of specifically binding to an immunoglobulin or to a T-cell receptor.
  • An epitope is a region of an antigen that is bound by an antibody that specifically targets that antigen, and when the antigen is a protein, includes specific amino acids that directly contact the antibody. Most often, epitopes reside on proteins, but in some instances may reside on other kinds of molecules, such as nucleic acids.
  • Epitope determinants may include chemically active surface groupings of molecules such as amino acids, sugar side chains, phosphoryl or sulfonyl groups, and may have specific three dimensional structural characteristics, and/or specific charge characteristics.
  • antibodies specific for a particular target antigen will preferentially recognize an epitope on the target antigen in a complex mixture of proteins and/or macromolecules.
  • An antibody of the invention is said to "specifically bind” its target antigen when the dissociation constant (Ka) is lxl 0 "7 M.
  • the antibody specifically binds antigen with "high affinity” when the Kd is lxl 0 "8 , higher affinity is M 5x10 ⁇ 9 M, and with "very high affinity” when the Kd is 5x 10 "10 M.
  • the antibody has a Kd of 1x10 "
  • the off-rate is ⁇ lxl0 "
  • the antibodies will bind to human DKKl with a Kd of between about lxl 0 "8 M and lxl 0 "10 M, and in yet another embodiment it will bind with a Kd
  • identity refers to a relationship between the sequences of two or more polypeptide molecules or two or more nucleic acid molecules, as determined by aligning and comparing the sequences. "Percent identity” means the percent of identical residues between the amino acids or nucleotides in the compared molecules and is calculated based on the size of the smallest of the molecules being compared. For these calculations, gaps in alignments (if any) must be addressed by a particular mathematical model or computer program (i.e., an
  • Algorithm Methods that can be used to calculate the identity of the aligned nucleic acids or polypeptides include those described in Computational Molecular Biology, (Lesk, A. M., ed.), 1988, New York: Oxford University Press; Biocomputing Informatics and Genome Projects, (Smith, D. W., ed.), 1993, New York: Academic Press; Computer Analysis of Sequence Data, Part I, (Griffin, A. M., and Griffin, H. G., eds.), 1994, New Jersey: Humana Press; von Heinje, G., 1987, Sequence Analysis in Molecular Biology, New York: Academic Press; Sequence Analysis Primer, (Gribskov, M. and Devereux, J., eds.), 1991, New York: M. Stockton Press; and Carillo et al, 1988, SIAM J. Applied Math. 48: 1073.
  • the sequences being compared are aligned in a way that gives the largest match between the sequences.
  • the computer program used to determine percent identity is the GCG program package, which includes GAP (Devereux et al, 1984, Nucl Acid Res 12:387; Genetics Computer Group, University of Wisconsin, Madison, Wise).
  • GAP is used to align the two polypeptides or polynucleotides for which the percent sequence identity is to be determined.
  • the sequences are aligned for optimal matching of their respective amino acid or nucleotide (the "matched span", as determined by the algorithm).
  • a gap opening penalty (which is calculated as 3.
  • Certain alignment schemes for aligning two amino acid sequences may result in matching of only a short region of the two sequences, and this small aligned region may have very high sequence identity even though there is no significant relationship between the two full- length sequences. Accordingly, the selected alignment method (GAP program) can be adjusted if so desired to result in an alignment that spans at least 50 contiguous amino acids of the target polypeptide.
  • substantially pure means that the described species of molecule is the predominant species present, that is, on a molar basis it is more abundant than any other individual species in the same mixture.
  • a substantially pure molecule is a composition wherein the object species comprises at least 50% (on a molar basis) of all macromolecular species present.
  • a substantially pure composition will comprise at least 80%, 85%>, 90%>, 95%>, or 99%> of all macromolecular species present in the composition.
  • the object species is purified to essential homogeneity wherein contaminating species cannot be detected in the composition by conventional detection methods and thus the composition consists of a single detectable macromolecular species.
  • osteoopenia refers to a patient with bone loss of at least one standard deviation compared with a standard patient considered to have normal bone mineral density (BMD).
  • BMD normal bone mineral density
  • BMD measurements may be taken of one or more bones.
  • therapeutically effective amount refers to the amount of an anti-DK l antibody determined to produce a therapeutic response in a mammal. Such therapeutically effective amounts are readily ascertained by one of ordinary skill in the art.
  • amino acid includes its normal meaning in the art.
  • the twenty naturally- occurring amino acids and their abbreviations follow conventional usage. See Immunology—A Synthesis, 2nd Edition, (E. S. Golub and D. R. Gren, eds.), Sinauer Associates: Sunderland, Mass. (1991).
  • Stereoisomers e.g., D-amino acids
  • unnatural amino acids such as .alpha.-, . alpha. -disubstituted amino acids, N-alkyl amino acids, and other unconventional amino acids may also be suitable components for polypeptides of the invention.
  • Examples of unconventional amino acids include: 4-hydroxyproline, gamma- carboxyglutamate, .epsilon.-N,N,N-trimethyllysine, .epsilon.-N-acetyllysine, O-phosphoserine, N-acetylserine, N-formylmethionine, 3-methylhistidine, 5 -hydroxy lysine, .sigma.-N- methylarginine, and other similar amino acids and imino acids (e.g., 4-hydroxyproline).
  • the left-hand direction is the amino terminal direction
  • the right-hand direction is the carboxyl-terminal direction, in accordance with standard usage and convention.
  • the present invention provides novel compositions comprising antibodies and antigen-binding sites of immunoglobulins specific for DKKl (e.g., a polypeptide consisting of amino acids 32 to 266 of SEQ ID NO: 2). Some of these antibodies and antibody fragments can cross-react with DKKl from several mammalian sources, including rat, mouse, cynomolgus monkey and human DKKl . Some of the antibodies and fragments have higher affinity for
  • DKKl from one species than another (e.g., some antibodies and fragments have higher affinity for human DKKl as compared to rat or murine DKKl; other antibodies have higher affinity for rat or murine DKKl as compared to human DKKl).
  • the invention also provides novel neutralizing antibodies, including chimeric, humanized and human antibodies, as well as antibodies and immunologically functional fragments thereof that bind a conformational epitope in human DKKl .
  • Nucleic acids encoding the antibodies and fragments are also disclosed, as well as methods for expressing the antibodies using these nucleic acids.
  • the invention relates to molecules (e.g., immunologically functional fragments and polypeptides) that are capable of exhibiting immunological binding properties of antibody antigen-binding sites.
  • the antibodies and immunologically functional fragments that are disclosed herein have a variety of utilities. Some of the antibodies and fragments, for instance, are useful in specific binding assays, affinity purification of DKKl or its ligands and in screening assays to identify other antagonists of DKKl activity. Certain of the antibodies can be used to treat various diseases that are associated with the activity of DKKl . Some antibodies and fragments can thus be used in a variety of treatments related to bone such as increasing bone mineral density, synthesis of new bone, treatment of systemic bone loss (e.g., bone erosions), bone repair, and treatments for various forms of arthritis. Some antibodies can also be used to increase osteoclast activity and induce bone resorption.
  • antibodies and fragments that are disclosed can be used to treat a variety of diverse diseases that are unrelated to bone diseases.
  • diseases include those in which it is desirable to promote stem cell renewal (e.g., diabetes and diseases of the muscle), inflammatory diseases (e.g., Crohn's and inflammatory bowel disease), neurological diseases, ocular diseases, renal diseases, and various skin disorders.
  • a variety of selective binding agents useful for regulating the activity of DK 1 are provided. These agents include, for instance, antibodies and immunologically functional fragments thereof that contain an antigen binding domain (e.g., single chain antibodies, domain antibodies, immunoadhesions, and polypeptides with an antigen binding region) and specifically bind to a DK 1 polypeptide (e.g., a human, rat and/or murine DK 1 polypeptide). Some of the agents, for example, are useful in inhibiting the binding of DK 1 to LRP5 and/or LRP6, and can thus be used to stimulate one or more activities associated with Wnt signaling.
  • an antigen binding domain e.g., single chain antibodies, domain antibodies, immunoadhesions, and polypeptides with an antigen binding region
  • a DK 1 polypeptide e.g., a human, rat and/or murine DK 1 polypeptide.
  • binding agents that are provided have the structure typically associated with naturally occurring antibodies.
  • the structural units of these antibodies typically comprise one or more tetramers, each composed of two identical couplets of polypeptide chains, though some species of mammals also produce antibodies having only a single heavy chain.
  • each pair or couplet includes one full-length "light" chain (in certain
  • Each individual immunoglobulin chain is composed of several "immunoglobulin domains," each consisting of roughly 90 to 110 amino acids and expressing a characteristic folding pattern. These domains are the basic units of which antibody polypeptides are composed.
  • each chain typically includes a variable domain that is responsible for antigen recognition.
  • the carboxy-terminal portion is more conserved evolutionarily than the other end of the chain and is referred to as the "constant region" or "C region.”
  • Human light chains generally are classified as kappa and lambda light chains, and each of these contains one variable domain and one constant domain.
  • Heavy chains are typically classified as mu, delta, gamma, alpha, or epsilon chains, and these define the antibody's isotype as IgM, IgD, IgG, IgA, and IgE, respectively.
  • IgG has several subtypes, including, but not limited to, IgGl , IgG2, IgG3, and IgG4.
  • IgM subtypes include IgM, and IgM2.
  • IgA subtypes include IgAl and IgA2. In humans, the IgA and IgD isotypes contain four heavy chains and four light chains; the IgG and
  • IgE isotypes contain two heavy chains and two light chains; and the IgM isotype contains five heavy chains and five light chains.
  • the heavy chain C region typically comprises one or more domains that may be responsible for effector function. The number of heavy chain constant region domains will depend on the isotype.
  • IgG heavy chains for example, each contain three C region domains known as CHI, CH2 and CH3.
  • the antibodies that are provided can have any of these isotypes and subtypes.
  • the anti-DK l antibody is of the IgGl , IgG2 or IgG4 subtype.
  • variable and constant regions are joined by a "J" region of about 12 or more amino acids, with the heavy chain also including a "D” region of about 10 more amino acids.
  • the variable regions of each light/heavy chain pair typically form the antigen binding site.
  • Variable regions of immunoglobulin chains generally exhibit the same overall structure, comprising relatively conserved framework regions (FR) joined by three hypervariable regions, more often called “complementarity determining regions” or CDRs.
  • the CDRs from the two chains of each heavy chain/light chain pair mentioned above typically are aligned by the framework regions to form a structure that binds specifically with a specific epitope on the target protein (e.g., DKKl).
  • DKKl specific epitope on the target protein
  • From N-terminal to C-terminal, naturally-occurring light and heavy chain variable regions both typically conform with the following order of these elements: FR1, CDR1, FR2, CDR2, FR3, CDR3 and FR4.
  • a numbering system has been devised for assigning numbers to amino acids that occupy positions in each of these domains. This numbering system is defined in Kabat Sequences of Proteins of Immunological Interest (1987 and 1991, National Institutes of Health, Bethesda, Md.), or Chothia & Lesk, 1987, J. Mol. Biol. 196: 901-917; Chothia et al, 1989, Nature 342: 878-883.
  • MMWCAAAAVRFLAVFTMMALCSLPLLGASATLNSVLINSNAIKNLPPPLGGAGGQPGSAVSVAPG VLYEGGNKYQTLDNYQPYPCAEDEECGSDEYCSSPSRGAAGVGGVQICLACRKRRKRCMRHAMCCP GNYCKNGICMPSDHSHFPRGEIEESI IENLGNDHNAAAGDGYPRRTTLTSKIYHTKGQEGSVCLRS SDCAAGLCCARHFWSKICKPVLKEGQVCTKHKRKGSHGLEIFQRCYCGEGLACRIQKDHHQASNSS RLHTCQRH
  • Table 1 that encompass variable regions of both the heavy and light chains compared to sequences of the full length antibody, which additional comprise constant regions. Variable domains can be combined with appropriate constant domains using standard technology well known in the art.
  • Each of the light chains listed in Table 1 can be combined with any of the heavy chains shown in Table 1 (e.g., polypeptides depicted in SEQ ID NOs: 242 or 244) to form an antibody.
  • the antibodies include at least one heavy chain and one light chain from those listed in Table 1. In other instances, the antibodies contain two identical light chains and two identical heavy chains.
  • an antibody or immunologically functional fragment may include two LI light chains and two HI heavy chains, or two L2 light chains and two H3 heavy chains, or two L2 light chains and two H4 heavy chains or two L2 and two H5 heavy chains and other similar combinations of pairs of light chains and pairs of heavy chains as listed in Table 1.
  • antibodies that are provided are variants of antibodies formed by combination of the heavy and light chains shown in Table 1 and comprise light and/or heavy chains that each have at least 70%, 75%, 80%, 85%, 90%, 95%, 97% or 99% identity to the amino acid sequences of these chains.
  • such antibodies include at least one heavy chain and one light chain, whereas in other instances such variant forms contain two identical light chains and two identical heavy chains.
  • Certain antibodies comprise a light chain variable domain comprising a sequence of amino acids that differs from the sequence of a light chain variable domain described herein at only 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1, 12, 13, 14 or 15 amino acid residues, wherein each such sequence difference is independently either a deletion, insertion or substitution of one amino acid.
  • the light chain variable region in some antibodies comprises a sequence of amino acids that has at least 70%, 75%, 80%, 85%, 90%, 95%, 97% or 99% sequence identity to the amino acid sequences of the light chain variable regions in Table 1
  • Some antibodies that are provided comprise a heavy chain variable domain comprising a sequence of amino acids that differs from the sequence of a heavy chain variable domain in Table 1 at only 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14 or 15 amino acid residues, wherein each such sequence difference is independently either a deletion, insertion or substitution of one amino acid.
  • the heavy chain variable region in some antibodies comprises a sequence of amino acids that has at least 70%, 75%, 80%, 85%, 90%, 95%, 97% or 99% sequence identity to the amino acid sequences of the heavy chain variable region shown in Table 1.
  • Still other antibodies or immunologically functional fragments include variant forms of a variant light chain and a variant heavy chain as just described.
  • CDRs Complementarity determining regions
  • FR framework regions
  • the antibodies and immunological functional fragments that are provided can include one, two, three, four, five or all six of the CDRs listed above. Some antibodies or fragments include both the light chain CDR3 and the heavy chain CDR3. Certain antibodies have variant forms of the CDRs, with one or more (i.e., 2, 3, 4, 5 or 6) of the CDRs each having at least 80%, 85%, 90% or 95% sequence identity to a CDR sequence.
  • the antibody or fragment can include both a light chain CDR3 and a heavy chain CDR3 that each have at least 80%, 85%, 90% or 95% sequence identity to the light chain CDR3 sequence and the heavy chain CDR3, respectively.
  • the CDR sequences of some of the antibodies that are provided may also differ from the CDR sequences in Table 1 such that the amino acid sequence for any given CDR differs from the sequence listed in Table 1 by no more than 1, 2, 3, 4 or 5 amino acid residues. Differences from the listed sequences usually are conservative substitutions (see below).
  • Polypeptides comprising one or more of the light or heavy chain CDRs may be produced by using a suitable vector to express the polypeptides in a suitable host cell as described in greater detail below.
  • the heavy and light chain variable regions and the CDRs that are disclosed in Table 1 can be used to prepare any of the various types of immunologically functional fragments that are known in the art including, but not limited to, domain antibodies, Fab fragments, Fab' fragments, F(ab') 2 fragments, Fv fragments, single-chain antibodies and scFvs.
  • DKK1 for example, what is meant is that the antibody specifically binds to a polypeptide consisting of the specified residues (e.g., a specified segment of DK 1). Such an antibody does not necessarily contact every residue within DK 1. Nor does every single amino acid substitution or deletion within DK 1 necessarily significantly affect binding affinity.
  • Exact epitope specificity of an antibody can be determined in variety of ways. One approach, for example, involves testing a collection of overlapping peptides of about 15 amino acids spanning the sequence of DKKl and differing in increments of a small number of amino acids (e.g., 3 amino acids). The peptides are immobilized within the wells of a microtiter dish.
  • Immobilization can be effected by biotinylating one terminus of the peptides.
  • different samples of the same peptide can be biotinylated at the N and C terminus and immobilized in separate wells for purposes of comparison. This is useful for identifying end- specific antibodies.
  • additional peptides can be included terminating at a particular amino acid of interest. This approach is useful for identifying end-specific antibodies to internal fragments of DKKl .
  • An antibody or immunologically functional fragment is screened for specific binding to each of the various peptides.
  • the epitope is defined as occurring with a segment of amino acids that is common to all peptides to which the antibody shows specific binding.
  • Antibodies and functional fragments thereof that bind to a conformational epitope that is located in the carboxy-terminal portion of DKKl are also provided.
  • the carboxy-terminus of DKKl contains several cysteine residues that form a cluster of disulfide bonds which create several loops.
  • the invention provides antibodies that bind to two of these loops, thereby neutralizing the ability of DKKl to suppress Wnt activity.
  • Exemplary antibodies capable of binding to the aforementioned conformational epitope are the monoclonal antibodies 11H10 and 1F11, each of which comprises a light chain and a heavy chain. These antibodies are described in detail in U.S. Patent No. 7,709,611.
  • the epitope comprising these two loops is formed by disulfide bonds between cysteine residues 220 and 237 of SEQ ID NO: 2 and between cysteine residues 245 and 263 of SEQ ID NO:2.
  • the body of the two loops that form the epitope thus includes amino acids 221- 236 and 246-262 of SEQ ID NO: 2. Segments within this loop that are involved in binding include amino acids 221-229 of SEQ ID NO:2 and amino acids 246-253 of SEQ ID NO: 2.
  • certain antibodies and fragments that are provided herein specifically bind to the foregoing region(s). Some of the antibodies and fragments, for instance, bind to a peptide comprising or consisting of amino acids 221 to 262 of SEQ ID NO: 2.
  • peptides comprising or consisting of amino acids
  • SEQ ID NO: 2 221-229 and/or 246-253 of SEQ ID NO: 2 are provided.
  • Other peptides comprise or consist of amino acids 221-236 and/or 246-262 of SEQ ID NO: 2.
  • Still other peptides that are provided comprise or consist of the region from 221 to 262 of SEQ ID NO: 2 or amino acids 221-253 of
  • the peptides may include one or more of the forgoing regions and be 8, 9, 10, 11, 12, 13, 14, 15, 20, 21, 22, 23, 24, 25, 30, 40, 50, 75, 100, 150, or 200 amino acids in length). These peptides may be fused to another peptide to increase immunogenicity and thus be in the form of a fusion protein.
  • Antibodies and immunologically functional fragments thereof that compete with one the exemplified antibodies or functional fragments for specific binding to DKKl are also provided. Such antibodies and fragments may also bind to the same epitope as one of the exemplified antibodies. Antibodies and fragments that compete with or bind to the same epitope as the exemplified antibody or fragment are expected to show similar functional properties.
  • the exemplified antibodies and fragment include those described above, including those with the heavy and light chains, variable region domains and CDRs listed in Table 1. Competing antibodies or immunologically functional fragments can include those that bind to the epitope described in the section on antibodies and epitopes above.
  • some competing antibodies or fragments include those that specifically bind a DKKl protein consisting of amino acids 32 to 266 of SEQ ID NO: 2 and can prevent or reduce the binding to human DKKl of an antibody that consists of two identical heavy chains and two identical light chains.
  • Other competing antibodies prevent or reduce the binding to human DKKl of an antibody that consists of two identical heavy chains and two identical light chains such as those listed in Table 1.
  • the antibodies that are provided include monoclonal antibodies that bind to
  • Monoclonal antibodies may be produced using any technique known in the art, e.g., by immortalizing spleen cells harvested from the transgenic animal after completion of the immunization schedule.
  • the spleen cells can be immortalized using any technique known in the art, e.g., by fusing them with myeloma cells to produce hybridomas.
  • Myeloma cells for use in hybridoma-producing fusion procedures preferably are non-antibody-producing, have high fusion efficiency, and enzyme deficiencies that render them incapable of growing in certain selective media which support the growth of only the desired fused cells (hybridomas).
  • Examples of suitable cell lines for use in mouse fusions include Sp-20, P3-X63/Ag8, P3-X63-Ag8.653, NSl/LAg 4 1, Sp210-Agl4, FO, NSO/U, MPC-11, MPCl 1-X45-GTG 1.7 and S194/5XXO Bui; examples of cell lines used in rat fusions include R210.RCY3, Y3-Ag 1.2.3, IR983F and 4B210.
  • Other cell lines useful for cell fusions are U-266, GM1500-GRG2, LICR-LON-HMy2 and UC729-6.
  • a hybridoma cell line is produced by immunizing an animal
  • hybridoma cell lines e.g., a transgenic animal having human immunoglobulin sequences
  • DKKl monoclonal antibodies produced by them are encompassed by the present invention.
  • Monoclonal antibodies secreted by a hybridoma cell line can be purified using any useful technique known in the antibody arts.
  • Hybridomas or mAbs may be further screened to identify mAbs with particular properties, such as the ability to block a Wnt induced activity. Examples of such screens are provided in the examples below.
  • Chimeric and humanized antibodies based upon the foregoing sequences are also provided.
  • Monoclonal antibodies for use as therapeutic agents may be modified in various ways prior to use.
  • One example is a "chimeric" antibody, which is an antibody composed of protein segments from different antibodies that are covalently joined to produce functional
  • immunoglobulin light or heavy chains or immunologically functional portions thereof are immunoglobulin light or heavy chains or immunologically functional portions thereof.
  • a portion of the heavy chain and/or light chain is identical with or homologous to a corresponding sequence in antibodies derived from a particular species or belonging to a particular antibody class or subclass, while the remainder of the chain(s) is/are identical with or homologous to a corresponding sequence in antibodies derived from another species or belonging to another antibody class or subclass.
  • CDR grafting is described, for example, in U.S. Pat. Nos. 6,180,370, 5,693,762, 5,693,761, 5,585,089, and 5,530,101.
  • the goal of making a chimeric antibody is to create a chimera in which the number of amino acids from the intended patient species is maximized.
  • One example is the "CDPv-grafted" antibody, in which the antibody comprises one or more complementarity determining regions (CDRs) from a particular species or belonging to a particular antibody class or subclass, while the remainder of the antibody chain(s) is/are identical with or homologous to a corresponding sequence in antibodies derived from another species or belonging to another antibody class or subclass.
  • CDRs complementarity determining regions
  • the V region or selected CDRs from a rodent antibody often are grafted into a human antibody, replacing the naturally-occurring V regions or CDRs of the human antibody.
  • a humanized antibody is produced from a monoclonal antibody raised initially in a non-human animal. Certain amino acid residues in this monoclonal antibody, typically from non-antigen recognizing portions of the antibody, are modified to be homologous to corresponding residues in a human antibody of corresponding isotype. Humanization can be performed, for example, using various methods by substituting at least a portion of a rodent variable region for the
  • Fully human antibodies are also provided. Methods are available for making fully human antibodies specific for a given antigen without exposing human beings to the antigen ("fully human antibodies”).
  • One means for implementing the production of fully human antibodies is the "humanization" of the mouse humoral immune system.
  • Introduction of human immunoglobulin (Ig) loci into mice in which the endogenous Ig genes have been inactivated is one means of producing fully human monoclonal antibodies (MAbs) in mouse, an animal that can be immunized with any desirable antigen.
  • Using fully human antibodies can minimize the immunogenic and allergic responses that can sometimes be caused by administering mouse or mouse-derivatized Mabs to humans as therapeutic agents.
  • Fully human antibodies can be produced by immunizing transgenic animals
  • Antigens for this purpose typically have six or more contiguous amino acids, and optionally are conjugated to a carrier, such as a hapten. See, for example, Jakobovits et al, 1993, Proc. Natl. Acad. Sci. USA 90:2551-2555; Jakobovits et al,
  • transgenic animals are produced by incapacitating the endogenous mouse immunoglobulin loci encoding the mouse heavy and light immunoglobulin chains therein, and inserting into the mouse genome large fragments of human genome DNA containing loci that encode human heavy and light chain proteins.
  • Partially modified animals which have less than the full complement of human immunoglobulin loci, are then cross-bred to obtain an animal having all of the desired immune system modifications.
  • these transgenic animals When administered an immunogen, produce antibodies that are immunospecific for the immunogen but have human rather than murine amino acid sequences, including the variable regions.
  • mice described above contain a human immunoglobulin gene minilocus that encodes unrearranged human heavy ( ⁇ and gamma) and kappa light chain immunoglobulin sequences, together with targeted mutations that inactivate the endogenous ⁇ and .kappa, chain loci (Lonberg et al, 1994, Nature 368: 856-859).
  • mice exhibit reduced expression of mouse IgM or kappa and in response to immunization, and the introduced human heavy and light chain transgenes undergo class switching and somatic mutation to generate high affinity human IgG kappa monoclonal antibodies (Lonberg et al, supra.; Lonberg and Huszar, 1995, Intern. Rev. Immunol, 13: 65-93; Harding and Lonberg, 1995, Ann. N.Y Acad. Sci 764: 536-546).
  • HuMab mice The preparation of HuMab mice is described in detail in Taylor et al., 1992, Nucleic Acids Research, 20: 6287-6295; Chen et al, 1993, International Immunology 5: 647-656; Tuaillon et al, 1994, J. Immunol. 152: 2912-2920; Lonberg et al, 1994, Nature 368: 856-859; Lonberg, 1994, Handbook of Exp. Pharmacology 113: 49-101; Taylor et al., 1994, International Immunology 6: 579-591; Lonberg and Huszar, 1995, Intern. Rev. Immunol. 13: 65-93; Harding and Lonberg, 1995, Ann. N.Y Acad. Sci.
  • antigen-specific human MAbs with the desired specificity can be produced and selected from the transgenic mice such as those described above.
  • Such antibodies may be cloned and expressed using a suitable vector and host cell, or the antibodies can be harvested from cultured hybridoma cells.
  • Fully human antibodies can also be derived from phage-display libraries (as disclosed in Hoogenboom et al, 1991, J. Mol. Biol. 227:381; and Marks et al, 1991, J. Mol.
  • Phage display techniques mimic immune selection through the display of antibody repertoires on the surface of filamentous bacteriophage, and subsequent selection of phage by their binding to an antigen of choice.
  • One such technique is described in PCT Publication No. WO99/10494, which describes the isolation of high affinity and functional agonistic antibodies for MPL- and msk-receptors using such an approach.
  • the anti-DK l agents provided herein may also block or reduce binding between DK 1 and LRP5 and/or LRP6, thereby stimulating at least one activity associated with Wnt signaling.
  • the agents can be an antibody or an immunologically functional fragment thereof and thus include antibodies with a naturally occurring structure, as well as polypeptides that have an antigen binding domain (e.g., a domain antibody).
  • the antibodies and fragments can be used to treat a variety of different diseases including preventing or treating conditions relating to loss of bone mass or to stimulate production of new bone, as well as various non-bone related disorders.
  • Nucleic acids molecules, vectors, and host cells useful in the production of the antibodies and selective binding agents are also provided.
  • Some of the antibodies and immunologically functional fragments that are provided include one or more of the following light chain (LC) complementary determining regions (CDRs): (i) a LC CDRl with at least 80% sequence identity to SEQ ID NO: 97, 103, 109, 115, 121, 127, 133, 139, 145, 151, 157, 163, 169, 175, 181, 187, 193, 199, 205, 211, 217, or 223; (ii) a LC CDR2 with at least 80% sequence identity to SEQ ID NO: 98, 104, 110, 116, 122, 128, 134, 139, 146, 152, 158, 164, 170, 176, 182, 188, 194, 200, 206, 212, 218, or 224; and (iii) a LC CDR3 with at least 80% sequence identity to SEQ ID NO: 99, 105, 111, 117, 123, 129, 13
  • Some of the antibodies and immunologically functional fragments that are provided include one or more of the preceding LC CDRs and/or one or more of the following heavy chain (HC) complementary determining regions (CDRs): (i) a HC CDRl with at least 80% sequence identity to SEQ ID NO: 100, 106, 112, 118, 124, 130, 136, 142, 148, 154, 160, 166, 172, 178, 184, 190, 196, 202, 208, 214, 220, or 226; (ii) a HC CDR2 with at least 80% sequence identity to SEQ ID NO: 101, 107, 113, 119, 125, 131, 137, 143, 149, 155, 161, 167, 173, 179, 185, 191, 197, 203, 209, 215, 221, or 227; and (iii) a HC CDR3 with at least 80% sequence identity to SEQ ID NO: 102, 108,
  • Such antibodies or fragments can specifically bind a DK 1 polypeptide.
  • Certain antibodies or fragments include one, two, three, four, five or all six of the forgoing CDRs.
  • CDR1 has the amino acid sequence as set forth in SEQ ID NOs: 97, 103, 109, 115, 121, 127, 133, 139, 145, 151, 157, 163, 169, 175, 181, 187, 193, 199, 205, 211, 217, or 223,
  • CDR2 has the amino acid sequence as set forth in SEQ ID NOs: 98, 104, 110, 116, 122, 128, 134, 139, 146, 152, 158, 164, 170, 176, 182, 188, 194, 200, 206, 212, 218, or 224 and/or CDR3 has the amino acid sequence as set forth in SEQ ID NOs: 99, 105, 111, 117, 123, 129, 135, 140, 147,
  • Some antibodies and fragments may also have a heavy chain in which CDR1 has the amino acid sequence as set forth in SEQ ID NOs: 100, 106, 112, 118, 124, 130, 136, 142, 148, 154, 160, 166, 172, 178, 184, 190, 196, 202, 208, 214, 220, or 226,
  • CDR2 has the amino acid sequence as set forth in SEQ ID NOs: 101, 107, 113, 119, 125, 131, 137, 143, 149, 155, 161,
  • HC CDR3 has the amino acid sequence as set forth in SEQ ID NOs: 102, 108, 114, 120, 126, 132, 138, 144, 150, 156, 162,
  • Certain antibodies or fragments include a light chain CDR3 with the amino acid sequence of SEQ ID NOs: 99, 105, 111, 117, 123, 129, 135, 140, 147, 153, 159, 165, 171, 177, 183, 189, 195, 201, 207, 213, 219, or 225 and/or a heavy chain CDR3 with the amino acid sequence of SEQ ID NOs: 102, 108, 114, 120, 126, 132, 138, 144, 150, 156, 162, 168, 174, 180, 186, 192, 198, 204, 210, 216, 222 or 228.
  • Certain other antibodies and immunologically functional fragments that are provided include (a) a light chain variable region (VL) having 80%, 85%, 90%>, 92%>, 95%> or greater sequence identity with SEQ ID NOs: 10, 14, 18, 22, 26, 30, 34, 38, 42, 46, 50, 54, 58, 62, 66, 70, 74, 78, 82, 86, 90, or 94; (b) a heavy chain variable region (VH) having at least 80% sequence identity with SEQ ID NOs: 12, 16, 20, 24, 28, 32, 36, 40, 44, 48, 52, 56, 60, 64, 68, 72, 76, 80, 84, 88, 92, or 96; or (c) a VL of (a) and a VH of (b).
  • VL light chain variable region
  • VH heavy chain variable region
  • VL has at least 90%
  • VH has at least 90% sequence identity with SEQ ID NOs: 12, 16, 20, 24, 28, 32, 36, 40, 44, 48, 52, 56, 60, 64, 68, 72, 76, 80,
  • the VL has at least 98%> sequence identity with SEQ ID NOs: 10, 14, 18, 22, 26, 30, 34, 38, 42, 46, 50, 54, 58, 62, 66, 70, 74, 78, 82, 86, 90, or 94; and the VH has at least 98% sequence identity with SEQ ID NOs: 12, 16, 20, 24, 28, 32,
  • Still other antibodies or fragments are ones that include a VL that has the amino acid sequence of SEQ ID NOs: 10, 14, 18, 22, 26,
  • VH has the amino acid sequence of SEQ ID NOs: 12, 16, 20, 24, 28, 32, 36, 40, 44, 48, 52, 56, 60, 64, 68, 72, 76, 80, 84, 88, 92, or 96.
  • Some antibodies or fragments include a light chain that comprises or consists of the amino acid sequence of SEQ ID NOs: 10, 14, 18, 22, 26, 30, 34, 38, 42, 46, 50, 54, 58, 62, 66, 70, 74, 78, 82, 86, 90, or 94 and/or a heavy chain that comprises or consists of the amino acid sequence of SEQ ID NOs: 12, 16, 20, 24, 28, 32, 36, 40, 44, 48, 52, 56, 60, 64, 68, 72, 76, 80, 84, 88, 92, or 96.
  • isolated antibodies or an immunologically functional fragments thereof that specifically bind a mature human DKK1 protein expressed from the sequence depicted in SEQ ID NO: 1, wherein said antibody binds to an epitope comprising two loops, said loops being formed by disulfide bonds between amino acids 220 and 237 of SEQ ID NO: 2 and between cysteine residues 245 and 263 of SEQ ID NO:2.
  • antibodies or fragments that are disclosed compete with an antibody such as those described above for specific binding to a DKK1 polypeptide.
  • some antibodies and fragments compete with an antibody that consists of two identical heavy chains and two identical light chains, wherein the heavy chains comprise SEQ ID NO: 42 and said light chains comprise SEQ ID NO: 44.
  • the various antibodies and fragments that are provided may include a single light and/or heavy chain or a single variable light domain and/or a single variable heavy domain.
  • antibodies and fragments include two light and/or two heavy chains. In those instances in which the antibody or fragment includes two light and/or heavy chains, the two light chains in some instances are identical to one another; likewise, the two heavy chains in some instances are identical.
  • the antibodies that are provided may include, for example, monoclonal antibodies, a human antibody, a chimeric antibody, or a humanized antibody.
  • the immunologically functional fragments may include, but are not limited to, a scFv, a Fab, a Fab', a F(ab') 2 , or a domain antibody. In certain instances, the antibody or fragment dissociates from a DK 1 polypeptide with a kd (k 0ff ) of 5x10 ⁇ 4 or less.
  • compositions that include any of the foregoing antibodies and immunologically active fragments are also provided. Such compositions typically also include a buffer, a pharmaceutically acceptable diluent, a carrier, a solubilizer, an emulsifier or a preservative. The use of the foregoing antibodies and immunologically active fragments in the preparation of a pharmaceutical composition or medicament is also provided. [00122] A variety of nucleic acids encoding the foregoing antibodies are also provided.
  • nucleic acids for instance, encode (a) a light chain CDR with the amino acid sequence as set forth in SEQ ID NOs: 9, 13, 17, 21, 25, 29, 33, 37, 41, 45, 49, 53, 57, 61, 65, 69, 73, 77, 81, 85, 89, and/or 93; and/or (b) a heavy chain CDR with the amino acid sequence as set forth in SEQ ID NOs: 11, 15, 19, 23, 27, 31, 35, 39, 43, 47, 51, 55, 59, 63, 67, 71, 75, 79, 83, 87, 91 and/or 95, such that the encoded CDR(s) encode an antibody or an immunologically functional fragment thereof that can specifically bind a DKKl polypeptide.
  • Certain other nucleic acids comprise or consist of a sequence that encodes a variable light region (VL) and/or a variable heavy region (VH) of an antibody or immunologically active fragment, wherein the VL has at least 80%, 90% or 95% sequence identity with SEQ ID NOs: 9, 13, 17, 21, 25, 29, 33, 37, 41, 45, 49, 53, 57, 61, 65, 69, 73, 77, 81, 85, 89, or 93 and the VH has at least 80% 90%, or 95% sequence identity with SEQ ID NOs: 11, 15, 19, 23, 27, 31, 35, 39, 43, 47, 51, 55, 59, 63, 67, 71, 75, 79, 83, 87, 91 or 95.
  • VL variable light region
  • VH variable heavy region
  • nucleic acids include a sequence that encodes a VL that comprises or consists of SEQ ID NOs: 9, 13, 17, 21, 25, 29, 33, 37, 41, 45, 49, 53, 57, 61, 65, 69, 73, 77, 81, 85, 89, or 93 and/or a sequence that encodes a VH that comprises or consists of SEQ ID NOs: 11, 15, 19, 23, 27, 31, 35, 39, 43, 47, 51, 55, 59, 63, 67, 71, 75, 79, 83, 87, 91 or 95.
  • Expression vectors comprising the foregoing nucleic acids are also disclosed herein, as are cells (e.g., CHO cells) that comprise such expression vectors. Methods of producing an antibody or an immunologically active fragment thereof by culturing cells that contain such expression vectors are also described.
  • novel DKKl antibodies that are effective in treating conditions requiring increased bone building, for example, fracture repair or bone loss associated with pathological conditions, such as multiple myeloma.
  • agents that increase bone anabolism including combinations of DKKl and sclerostin inhibitors. These combinations can be used for treatment of, for example,
  • the combination therapeutic can take the form of two separate inhibitors, for example, an anti-sclerostin antibody and an anti-DKKl antibody, or can be a single molecular entity, for example, a bispecific antibody.
  • a bispecific antibody binds one antigen on one of its two binding arms, and binds a different antigen on its second arm.
  • a bispecific antibody has two distinct antigen binding arms and is monovalent for each antigen it binds.
  • DKKl antibodies provided herein can include one or more CDRs or one or more variable regions as described above.
  • a bispecific or bifunctional antibody in some instances is an artificial hybrid antibody having two different heavy/light chain pairs and two different binding sites. These bispecific antibodies may be produced by a variety of methods including, but not limited to, fusion of hybridomas or linking of Fab' fragments. See, e.g., Songsivilai & Lachmann, 1990, Clin. Exp. Immunol. 79: 315-321; Kostelny et al, 1992, J. Immunol. 148: 1547-1553.
  • Bispecific molecules can also be created according to the invention by fusion.
  • an antibody of the invention can be linked (e.g., by expressing fused proteins, chemical linking, high affinity non-covalent association or the like) to one or more other binding molecules.
  • binding molecules include but are not limited to another antibody, antibody fragment, peptide or binding mimetic, such that a bispecific molecule results.
  • Bispecific molecules can also comprise a first binding specificity for sclerostin and a second binding specificity for a second target.
  • the second target can be another epitope of sclerostin different from the first epitope.
  • a bispecific molecule comprising at least one first binding specificity for sclerostin and a second binding specificity for an epitope within DK 1.
  • a bispecific molecule comprising at least one first binding specificity for sclerostin and a second binding specificity for an epitope within LRP4.
  • the molecule can further include a third binding specificity, in addition to the first and second target epitope.
  • the bispecific molecules of the invention comprise as a binding specificity at least one antibody, or an antibody fragment thereof, including, e.g., an Fab,
  • Bispecific molecules can be prepared by chemically conjugating the binding portions using methods known in the art.
  • the binding portions are proteins or peptides
  • a variety of coupling or cross-linking agents can be used for covalent conjugation. Examples include protein A, carbodiimide, N-succinimidyl-S-acetyl-thioacetate (SATA), 5,5'-dithiobis(2- nitrobenzoic acid) (DTNB), o-phenylenedimaleimide (oPDM), N-succinimidyl-3-(2- pyridyldithio)propionate (SPDP), and sulfosuccinimidyl4-(N-maleimidomethyl) cyclohaxane- lcarboxylate (sulfo-SMCC) (see e.g., Karpovsky et a/., 1984 J. Exp. Med. 160: 1686; Liu, MA et al, 1985 Proc.
  • Conjugating agents include SATA and sulfo-SMCC, both available from Pierce Chemical Co. (Rockford, IL).
  • the binding portions are antibodies, they can be conjugated by sulfhydryl bonding of the hinge regions of the two heavy chains.
  • the hinge region is modified to contain an odd number of sulfhydryl residues such that there is a free sulfhydryl group that has not formed a disulfide linkage with a corresponding heavy or light chain counterpart.
  • Bispecific molecules may comprise at least two single chain molecules.
  • Non- limiting examples of methods for preparing bispecific molecules are described various patent publications including in U.S. Patent Number 5,260,203; U.S. Patent Number 5,455,030; U.S. Patent Number 4,881,175; U.S. Patent Number 5,132,405; U.S. Patent Number 5,091,513; U.S. Patent Number 5,476,786; U.S. Patent Number 5,013,653; U.S. Patent Number 5,258,498; U.S. Patent Number 5,482,858; and U.S. Patent Application No. 2010/0076178.
  • Examples of partners for either combination therapy with DKKl inhibitors or bi- or multi-specific molecules including DKKl binding portions include sclerostin antibodies or binding fragments that specifically recognize sclerostin proteins. Sclerostin has been previously described as being involved in regulating bone density through wnt signaling pathways (PCT WO 06/119107).
  • antibodies or immunologically functional fragments that are provided are variant forms of the antibodies and fragments disclosed above (e.g., those having the sequences listed in Table 1). For instance, some of the antibodies or fragments are ones having one or more conservative amino acid substitutions in one or more of the heavy or light chains, variable regions or CDRs listed in Table 1.
  • Naturally-occurring amino acids may be divided into classes based on common side chain properties: [0149] 1) hydrophobic: norleucine, Met, Ala, Val, Leu, He; [0150] 2) neutral hydrophilic: Cys, Ser, Thr, Asn, Gin; [0151] 3) acidic: Asp, Glu; [0152] 4) basic: His, Lys, Arg; [0153] 5) residues that influence chain orientation: Gly, Pro; and [0154] 6) aromatic: Trp, Tyr, Phe.
  • Conservative amino acid substitutions may involve exchange of a member of one of these classes with another member of the same class.
  • Conservative amino acid substitutions may encompass non-naturally occurring amino acid residues, which are typically incorporated by chemical peptide synthesis rather than by synthesis in biological systems. These include peptidomimetics and other reversed or inverted forms of amino acid moieties.
  • Non-conservative substitutions may involve the exchange of a member of one of the above classes for a member from another class. Such substituted residues may be introduced into regions of the antibody that are homologous with human antibodies, or into the nonhomologous regions of the molecule.
  • the hydropathic index of amino acids may be considered.
  • the hydropathic profile of a protein is calculated by assigning each amino acid a numerical value ("hydropathy index") and then repetitively averaging these values along the peptide chain.
  • Each amino acid has been assigned a hydropathic index on the basis of its hydrophobicity and charge characteristics.
  • the substitution of like amino acids can be made effectively on the basis of hydrophilicity, particularly where the biologically functional protein or peptide thereby created is intended for use in immunological embodiments, as in the present case.
  • the greatest local average hydrophilicity of a protein as governed by the hydrophilicity of its adjacent amino acids, correlates with its immunogenicity and antigen-binding or immunogenicity, that is, with a biological property of the protein.
  • hydrophilicity values have been assigned to these amino acid residues: arginine (+3.0); lysine (+3.0); aspartate (+3.0.+-.1); glutamate (+3.0.+-.1); serine (+0.3); asparagine (+0.2); glutamine (+0.2); glycine (0); threonine (-0.4); proline (-0.5.+-.1); alanine (-0.5); histidine (-0.5); cysteine (-1.0); methionine (-1.3); valine (-1.5); leucine (-1.8); isoleucine (-1.8); tyrosine (-2.3); phenylalanine (-2.5) and tryptophan (-3.4).
  • the substitution of amino acids whose hydrophilicity values are within .+1-2 is included, in other embodiments, those which are within .+/-.1 are included, and in still other embodiments, those within .+/-.0.5 are included.
  • a skilled artisan will be able to determine suitable variants of polypeptides as set forth herein using well-known techniques.
  • One skilled in the art may identify suitable areas of the molecule that may be changed without destroying activity by targeting regions not believed to be important for activity.
  • the skilled artisan also will be able to identify residues and portions of the molecules that are conserved among similar polypeptides.
  • even areas that may be important for biological activity or for structure may be subject to conservative amino acid substitutions without destroying the biological activity or without adversely affecting the polypeptide structure.
  • One skilled in the art can also analyze the three-dimensional structure and amino acid sequence in relation to that structure in similar polypeptides. In view of such information, one skilled in the art may predict the alignment of amino acid residues of an antibody with respect to its three dimensional structure. One skilled in the art may choose not to make radical changes to amino acid residues predicted to be on the surface of the protein, since such residues may be involved in important interactions with other molecules. Moreover, one skilled in the art may generate test variants containing a single amino acid substitution at each desired amino acid residue. These variants can then be screened using assays for DK 1 neutralizing activity, (see examples below) thus yielding information regarding which amino acids can be changed and which must not be changed. In other words, based on information gathered from such routine experiments, one skilled in the art can readily determine the amino acid positions where further substitutions should be avoided either alone or in combination with other mutations.
  • polypeptides or proteins that have a sequence identity of greater than 30%, or similarity greater than 40% often have similar structural topologies.
  • the recent growth of the protein structural database (PDB) has provided enhanced predictability of secondary structure, including the potential number of folds within a polypeptide's or protein's structure. See Holm et al, 1999, Nucl. Acid. Res. 27:244-247. It has been suggested (Brenner et al, 1997, Curr. Op. Struct. Biol. 7:369-376) that there are a limited number of folds in a given polypeptide or protein and that once a critical number of structures have been resolved, structural prediction will become dramatically more accurate.
  • Additional methods of predicting secondary structure include “threading” (Jones, 1997, Curr. Opin. Struct. Biol. 7:377-87; Sippl et al, 1996, Structure 4: 15-19), “profile analysis” (Bowie et al, 1991, Science 253: 164-170; Gribskov et al, 1990, Meth. Enzym. 183: 146-159; Gribskov et al, 1987, Proc. Nat. Acad. Sci. 84:4355-4358), and "evolutionary linkage” (See Holm, 1999, supra; and Brenner, 1997, supra).
  • amino acid substitutions are made that: (1) reduce susceptibility to proteolysis, (2) reduce susceptibility to oxidation, (3) alter binding affinity for forming protein complexes, (4) alter ligand or antigen binding affinities, and/or (4) confer or modify other physicochemical or functional properties on such polypeptides.
  • single or multiple amino acid substitutions may be made in the naturally-occurring sequence.
  • Substitutions can be made in that portion of the antibody that lies outside the domain(s) forming intermolecular contacts).
  • conservative amino acid substitutions can be used that do not substantially change the structural characteristics of the parent sequence (e.g., one or more replacement amino acids that do not disrupt the secondary structure that characterizes the parent or native antibody).
  • conservative amino acid substitutions can be used that do not substantially change the structural characteristics of the parent sequence (e.g., one or more replacement amino acids that do not disrupt the secondary structure that characterizes the parent or native antibody). Examples of art-recognized polypeptide secondary and tertiary structures are described in Proteins, Structures and Molecular Principles (Creighton, Ed.), 1984, W. H. New York: Freeman and Company; Introduction to Protein Structure (Branden and Tooze, eds.), 1991, New York: Garland Publishing; and Thornton et at., 1991, Nature 354: 105, which are each incorporated herein by reference.
  • the invention also encompasses glycosylation variants of the inventive antibodies wherein the number and/or type of glycosylation site(s) has been altered compared to the amino acid sequences of the parent polypeptide.
  • antibody protein variants comprise a greater or a lesser number of N-linked glycosylation sites than the native antibody.
  • An N-linked glycosylation site is characterized by the sequence: Asn-X-Ser or Asn-X-Thr, wherein the amino acid residue designated as X may be any amino acid residue except proline. The substitution of amino acid residues to create this sequence provides a potential new site for the addition of an N-linked carbohydrate chain.
  • substitutions that eliminate or alter this sequence will prevent addition of an N-linked carbohydrate chain present in the native polypeptide.
  • the glycosylation can be reduced by the deletion of an Asn or by substituting the Asn with a different amino acid.
  • one or more new N- linked sites are created.
  • Antibodies typically have a N-linked glycosylation site in the Fc region.
  • Additional preferred antibody variants include cysteine variants wherein one or more cysteine residues in the parent or native amino acid sequence are deleted from or substituted with another amino acid (e.g., serine). Cysteine variants are useful, inter alia when antibodies must be refolded into a biologically active conformation. Cysteine variants may have fewer cysteine residues than the native antibody, and typically have an even number to minimize interactions resulting from unpaired cysteines.
  • the heavy and light chains, variable regions domains and CDRs that are disclosed can be used to prepare polypeptides that contain an antigen binding region that can specifically bind to a DK 1 polypeptide.
  • one or more of the CDRs listed in Table 1 can be incorporated into a molecule (e.g., a polypeptide) covalently or noncovalently to make an immunoadhesion.
  • An immunoadhesion may incorporate the CDR(s) as part of a larger polypeptide chain, may covalently link the CDR(s) to another polypeptide chain, or may incorporate the CDR(s) noncovalently.
  • the CDR(s) enable the immunoadhesion to bind specifically to a particular antigen of interest (e.g., a DKKl polypeptide or epitope thereof).
  • Mimetics e.g., peptide mimetics” or “peptidomimetics” based upon the variable region domains and CDRs that are described herein are also provided. These analogs can be peptides, non-peptides or combinations of peptide and non-peptide regions. Fauchere, 1986, Adv. Drug Res. 15: 29; Veber and Freidinger, 1985, TINS p. 392; and Evans et al, 1987, J. Med. Chem. 30: 1229, which are incorporated herein by reference for any purpose. Peptide mimetics that are structurally similar to therapeutically useful peptides may be used to produce a similar therapeutic or prophylactic effect.
  • peptidomimetics of the invention are proteins that are structurally similar to an antibody displaying a desired biological activity, such as here the ability to specifically bind DKKl, but have one or more peptide linkages optionally replaced by a linkage selected from: -CH2NH-, -CH2S-, -CH2-CH.2-, -CH-CH-(cis and trans), - COCH2-, ⁇ CH(OH)CH2 ⁇ , and -CH2SO-, by methods well known in the art.
  • Systematic substitution of one or more amino acids of a consensus sequence with a D-amino acid of the same type may be used in certain embodiments of the invention to generate more stable proteins.
  • constrained peptides comprising a consensus sequence or a substantially identical consensus sequence variation may be generated by methods known in the art (Rizo and Gierasch, 1992, Ann. Rev. Biochem. 61 : 387), incorporated herein by reference), for example, by adding internal cysteine residues capable of forming intramolecular disulfide bridges which cyclize the peptide.
  • the derivatized antibody or fragment may comprise any molecule or substance that imparts a desired property to the antibody or fragment, such as increased half-life in a particular use.
  • the derivatized antibody can comprise, for example, a detectable (or labeling) moiety (e.g., a radioactive, colorimetric, antigenic or enzymatic molecule, a detectable bead (such as a magnetic or electrodense (e.g., gold) bead), or a molecule that binds to another molecule (e.g., biotin or streptavidin)), a therapeutic or diagnostic moiety
  • a detectable (or labeling) moiety e.g., a radioactive, colorimetric, antigenic or enzymatic molecule, a detectable bead (such as a magnetic or electrodense (e.g., gold) bead
  • a detectable bead such as a magnetic or electrodense (e.g., gold) bead
  • an antibody e.g., a radioactive, cytotoxic, or pharmaceutically active moiety
  • a molecule that increases the suitability of the antibody for a particular use e.g., administration to a subject, such as a human subject, or other in vivo or in vitro uses.
  • molecules that can be used to derivatize an antibody include albumin (e.g., human serum albumin) and polyethylene glycol (PEG).
  • Albumin-linked and PEGylated derivatives of antibodies can be prepared using techniques well known in the art.
  • the antibody is conjugated or otherwise linked to transthyretin (TTR) or a TTR variant.
  • TTR transthyretin
  • the TTR or TTR variant can be chemically modified with, for example, a chemical selected from the group consisting of dextran, poly(n- vinyl pyrrolidone), polyethylene glycols, propropylene glycol homopolymers, polypropylene oxide/ethylene oxide co-polymers, polyoxyethylated polyols and polyvinyl alcohols.
  • Other derivatives include covalent or aggregative conjugates of anti-DKKl antibodies, or fragments thereof, with other proteins or polypeptides, such as by expression of recombinant fusion proteins comprising heterologous polypeptides fused to the N-terminus or C- terminus of an anti-DKKl antibody polypeptide.
  • the conjugated peptide may be a heterologous signal (or leader) polypeptide, e.g., the yeast alpha- factor leader, or a peptide such as an epitope tag.
  • Anti-DKKl antibody-containing fusion proteins can comprise peptides added to facilitate purification or identification of the anti-DKKl antibody (e.g., poly-His).
  • An anti- DKKl antibody polypeptide also can be linked to the FLAG peptide as described in Hopp et al, Bio/Technology 6: 1204, 1988, and U.S. Pat. No. 5,011,912.
  • the FLAG peptide is highly antigenic and provides an epitope reversibly bound by a specific monoclonal antibody (mAb), enabling rapid assay and facile purification of expressed recombinant protein.
  • mAb monoclonal antibody
  • Reagents useful for preparing fusion proteins in which the FLAG peptide is fused to a given polypeptide are commercially available (Sigma, St. Louis, Mo.).
  • Oligomers that contain one or more anti-DKKl antibody polypeptides may be employed as DKKl antagonists. Oligomers may be in the form of covalently-linked or non- covalently-linked dimers, trimers, or higher. Oligomers comprising two or more anti-DKKl antibody polypeptides are contemplated for use, with one example being a homodimer. Other oligomers include heterodimers, homotrimers, heterotrimers, homotetramers, heterotetramers, etc.
  • One embodiment is directed to oligomers comprising multiple anti-DKKl antibody polypeptides joined via covalent or non-covalent interactions between peptide moieties fused to the anti-DKKl antibody polypeptides.
  • Such peptides may be peptide linkers (spacers), or peptides that have the property of promoting oligomerization.
  • Leucine zippers and certain polypeptides derived from antibodies are among the peptides that can promote oligomerization of anti-DKKl antibody polypeptides attached thereto, as described in more detail below.
  • the oligomers comprise from two to four anti-DKKl antibody polypeptides.
  • the anti-DKKl antibody moieties of the oligomer may be in any of the forms described above, e.g., variants or fragments.
  • the oligomers comprise anti- DK 1 antibody polypeptides that have DKK1 binding activity.
  • an oligomer is prepared using polypeptides derived from immunoglobulins.
  • Preparation of fusion proteins comprising certain heterologous polypeptides fused to various portions of antibody-derived polypeptides (including the Fc domain) has been described, e.g., by Ashkenazi et al, 1991, PNAS USA 88: 10535; Byrn et al, 1990, Nature 344:677; and Hollenbaugh et al., 1992 "Construction of Immunoglobulin Fusion Proteins", in Current Protocols in Immunology, Suppl. 4, pages 10.19.1-10.19.11.
  • One embodiment of the present invention is directed to a dimer comprising two fusion proteins created by fusing a DK 1 binding fragment of an anti-DK l antibody to the Fc region of an antibody.
  • the dimer can be made by, for example, inserting a gene fusion encoding the fusion protein into an appropriate expression vector, expressing the gene fusion in host cells transformed with the recombinant expression vector, and allowing the expressed fusion protein to assemble much like antibody molecules, whereupon interchain disulfide bonds form between the Fc moieties to yield the dimer.
  • Fc polypeptide as used herein includes native and mutein forms of polypeptides derived from the Fc region of an antibody. Truncated forms of such polypeptides containing the hinge region that promotes dimerization also are included. Fusion proteins comprising Fc moieties (and oligomers formed therefrom) offer the advantage of facile purification by affinity chromatography over Protein A or Protein G columns.
  • Fc polypeptide described in PCT application WO 93/10151 and U.S. Pat. Nos. 5,426,048 and 5,262,522 (each of which is hereby incorporated by reference), is a single chain polypeptide extending from the N-terminal hinge region to the native C-terminus of the Fc region of a human IgGl antibody.
  • Another useful Fc polypeptide is the Fc mutein described in U.S. Pat. No. 5,457,035 and in Baum et al, 1994, EMBO J. 13:3992-4001.
  • amino acid sequence of this mutein is identical to that of the native Fc sequence presented in WO 93/10151, except that amino acid 19 has been changed from Leu to Ala, amino acid 20 has been changed from Leu to Glu, and amino acid 22 has been changed from Gly to Ala.
  • the mutein exhibits reduced affinity for Fc receptors.
  • variable portion of the heavy and/or light chains of an anti-DKKl antibody such as disclosed herein may be substituted for the variable portion of an antibody heavy and/or light chain.
  • the oligomer is a fusion protein comprising multiple anti-DKKl antibody polypeptides, with or without peptide linkers (spacer peptides).
  • suitable peptide linkers are those described in U.S. Pat. Nos. 4,751,180 and 4,935,233.
  • Leucine zipper domains are peptides that promote
  • Leucine zippers were originally identified in several DNA-binding proteins (Landschulz et al, 1988, Science 240: 1759), and have since been found in a variety of different proteins. Among the known leucine zippers are naturally occurring peptides and derivatives thereof that dimerize or trimerize. Examples of leucine zipper domains suitable for producing soluble oligomeric proteins are described in PCT application WO 94/10308, and the leucine zipper derived from lung surfactant protein D (SPD) described in Hoppe et al, 1994, FEBS Letters 344: 191, hereby incorporated by reference.
  • SPD lung surfactant protein D
  • a modified leucine zipper that allows for stable trimerization of a heterologous protein fused thereto is described in Fanslow et al, 1994, Semin. Immunol. 6:267-78.
  • recombinant fusion proteins comprising an anti-DKKl antibody fragment or derivative fused to a leucine zipper peptide are expressed in suitable host cells, and the soluble oligomeric anti-DKKl antibody fragments or derivatives that form are recovered from the culture supernatant.
  • Some antibodies that are provided have a binding affinity (Ka) for DKKl of at least 10 4 or 10 5 /M x seconds measured, for instance, as described in the examples below.
  • Other antibodies have a k a of at least 10 6 , 10 7 , 10 8 or 10 9 /M x seconds.
  • Certain antibodies that are provided have a low disassociation rate.
  • Some antibodies, for instance, have a Koff of lxl 0 ' V 1 , lxl O ' V 1 or lower.
  • the present invention provides an anti-DKKl antibody having a half-life of at least one day in vitro or in vivo (e.g., when administered to a human subject).
  • the antibody has a half-life of at least three days.
  • the antibody or portion thereof has a half- life of four days or longer.
  • the antibody or portion thereof has a half- life of eight days or longer.
  • the antibody or antigen-binding portion thereof is derivatized or modified such that it has a longer half-life as compared to the underivatized or unmodified antibody.
  • the antibody contains point mutations to increase serum half life, such as described in WO 00/09560.
  • hybridization probes for identifying, analyzing, mutating or amplifying a polynucleotide encoding a polypeptide, anti-sense nucleic acids for inhibiting expression of a polynucleotide, and complementary sequences of the foregoing are also provided.
  • the nucleic acids can be any length.
  • nucleic acids can be single-stranded or double-stranded and can comprise RNA and/or DNA nucleotides, and artificial variants thereof (e.g., peptide nucleic acids).
  • nucleic acids that encode the epitope to which certain of the antibodies provided herein bind are also provided.
  • nucleic acids that encode amino acids 221-229 and/or 246- 253 of SEQ ID NO:2 are included, as are nucleic acids that encode amino acids 221-236 and/or 246-262 of SEQ ID NO:2 and those that encode amino acids 221 to 262 of SEQ ID NO:2 or amino acids 221-253 of SEQ ID NO:2.
  • Nucleic acids encoding fusion proteins that include these peptides are also provided.
  • DNA encoding antibody polypeptides may be isolated from B-cells of mice that have been immunized with DK 1 or an immunogenic fragment thereof.
  • the DNA may be isolated by conventional procedures such as polymerase chain reaction (PCR).
  • Phage display is another example of a known technique whereby derivatives of antibodies may be prepared.
  • polypeptides that are components of an antibody of interest are expressed in any suitable recombinant expression system, and the expressed polypeptides are allowed to assemble to form antibody molecules.
  • nucleic acids that encode the light and heavy chains, variable regions and CDRs of the antibodies and immunologically functional fragments that are provided are listed in Table 1 above. Due to the degeneracy of the genetic code, each of the polypeptide sequences listed in Table 1 is also encoded by a large number of other nucleic acid sequences besides those listed in Table 1. The present invention provides each degenerate nucleotide sequence encoding each antibody of the invention.
  • the invention further provides nucleic acids that hybridize to other nucleic acids
  • nucleic acids comprising a nucleotide sequence listed in Tables 1-3
  • hybridization conditions Methods for hybridizing nucleic acids are well-known in the art. See, e.g., Current Protocols in Molecular Biology, John Wiley & Sons, N.Y. (1989), 6.3.1-6.3.6.
  • a moderately stringent hybridization condition uses a prewashing solution containing 5.times, sodium chloride/sodium citrate (SSC), 0.5% SDS, 1.0 mM EDTA (pH 8.0), hybridization buffer of about 50% formamide, 6.times.SSC, and a hybridization temperature of 55° C.
  • a stringent hybridization condition hybridizes in 6x SSC at 45° C, followed by one or more washes in 0. lx SSC, 0.2% SDS at 68° C.
  • one of skill in the art can manipulate the hybridization and/or washing conditions to increase or decrease the stringency of hybridization such that nucleic acids comprising nucleotide sequences that are at least 65, 70, 75, 80, 85, 90, 95, 98 or 99% identical to each other typically remain hybridized to each other.
  • Changes can be introduced by mutation into a nucleic acid, thereby leading to changes in the amino acid sequence of a polypeptide (e.g., an antibody or antibody derivative of the invention) that it encodes. Mutations can be introduced using any technique known in the art. In one embodiment, one or more particular amino acid residues are changed using, for example, a site-directed mutagenesis protocol. In another embodiment, one or more randomly selected residue is changed using, for example, a random mutagenesis protocol. However it is made, a mutant polypeptide can be expressed and screened for a desired property.
  • a polypeptide e.g., an antibody or antibody derivative of the invention
  • Mutations can be introduced into a nucleic acid without significantly altering the biological activity of a polypeptide that it encodes. For example, one can make nucleotide substitutions leading to amino acid substitutions at non-essential amino acid residues.
  • one or more mutations can be introduced into a nucleic acid that selectively change the biological activity of a polypeptide that it encodes.
  • the mutation can be introduced into a nucleic acid that selectively change the biological activity of a polypeptide that it encodes.
  • the mutation can be introduced into a nucleic acid that selectively change the biological activity of a polypeptide that it encodes.
  • the mutation can be introduced into a nucleic acid that selectively change the biological activity of a polypeptide that it encodes.
  • the mutation can
  • the present invention provides nucleic acid molecules that are suitable for use as primers or hybridization probes for the detection of nucleic acid sequences of the invention.
  • a nucleic acid molecule of the invention can comprise only a portion of a nucleic acid sequence encoding a full-length polypeptide of the invention, for example, a fragment that can be used as a probe or primer or a fragment encoding an active portion (e.g., a DK 1 binding portion) of a polypeptide of the invention.
  • Probes based on the sequence of a nucleic acid of the invention can be used to detect the nucleic acid or similar nucleic acids, for example, transcripts encoding a polypeptide of the invention.
  • the probe can comprise a label group, e.g., a radioisotope, a fluorescent compound, an enzyme, or an enzyme co-factor. Such probes can be used to identify a cell that expresses
  • the present invention provides vectors comprising a nucleic acid encoding a polypeptide of the invention or a portion thereof (e.g., a fragment containing one or more CDRs or one or more variable region domains).
  • vectors include, but are not limited to, plasmids, viral vectors, non-episomal mammalian vectors and expression vectors, for example, recombinant expression vectors.
  • the recombinant expression vectors of the invention can comprise a nucleic acid of the invention in a form suitable for expression of the nucleic acid in a host cell.
  • the recombinant expression vectors include one or more regulatory sequences, selected on the basis of the host cells to be used for expression, which is operably linked to the nucleic acid sequence to be expressed.
  • Regulatory sequences include those that direct constitutive expression of a nucleotide sequence in many types of host cells (e.g., SV40 early gene enhancer, Rous sarcoma virus promoter and cytomegalovirus promoter), those that direct expression of the nucleotide sequence only in certain host cells (e.g., tissue-specific regulatory sequences, see Voss et al, 1986, Trends Biochem. Sci. 11 :287, Maniatis et al, 1987, Science
  • the expression vector can depend on such factors as the choice of the host cell to be transformed, the level of expression of protein desired, etc.
  • the expression vectors of the invention can be introduced into host cells to thereby produce proteins or peptides, including fusion proteins or peptides, encoded by nucleic acids as described herein.
  • the present invention provides host cells into which a recombinant expression vector of the invention has been introduced.
  • a host cell can be any prokaryotic cell (for example, E. coli) or eukaryotic cell (for example, yeast, insect, or mammalian cells (e.g., CHO cells)).
  • Vector DNA can be introduced into prokaryotic or eukaryotic cells via conventional transformation or transfection techniques. For stable transfection of mammalian cells, it is known that, depending upon the expression vector and transfection technique used, only a small fraction of cells may integrate the foreign DNA into their genome.
  • a gene that encodes a selectable marker (e.g., for resistance to antibiotics) is generally introduced into the host cells along with the gene of interest.
  • selectable markers include those which confer resistance to drugs, such as G418, hygromycin and methotrexate.
  • Cells stably transfected with the introduced nucleic acid can be identified by drug selection (e.g., cells that have incorporated the selectable marker gene will survive, while the other cells die), among other methods.
  • non-human antibodies can be, for example, derived from any antibody-producing animal, such as mouse, rat, rabbit, goat, donkey, or non-human primate (such as monkey (e.g., cynomologous or rhesus monkey) or ape (e.g., chimpanzee)).
  • non-human primate such as monkey (e.g., cynomologous or rhesus monkey) or ape (e.g., chimpanzee)
  • Non-human antibodies can be used, for instance, in in vitro cell culture and cell-culture based applications, or any other application where an immune response to the antibody does not occur or is
  • the antibodies may be produced by immunizing with full-length DKKl or with the carboxy-terminal half of DKKl .
  • the certain non-human antibodies may be raised by immunizing with amino acids 221-236 and/or amino acids 246-262 of SEQ ID NO:2, which are segments of human DKKl that form part of the epitope to which certain antibodies provided herein bind (e.g., the 11H10, see FIG. 1).
  • the antibodies may be polyclonal, monoclonal, or may be synthesized in host cells by expressing recombinant DNA.
  • Fully human antibodies may be prepared as described above by immunizing transgenic animals containing human immunoglobulin loci or by selecting a phage display library that is expressing a repertoire of human antibodies.
  • the monoclonal antibodies (mAbs) of the invention can be produced by a variety of techniques, including conventional monoclonal antibody methodology, e.g., the standard somatic cell hybridization technique of Kohler and Milstein, 1975, Nature 256: 495.
  • monoclonal antibodies can be employed, for example, the viral or oncogenic transformation of B-lymphocytes.
  • One suitable animal system for preparing hybridomas is the murine system, which is a very well established procedure.
  • Immunization protocols and techniques for isolation of immunized splenocytes for fusion are known in the art.
  • B cells from immunized mice are fused with a suitable immortalized fusion partner, such as a murine myeloma cell line.
  • a suitable immortalized fusion partner such as a murine myeloma cell line.
  • rats or other mammals besides can be immunized instead of mice and B cells from such animals can be fused with the murine myeloma cell line to form hybridomas.
  • a myeloma cell line from a source other than mouse may be used. Fusion procedures for making hybridomas also are well known.
  • the single chain antibodies that are provided may be formed by linking heavy and light chain variable domain (Fv region) fragments (see, e.g., Table 1) via an amino acid bridge (short peptide linker), resulting in a single polypeptide chain.
  • Fv region heavy and light chain variable domain
  • Such single-chain Fvs may be prepared by fusing DNA encoding a peptide linker between DNAs encoding the two variable domain polypeptides (VL and VH).
  • the resulting polypeptides can fold back on themselves to form antigen-binding monomers, or they can form multimers (e.g., dimers, trimers, or tetramers), depending on the length of a flexible linker between the two variable domains (Kortt et al., 1997, Prot. Eng. 10:423; Kortt et al, 2001, Biomol. Eng. 18:95-108).
  • VL and VH-comprising polypeptides By combining different VL and VH-comprising polypeptides, one can form multimeric scFvs that bind to different epitopes (Kriangkum et al, 2001, Biomol. Eng. 18:31-40). Techniques developed for the production of single chain antibodies include those described in U.S. Pat. No.
  • Antibodies provided herein that are of one subclass can be changed to antibodies from a different subclass using subclass switching methods.
  • the variable domains depicted in Table 1 can be attached to constant domains of any desired Ig subtype.
  • Such techniques allow the preparation of new antibodies that possess the antigen-binding properties of a given antibody (the parent antibody), but also exhibit biological properties associated with an antibody isotype or subclass different from that of the parent antibody.
  • Recombinant DNA techniques may be employed. Cloned DNA encoding particular antibody polypeptides may be employed in such procedures, e.g., DNA encoding the constant domain of an antibody of the desired isotype. See, e.g., Lantto et al, 2002, Methods Mol. Biol.l78:303-16.
  • the antibodies that are provided include a desired isotype (for example, IgA, IgGl, IgG2, IgG3, IgG4, IgE, and IgD) as well as Fab or F(ab') 2 fragments thereof.
  • a desired isotype for example, IgA, IgGl, IgG2, IgG3, IgG4, IgE, and IgD
  • Fab or F(ab') 2 fragments thereof e.gA, IgGl, IgG2, IgG3, IgG4, IgE, and IgD
  • Fab or F(ab') 2 fragments thereof e.gA, IgGl, IgG2, IgG3, IgG4, IgE, and IgD
  • Fab or F(ab') 2 fragments thereof e.gA, IgGl, IgG2, IgG3, IgG4, IgE, and IgD
  • chain shuffling involves displaying immunoglobulin variable domain gene repertoires on the surface of filamentous bacteriophage, often referred to as phage display.
  • Chain shuffling has been used to prepare high affinity antibodies to the hapten 2-phenyloxazol-5-one, as described by Marks et al, 1992, BioTechnology, 10:779.
  • Antibodies and functional fragments thereof according to the invention may be further modified in various ways. For example, if they are to be used for therapeutic purposes, they may be conjugated with polyethylene glycol (pegylated) to prolong the serum half-life or to enhance protein delivery. Alternatively, the V region of the subject antibodies or fragments thereof may be fused with the Fc region of a different antibody molecule. The Fc region used for this purpose may be modified so that it does not bind complement, thus reducing the likelihood of inducing cell lysis in the patient when the fusion protein is used as a therapeutic agent. In addition, the subject antibodies or functional fragments thereof may be conjugated with human serum albumin to enhance the serum half-life of the antibody or fragment thereof. Another useful fusion partner for the inventive antibodies or fragments thereof is transthyretin (TTR). TTR has the capacity to form a tetramer, thus an antibody-TTR fusion protein can form a multivalent antibody which may increase its binding avidity.
  • TTR transthyretin
  • substantial modifications in the functional and/or biochemical characteristics of the antibodies and fragments described herein may be achieved by creating substitutions in the amino acid sequence of the heavy and light chains that differ significantly in their effect on maintaining (a) the structure of the molecular backbone in the area of the substitution, for example, as a sheet or helical conformation, (b) the charge or hydrophobicity of the molecule at the target site, or (c) the bulkiness of the side chain.
  • a "conservative amino acid substitution” may involve a substitution of a native amino acid residue with a nonnative residue that has little or no effect on the polarity or charge of the amino acid residue at that position.
  • any native residue in the polypeptide may also be substituted with alanine, as has been previously described for alanine scanning mutagenesis.
  • Amino acid substitutions (whether conservative or non-conservative) of the subject antibodies can be implemented by those skilled in the art by applying routine techniques. Amino acid substitutions can be used to identify important residues of the antibodies provided herein, or to increase or decrease the affinity of these antibodies for human DK 1 or for modifying the binding affinity of other anti-DK l antibodies described herein.
  • anti-DKKl antibodies and immunological functional fragments can be prepared by any of a number of conventional techniques.
  • anti-DKKl antibodies may be produced by recombinant expression systems, using any technique known in the art. See, for example, Monoclonal Antibodies, Hybridomas: A New Dimension in Biological Analyses, Kennet et al. (eds.) Plenum Press, New York (1980): and Antibodies: A Laboratory Manual, Harlow and Lane (eds.), Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. (1988).
  • Antibodies of the present invention can be expressed in hybridoma cell lines or in cell lines other than hybridomas.
  • Expression constructs encoding the antibodies can be used to transform a mammalian, insect or microbial host cell. Transformation can be performed using any known method for introducing polynucleotides into a host cell, including, for example packaging the polynucleotide in a virus or bacteriophage and transducing a host cell with the construct by transfection procedures known in the art, as exemplified by U.S. Pat. Nos.
  • heterologous polynucleotides into mammalian cells are well known in the art and include, but are not limited to, dextran-mediated transfection, calcium phosphate precipitation, polybrene mediated transfection, protoplast fusion, electroporation, encapsulation of the polynucleotide(s) in liposomes, mixing nucleic acid with positively-charged lipids, and direct microinjection of the DNA into nuclei.
  • Recombinant expression constructs of the invention typically comprise a nucleic acid molecule encoding a polypeptide comprising one or more of the following: a heavy chain constant region (e.g., CHI, CH2 and/or CH3); a heavy chain variable region; a light chain constant region; a light chain variable region; one or more CDRs of the light or heavy chain of the anti-DKKl antibody.
  • a heavy chain constant region e.g., CHI, CH2 and/or CH3
  • a heavy chain variable region e.g., CHI, CH2 and/or CH3
  • a heavy chain variable region e.g., CHI, CH2 and/or CH3
  • a heavy chain variable region e.g., CHI, CH2 and/or CH3
  • a heavy chain variable region e.g., CHI, CH2 and/or CH3
  • a heavy chain variable region e.g., CHI, CH2 and/or CH3
  • a heavy chain variable region
  • the vector is typically selected to be functional in the particular host cell employed (i.e., the vector is compatible with the host cell machinery, permitting amplification and/or expression of the gene can occur).
  • vectors are used that employ protein- fragment complementation assays using protein reporters, such as dihydrofolate reductase (see, for example, U.S. Pat. No. 6,270,964).
  • Suitable expression vectors can be purchased, for example, from Invitrogen Life Technologies or BD Biosciences (formerly "Clontech”).
  • Other useful vectors for cloning and expressing the antibodies and fragments of the invention include those described in Bianchi and McGrew, Biotech Biotechnol Bioeng 84(4):439-44 (2003). Additional suitable expression vectors are discussed, for example, in Methods Enzymol, vol. 185 (D. V. Goeddel, ed.), 1990, New York: Academic Press, which is hereby incorporated by reference.
  • expression vectors used in any of the host cells contain sequences for plasmid or virus maintenance and for cloning and expression of exogenous nucleotide sequences.
  • sequences collectively referred to as "flanking sequences” typically include one or more of the following operatively linked nucleotide sequences: a promoter, one or more enhancer sequences, an origin of replication, a transcriptional termination sequence, a complete intron sequence containing a donor and acceptor splice site, a sequence encoding a leader sequence for polypeptide secretion, a ribosome binding site, a polyadenylation sequence, a polylinker region for inserting the nucleic acid encoding the polypeptide to be expressed, and a selectable marker element.
  • the vector may contain a "tag" -encoding sequence, that is, an oligonucleotide molecule located at the 5 ' or 3' end of the coding sequence, the oligonucleotide sequence encoding polyHis (such as hexaHis), or another "tag" for which commercially available
  • antibodies exist, such as FLAG , HA (hemaglutinin from influenza virus), or myc.
  • the tag is typically fused to the antibody protein upon expression, and can serve as a means for affinity purification of the antibody from the host cell. Affinity purification can be accomplished, for example, by column chromatography using antibodies against the tag as an affinity matrix.
  • the tag can subsequently be removed from the purified antibody polypeptide by various means such as using certain peptidases for cleavage.
  • Flanking sequences in the expression vector may be homologous (i.e. , from the same species and/or strain as the host cell), heterologous (i.e., from a species other than the host cell species or strain), hybrid (i.e., a combination of flanking sequences from more than one source), synthetic or native.
  • the source of a flanking sequence may be any prokaryotic or eukaryotic organism, any vertebrate or invertebrate organism, or any plant, provided that the flanking sequence is functional in, and can be activated by, the host cell machinery.
  • Flanking sequences useful in the vectors of this invention may be obtained by any of several methods well known in the art.
  • flanking sequences useful herein will have been previously identified by mapping and/or by restriction endonuclease digestion and can thus be isolated from the proper tissue source using the appropriate restriction endonucleases.
  • the full nucleotide sequence of a flanking sequence may be known.
  • the flanking sequence may be synthesized using the methods described herein for nucleic acid synthesis or cloning.
  • flanking sequence may be obtained using PCR and/or by screening a genomic library with a suitable oligonucleotide and/or flanking sequence fragment from the same or another species.
  • flanking sequence may be not known, a fragment of DNA containing a flanking sequence may be isolated from a larger piece of DNA that may contain, for example, a coding sequence or even another gene or genes. Isolation may be accomplished by restriction endonuclease digestion to produce the proper DNA fragment followed by isolation using agarose gel purification, QiagenTM column chromatography
  • An origin of replication is typically a part of prokaryotic expression vectors, particularly those purchased commercially, and the origin aids in the amplification of the vector in a host cell. If the vector of choice does not contain an origin of replication site, one may be chemically synthesized based on a known sequence, and ligated into the vector.
  • the origin of replication from the plasmid pBR322 (New England Biolabs, Beverly, Mass.) is suitable for most gram-negative bacteria and various origins (e.g., SV40, polyoma, adenovirus, vesicular stomatitis virus (VSV), or papillomaviruses such as HPV or BPV) are useful for cloning vectors in mammalian cells.
  • origins e.g., SV40, polyoma, adenovirus, vesicular stomatitis virus (VSV), or papillomaviruses such as HPV or BPV
  • a mammalian origin of replication is not needed for mammalian expression vectors (for example, the SV40 origin is often used only because it contains the early promoter).
  • the expression and cloning vectors of the present invention will typically contain a promoter that is recognized by the host organism and operably linked to nucleic acid encoding the anti-DK l antibody or immunologically functional fragment thereof Promoters are untranscribed sequences located upstream (i.e., 5') to the start codon of a structural gene
  • Promoters are conventionally grouped into one of two classes: inducible promoters and constitutive promoters.
  • Inducible promoters initiate increased levels of transcription from DNA under their control in response to some change in culture conditions, such as the presence or absence of a nutrient or a change in temperature.
  • Constitutive promoters initiate continuous gene product production; that is, there is little or no experimental control over gene expression.
  • a large number of promoters, recognized by a variety of potential host cells, are well known.
  • a suitable promoter is operably linked to the DNA encoding anti-DK l antibody by removing the promoter from the source DNA by restriction enzyme digestion or amplifying the promoter by polymerase chain reaction and inserting the desired promoter sequence into the vector.
  • Suitable promoters for use with yeast hosts are also well known in the art.
  • Yeast enhancers are advantageously used with yeast promoters.
  • Suitable promoters for use with mammalian host cells are well known and include, but are not limited to, those obtained from the genomes of viruses such as polyoma virus, fowlpox virus, adenovirus (such as Adenovirus 2), bovine papilloma virus, avian sarcoma virus, cytomegalovirus, retroviruses, hepatitis-B virus and
  • SV40 Simian Virus 40
  • suitable mammalian promoters include heterologous mammalian promoters, for example, heat-shock promoters and the actin promoter.
  • promoters useful in the practice of the recombinant expression vectors of the invention include, but are not limited to: the SV40 early promoter region (Bemoist and
  • the CMV promoter the promoter contained in the 3' long terminal repeat of Rous sarcoma virus (Yamamoto, et al, 1980, Cell 22: 787-97); the herpes thymidine kinase promoter (Wagner et al, 1981, Proc. Natl. Acad. Sci. U.S.A. 78: 1444-45); the regulatory sequences of the metallothionine gene (Brinster et al., 1982, Nature 296: 39-42); prokaryotic expression vectors such as the beta-lactamase promoter (Villa-Kamaroff et al., 1978,
  • Enhancers may be inserted into the vector to increase the transcription in higher eukaryotes of a nucleic acid encoding an anti-DK l antibody or immunologically functional fragment thereof of the present invention.
  • Enhancers are cis-acting elements of DNA, usually about 10-300 bp in length, that act on promoters to increase transcription. Enhancers are relatively orientation and position independent. They have been found 5' and 3' to the
  • enhancer sequences available from mammalian genes are known (e.g., globin, elastase, albumin, alpha-feto-protein and insulin).
  • An enhancer sequence from a virus also can be used.
  • the SV40 enhancer, the cytomegalovirus early promoter enhancer, the polyoma enhancer, and adenovirus enhancers are exemplary enhancing elements for the activation of eukaryotic promoters. While an enhancer may be spliced into the vector at a position 5' or 3' to a nucleic acid molecule, it is typically placed at a site 5' to the promoter.
  • a transcription termination sequence is typically located 3' of the end of a polypeptide-coding region and serves to terminate transcription.
  • a transcription termination sequence used for expression in prokaryotic cells typically is a G-C rich fragment followed by a poly-T sequence. While the sequence is easily cloned from a library or even purchased commercially as part of a vector, it can also be readily synthesized using methods for nucleic acid synthesis such as those described herein.
  • a selectable marker gene element encodes a protein necessary for the survival and growth of a host cell grown in a selective culture medium.
  • Typical selection marker genes used in expression vectors encode proteins that (a) confer resistance to antibiotics or other toxins, e.g., ampicillin, tetracycline, or kanamycin for prokaryotic host cells; (b) complement auxotrophic deficiencies of the cell; or (c) supply critical nutrients not available from complex media.
  • selectable markers examples include the kanamycin resistance gene, the ampicillin resistance gene and the tetracycline resistance gene.
  • a bacterial neomycin resistance gene can also be used for selection in both prokaryotic and eukaryotic host cells.
  • selection genes can be used to amplify the gene that will be expressed. Amplification is a process whereby genes that cannot in single copy be expressed at high enough levels to permit survival and growth of cells under certain selection conditions are reiterated in tandem within the chromosomes of successive generations of recombinant cells.
  • suitable amplifiable selectable markers for mammalian cells include dihydrofolate reductase (DHFR) and promoterless thymidine kinase. In the use of these markers mammalian cell transformants are placed under selection pressure wherein only the transformants are uniquely adapted to survive by virtue of the selection gene present in the vector.
  • DHFR dihydrofolate reductase
  • promoterless thymidine kinase promoterless thymidine kinase
  • Selection pressure is imposed by culturing the transformed cells under conditions in which the concentration of selection agent in the medium is successively increased, thereby permitting survival of only those cells in which the selection gene has been amplified.
  • DNA adjacent to the selection gene such as DNA encoding an antibody of the invention, is co-amplified with the selection gene.
  • increased quantities of anti-DK l polypeptide are synthesized from the amplified DNA.
  • a ribosome-binding site is usually necessary for translation initiation of mRNA and is characterized by a Shine-Dalgarno sequence (prokaryotes) or a Kozak sequence
  • the element is typically located 3' to the promoter and 5' to the coding sequence of the polypeptide to be expressed.
  • various presequences can be manipulated to improve glycosylation or yield.
  • the peptidase cleavage site of a particular signal peptide can be altered, or pro- sequences added, which also may affect glycosylation.
  • the final protein product may have, in the -1 position (relative to the first amino acid of the mature protein) one or more additional amino acids incident to expression, which may not have been totally removed.
  • the final protein product may have one or two amino acid residues found in the peptidase cleavage site, attached to the amino-terminus.
  • use of some enzyme cleavage sites may result in a slightly truncated yet active form of the desired polypeptide, if the enzyme cuts at such area within the mature polypeptide.
  • the vector can be modified by individually ligating these sequences into the vector. After the vector has been chosen and modified as desired, a nucleic acid molecule encoding an anti-DKKl antibody or immunologically functional fragment thereof is inserted into the proper site of the vector.
  • the completed vector containing sequences encoding the inventive antibody or immunologically functional fragment thereof is inserted into a suitable host cell for amplification and/or polypeptide expression.
  • the transformation of an expression vector for an anti-DKKl antibody immunologically functional fragment thereof into a selected host cell may be accomplished by well-known methods including methods such as transfection, infection, calcium chloride, electroporation, microinjection, lipofection, DEAE-dextran method, or other known techniques. The method selected will in part be a function of the type of host cell to be used. These methods and other suitable methods are well known to the skilled artisan.
  • the transformed host cell when cultured under appropriate conditions, synthesizes an anti-DKKl antibody or functional fragment thereof that can subsequently be collected from the culture medium (if the host cell secretes it into the medium) or directly from the host cell producing it (if it is not secreted).
  • the selection of an appropriate host cell will depend upon various factors, such as desired expression levels, polypeptide modifications that are desirable or necessary for activity (such as glycosylation or phosphorylation) and ease of folding into a biologically active molecule.
  • Mammalian cell lines available as hosts for expression are well known in the art and include, but are not limited to, many immortalized cell lines available from the American Type Culture Collection (ATCC), such as Chinese hamster ovary (CHO) cells, HeLa cells, baby hamster kidney (BHK) cells, monkey kidney cells (COS), human hepatocellular carcinoma cells (e.g., Hep G2), and a number of other cell lines.
  • ATCC American Type Culture Collection
  • CHO Chinese hamster ovary
  • HeLa cells HeLa cells
  • BHK baby hamster kidney
  • COS monkey kidney cells
  • human hepatocellular carcinoma cells e.g., Hep G2
  • the best cell line for expressing a particular DNA construct may be selected by testing various cell lines to determine which ones have the highest levels of expression levels and produce antibodies with constitutive DKKl binding properties.
  • the invention also provides compositions comprising the subject anti-DKKl antibodies or immunologically functional fragments thereof together with one or more of the following: a pharmaceutically acceptable diluent; a carrier; a solubilizer; an emulsifier; a preservative; and/or an adjuvant.
  • Such compositions may contain an effective amount of the anti-DKKl antibody or immunologically functional fragment thereof.
  • the use of the antibodies and immunologically active fragments that are provided herein in the preparation of a pharmaceutical composition or medicament is also included.
  • Such compositions can be used in the treatment of a variety of diseases such as listed below in the section on exemplary utilities.
  • compositions according to the invention may contain components for modifying, maintaining or preserving, for example, the pH, osmolarity, viscosity, clarity, color, isotonicity, odor, sterility, stability, rate of dissolution or release, adsorption or penetration of the composition.
  • Suitable materials for formulating pharmaceutical compositions include, but are not limited to, amino acids (such as glycine, glutamine, asparagine, arginine or lysine); antimicrobials; antioxidants (such as ascorbic acid, sodium sulfite or sodium hydrogen-sulfite); buffers (such as acetate, borate, bicarbonate, Tris- HC1, citrates, phosphates or other organic acids); bulking agents (such as mannitol or glycine); chelating agents (such as ethylenediamine tetraacetic acid (EDTA)); complexing agents (such as caffeine, polyvinylpyrrolidone, beta-cyclodextrin or hydroxypropyl-beta-cyclodextrin); fillers; monosaccharides; disaccharides; and other carbohydrates (such as glucose, mannose or dextrins); proteins (such as serum albumin, gelatin or immunoglobulins); coloring, flavoring and diluting agents;
  • solvents such as glycerin, propylene glycol or polyethylene glycol
  • sugar alcohols such as mannitol or sorbitol
  • suspending agents surfactants or wetting agents (such as pluronics, PEG, sorbitan esters, polysorbates such as polysorbate 20, polysorbate 80, triton, tromethamine, lecithin, cholesterol, tyloxapal)
  • stability enhancing agents such as sucrose or sorbitol
  • tonicity enhancing agents such as alkali metal halides, preferably sodium or potassium chloride, mannitol sorbitol
  • delivery vehicles diluents; excipients and/or pharmaceutical adjuvants, (see Remington's Pharmaceutical Sciences, 18th Edition, (A. R. Gennaro, ed.), 1990, Mack
  • the primary vehicle or carrier in a pharmaceutical composition may be either aqueous or non-aqueous in nature.
  • Suitable vehicles or carriers for such compositions include water for injection, physiological saline solution or artificial cerebrospinal fluid, possibly supplemented with other materials common in compositions for parenteral administration.
  • compositions comprising anti-DK l antibodies or immunologically functional fragments thereof may be prepared for storage by mixing the selected composition having the desired degree of purity with optional formulation agents in the form of a lyophilized cake or an aqueous solution. Further, the anti-DKKl antibodies or immunologically functional fragments thereof may be formulated as a lyophilizate using appropriate excipients such as sucrose.
  • Formulation components are present in concentrations that are acceptable to the site of administration. Buffers are advantageously used to maintain the composition at physiological pH or at a slightly lower pH, typically within a pH range of from about 4.0 to about 8.5, or alternatively, between about 5.0 to 8.0.
  • Pharmaceutical compositions can comprise TRIS buffer of about pH 6.5-8.5, or acetate buffer of about pH 4.0-5.5, which may further include sorbitol or a suitable substitute therefor.
  • a pharmaceutical composition may involve an effective quantity of anti-DKKl antibodies or immunologically functional fragments thereof in a mixture with non-toxic excipients that are suitable for the manufacture of tablets.
  • excipients include, but are not limited to, inert materials, such as calcium carbonate, sodium carbonate or bicarbonate, lactose, or calcium phosphate; or binding agents, such as starch, gelatin, or acacia; or lubricating agents such as magnesium stearate, stearic acid, or talc.
  • Additional pharmaceutical compositions are in the form of sustained- or controlled-delivery formulations.
  • Techniques for formulating a variety of other sustained- or controlled-delivery means such as liposome carriers, bio-erodible microparticles or porous beads and depot injections can be used (see, for e.g., PCT/US93/00829, which describes the controlled release of porous polymeric microparticles for the delivery of pharmaceutical compositions).
  • Sustained-release preparations may include semipermeable polymer matrices in the form of shaped articles, e.g. films, or microcapsules, polyesters, hydrogels, polylactides (U.S. Pat. No.
  • compositions may also include liposomes, which can be prepared by any of several methods known in the art.
  • the pharmaceutical composition to be used for in vivo administration typically is sterile. Sterilization may be accomplished by filtration through sterile filtration membranes. If the composition is lyophilized, sterilization may be conducted either prior to or following lyophilization and reconstitution. The composition for parenteral administration may be stored in lyophilized form or in a solution.
  • parenteral compositions are placed into a container having a sterile access port, for example, an intravenous solution bag or vial having a stopper pierceable by a hypodermic injection needle, or a sterile pre-filled syringe ready to use for injection.
  • a sterile access port for example, an intravenous solution bag or vial having a stopper pierceable by a hypodermic injection needle, or a sterile pre-filled syringe ready to use for injection.
  • composition of the invention may be stored in sterile vials as a solution, suspension, gel, emulsion, solid, or as a dehydrated or lyophilized powder.
  • Such formulations may be stored either in a ready-to-use form or in a form (e.g., lyophilized) that is reconstituted prior to administration.
  • compositions intended for in vivo use are usually sterile. To the extent that a given compound must be synthesized prior to use, the resulting product is typically substantially free of any potentially toxic agents, particularly any endotoxins, which may be present during the synthesis or purification process.
  • compositions for parental administration are also sterile, substantially isotonic and made under GMP conditions.
  • kits for producing a multi-dose or single-dose administration units may each contain both a first container having a dried protein and a second container having an aqueous diluent, including for example single and multi-chambered pre-filled syringes (e.g., liquid syringes, lyosyringes or needle-free syringes).
  • syringes e.g., liquid syringes, lyosyringes or needle-free syringes.
  • compositions of the invention can be delivered parenterally, typically by injection.
  • Injections can be intraocular, intraperitoneal, intraportal, intramuscular, intravenous, intrathecal, intracerebral (intra-parenchymal), intracerebroventricular, intraarterial, intralesional, perilesional or subcutaneous.
  • Eye drops can be used for intraocular administration.
  • injections may be localized to the vicinity of a particular bone or bones to which the treatment is targeted.
  • the antibodies may be parenteral administration.
  • a pyrogen-free, parenterally acceptable aqueous solution comprising the desired anti-DK l antibodies or immunologically functional fragments thereof in a pharmaceutically acceptable vehicle.
  • a particularly suitable vehicle for parenteral injection is sterile distilled water in which the anti-DKKl antibodies or immunologically functional fragments thereof are formulated as a sterile, isotonic solution, properly preserved.
  • compositions comprising the subject anti-DKKl antibodies and functional fragments thereof may be administered by bolus injection or continuously by infusion, by implantation device, sustained release systems or other means for accomplishing prolonged release.
  • the pharmaceutical composition also can be administered locally via implantation of a membrane, sponge or another appropriate material onto which the desired molecule has been absorbed or encapsulated. Where an implantation device is used, the device may be implanted into any suitable tissue or organ, and delivery of the desired molecule may be via diffusion, timed-release bolus, or continuous release.
  • the preparation may be formulated with agent, such as injectable microspheres, bio-erodible particles, polymeric compounds (such as polylactic acid; polyglycolic acid; or copoly (lactic/gly colic) acid (PLGA), beads or liposomes, that can provide controlled or sustained release of the product which may then be delivered via a depot injection.
  • agent such as injectable microspheres, bio-erodible particles, polymeric compounds (such as polylactic acid; polyglycolic acid; or copoly (lactic/gly colic) acid (PLGA), beads or liposomes, that can provide controlled or sustained release of the product which may then be delivered via a depot injection.
  • agent such as injectable microspheres, bio-erodible particles, polymeric compounds (such as polylactic acid; polyglycolic acid; or copoly (lactic/gly colic) acid (PLGA), beads or liposomes, that can provide controlled or sustained release of the product which may then be delivered via a depot injection.
  • compositions comprising an anti-DKKl antibody or functional fragment thereof may be formulated for inhalation.
  • an anti-DKKl antibody is formulated as a dry powder for inhalation, or anti-DKKl antibody inhalation solutions may also be formulated with a propellant for aerosol delivery, such as by nebulization.
  • Pulmonary administration is further described in PCT/US94/001875, which describes pulmonary delivery of chemically modified proteins, and which is hereby incorporated by reference.
  • compositions of the invention can be delivered through the digestive tract, such as orally.
  • the subject anti-DKKl antibodies or immunologically functional fragments thereof that are administered in this fashion may be formulated with or without those carriers customarily used in the compounding of solid dosage forms such as tablets and capsules.
  • a capsule may be designed to release the active portion of the formulation at the point in the gastrointestinal tract when bioavailability is maximized and pre-systemic degradation is minimized.
  • Additional agents can be included to facilitate absorption of the anti-DKKl antibody or functional fragment thereof.
  • modified amino acids may be used to confer resistance to digestive enzymes.
  • compositions comprising anti-DKKl antibodies or immunologically functional fragments thereof also may be used ex vivo. In such instances, cells, tissues or organs that have been removed from the patient are exposed to or cultured with the anti-DKKl antibody. The cultured cells may then be implanted back into the patient or a different patient or used for other purposes.
  • anti-DKKl antibodies or immunologically functional fragments thereof can be delivered by implanting certain cells that have been genetically engineered, using methods such as those described herein, to express and secrete the polypeptide.
  • Such cells may be animal or human cells, and may be autologous, heterologous, or xenogenic, or may be immortalized.
  • the cells may be encapsulated to avoid infiltration of surrounding tissues. Encapsulation materials are typically biocompatible, semi-permeable polymeric enclosures or membranes that allow the release of the protein product(s) but prevent the destruction of the cells by the patient's immune system or by other detrimental factors from the surrounding tissues.
  • compositions that are provided can be administered for prophylactic and/or therapeutic treatments.
  • An “effective amount” refers generally to an amount that is a sufficient, but non-toxic, amount of the active ingredient (i.e., an anti-DKKl antibody or immunologically functional fragment thereof) to achieve the desired effect, which is a reduction or elimination in the severity and/or frequency of symptoms and/or improvement or remediation of damage.
  • a “therapeutically effective amount” refers to an amount that is sufficient to remedy a disease state or symptoms, or otherwise prevent, hinder, retard or reverse the progression of a disease or any other undesirable symptom.
  • a “prophylactically effective amount” refers to an amount that is effective to prevent , hinder or retard the onset of a disease state or symptom.
  • toxicity and therapeutic efficacy of the antibody or fragment can be determined according to standard pharmaceutical procedures in cell cultures and/or experimental animals, including, for example, determining the LD50 (the dose lethal to 50% of the population) and the ED50 (the dose therapeutically effective in 50% of the population).
  • the dose ratio between toxic and therapeutic effects is the therapeutic index and it can be expressed as the ratio
  • compositions that exhibit large therapeutic indices are preferred.
  • the data obtained from cell culture and/or animal studies can be used in formulating a range of dosages for humans.
  • the dosage of the active ingredient typically lines within a range of circulating concentrations that include the ED50 with little or no toxicity.
  • the dosage can vary within this range depending upon the dosage form employed and the route of administration utilized.
  • the effective amount of a pharmaceutical composition comprising anti-DKKl antibodies or immunologically functional fragments thereof to be employed therapeutically or prophylactically will depend, for example, upon the therapeutic context and objectives.
  • One skilled in the art will appreciate that the appropriate dosage levels for treatment, according to certain embodiments, will thus vary depending, in part, upon the molecule delivered, the indication for which the anti-DKKl antibody is being used, the route of administration, and the size (body weight, body surface or organ size) and/or condition (the age and general health) of the patient.
  • a clinician may titer the dosage and modify the route of administration to obtain the optimal therapeutic effect.
  • Typical dosages range from about 0.1 ⁇ g/kg to up to about 100 mg/kg or more, depending on the factors mentioned above.
  • the dosage may range from 0.1 ⁇ g/kg up to about 150 mg/kg; or 1 ⁇ g/kg up to about 100 mg/kg; or 5 ⁇ g/kg up to about 50 mg/kg.
  • the dosing frequency will depend upon the pharmacokinetic parameters of the anti-DKKl antibody or immunologically functional fragment thereof in the formulation. For example, a clinician will administer the composition until a dosage is reached that achieves the desired effect.
  • the composition may therefore be administered as a single dose, or as two or more doses (which may or may not contain the same amount of the desired molecule) over time, or as a continuous infusion via an implantation device or catheter. Treatment may be continuous over time or intermittent. Further refinement of the appropriate dosage is routinely made by those of ordinary skill in the art and is within the ambit of tasks routinely performed by them.
  • Appropriate dosages may be ascertained through use of appropriate dose-response data.
  • a composition comprising the subject anti-DKKl antibodies or immunologically functional fragments thereof may be administered to the patient in an amount and for a time sufficient to induce a sustained improvement in at least one indicator that reflects the severity of the disorder.
  • An improvement is considered “sustained” if the patient exhibits the improvement on at least two occasions separated by at least one to seven days, or in some instances one to six weeks.
  • the appropriate interval will depend to some extent on what disease condition is being treated; it is within the purview of the skilled physician to determine the appropriate interval for determining whether the improvement is sustained.
  • the degree of improvement is determined based on signs or symptoms, and may also employ questionnaires that are administered to the patient, such as quality-of-life questionnaires.
  • Various indicators that reflect the extent of the patient's illness may be assessed for determining whether the amount and time of the treatment is sufficient.
  • the baseline value for the chosen indicator or indicators is established by examination of the patient prior to
  • the baseline examination is done within about 60 days of administering the first dose. If the antibody is being administered to treat acute symptoms, such as for example to treat a broken bone, the first dose is administered as soon as practically possible after the injury has occurred.
  • Improvement is induced by administering the subject anti-DK l antibodies or immunologically functional fragments thereof until the patient manifests an improvement over baseline for the chosen indicator or indicators.
  • this degree of improvement is obtained by repeatedly administering this medicament over a period of at least a month or more, e.g., for one, two, or three months or longer, or indefinitely.
  • a period of one to six weeks, or even a single dose often is sufficient for treating acute conditions. For injuries or acute conditions, a single dose may be sufficient.
  • treatment may be continued indefinitely at the same level or at a reduced dose or frequency. Once treatment has been reduced or discontinued, it later may be resumed at the original level if symptoms should reappear.
  • the subject anti-DKKl antibodies and immunologically functional fragments thereof can be used to detect DKKl in biological samples. Such uses allow the identification of cells or tissues that produce the protein or serve as a diagnostic for detecting pathological conditions in which DKKl is overproduced or underproduced.
  • the antibodies and fragments that are provided can also be used in methods to screen for a molecule that binds to DKKl . A variety of competitive screening methods, for example, can be used. In some methods, a DKKl molecule or fragment thereof to which an anti-DKKl antibody binds, is contacted with an antibody or fragment disclosed herein together with another molecule (i.e., a candidate molecule).
  • a reduction in binding between the antibody or fragment and DKKl is an indication that the molecule binds DKKl .
  • Binding of the antibody or fragment can be detected using a variety of methods, e.g., an ELISA. Detection of binding between the anti-DKKl antibody or fragment to DKKl can be simplified by detectably labeling the antibody.
  • a molecule that exhibits binding in the initial screen is further analyzed to determine whether it inhibits a DK 1 activity (e.g., whether the molecule activates Wnt signaling).
  • Activity of a DKK1 inhibitor or a sclerostin inhibitor or combinations may be measured in a variety of ways. Binding agent-mediated increases in bone mineral content or bone density may be measured using single- and dual- energy X-ray absorptometry, ultrasound, computed tomography, radiography, and magnetic resonance imaging. The amount of bone mass may also be calculated from body weights or by using other methods (see Guinness-Hey, Metab. Bone Dis. Relat. Res., 5: 177-181 (1984)).
  • compositions and methods on, for example, parameters of bone loss, bone resorption, bone formation, bone strength, or bone mineralization that mimic conditions of human disease such as osteoporosis and osteopenia.
  • models include the ovariectomized rat model (Kalu, Bone and Mineral, 15: 175-192 (1991); Frost and Jee, Bone and Mineral, 18:227-236 (1992); and Jee and Yao, J. Musculoskel. Neuron. Interact., 1 : 193-207 (2001)).
  • the methods for measuring binding agent activity described herein also may be used to determine the efficacy of other inhibitors.
  • bone mineral density can be determined clinically using dual x-ray absorptiometry (DXA) of, for example, the hip and spine.
  • DXA dual x-ray absorptiometry
  • Other techniques include quantitative computed tomography (QCT), ultrasonography, single-energy x-ray absorptiometry (SXA), and radiographic absorptiometry.
  • QCT quantitative computed tomography
  • SXA single-energy x-ray absorptiometry
  • radiographic absorptiometry Common central skeletal sites for measurement include the spine and hip; peripheral sites include the forearm, finger, wrist and heel.
  • BMD techniques typically involve the use of x-rays and are based on the principle that attenuation of the radiation depends on thickness and composition of the tissues in the radiation path. All techniques involve the comparison of results to a normative database.
  • a physiological response to one or more binding agents can be gauged by monitoring bone marker levels.
  • Bone markers are products created during the bone remodeling process and are released by bone, osteoblasts, and/or osteoclasts. Fluctuations in bone resorption and/or bone formation "marker" levels imply changes in bone
  • the International Osteoporosis Foundation recommends using bone markers to monitor bone density therapies (see, e.g., Delmas et al, Osteoporos Int., Suppl. 6:S2-
  • Markers indicative of bone resorption (or osteoclast activity) include, for example, C-telopeptide (e.g., C-terminal telopeptide of type 1 collagen (CTX) or serum cross-linked C-telopeptide), N-telopeptide (N-terminal telopeptide of type 1 collagen (NTX)), deoxypyridinoline (DPD), pyridinoline, urinary hydroxyproline, galactosyl hydroxy lysine, and tartrate-resistant acid phosphatase (e.g., serum tartrate-resistant acid phosphatase isoform 5b).
  • C-telopeptide e.g., C-terminal telopeptide of type 1 collagen (CTX) or serum cross-linked C-telopeptide
  • N-telopeptide N-terminal telopeptide of type 1 collagen (NTX)
  • DPD deoxypyridinoline
  • pyridinoline pyridinoline
  • Bone formation/mineralization markers include, but are not limited to, bone-specific alkaline phosphatase (BSAP), peptides released from N- and C-terminal extension of type I procollagen (P1NP, PICP), and osteocalcin (OstCa).
  • BSAP bone-specific alkaline phosphatase
  • P1NP peptides released from N- and C-terminal extension of type I procollagen
  • PICP type I procollagen
  • osteocalcin osteocalcin
  • a therapeutic agent preferably reduces the level of one or more markers of bone resorption, such as the serum level of C-telopeptide of type I collagen (CTX).
  • CTX C-telopeptide of type I collagen
  • the invention further provides a method of monitoring therapy, i.e., the physiological response to a sclerostin binding agent or other sclerostin inhibitor.
  • the method comprises administering a therapeutic, then measuring the level of one or more markers of bone resorption.
  • the method can comprise measuring the level of one or more markers of bone formation before administration.
  • the level of bone resorption marker during and/or after treatment may be compared to a pre-treatment level, or alternatively may be compared to a standard range typical of that patient population.
  • the level of bone resorption marker can be reduced by at least about 5% (e.g., about 10%, about 20%, or about 30%)) by a single dose of therapeutic.
  • the dose of therapeutic reduces the level of bone resorption marker at least about 40%> (e.g., about 50%>, about 60%>, or about 70%>) compared to the level of the bone resorption marker prior to administering.
  • the bone resorption marker level may be reduced for at least about 3 days (e.g., about 7 days, about 2 weeks, about 3 weeks, about 1 month, about 5 weeks, about 6 weeks, about 7 weeks, about 2 months, about 9 weeks, about 10 weeks, about 11 weeks, or about 3 months) after administration of a single dose.
  • 3 days e.g., about 7 days, about 2 weeks, about 3 weeks, about 1 month, about 5 weeks, about 6 weeks, about 7 weeks, about 2 months, about 9 weeks, about 10 weeks, about 11 weeks, or about 3 months
  • the amount of therapeutic administered to a patient also can increase the level of one or more markers of bone formation, such as the serum level of BSAP, the serum level of P1NP, and/or the serum level of
  • a single dose of therapeutic can increase the level of a bone formation marker by, for example, at least about 5% (e.g., about 10%>, about 20%>, or about 30%>). In some embodiments, the dose of therapeutic elevates the level of a bone formation marker at least about 40% (e.g., about 50%, about 60%>, or about 70%>). In other embodiments, the dose of therapeutic increases the level of one or more bone formation markers by at least about 75% (e.g., about 80%, about 90%), about 100%), or about 110%). In yet other embodiments, the dose of therapeutic increases the level of a bone formation marker by at least about 120% (e.g., about 130%, about 140%, about 150%, about 160% or about 170%).
  • the therapeutic increases the level of bone formation marker by least about 180% (e.g., about 190% or about 200%).
  • Bone formation marker levels ideally remain elevated (compared to bone formation marker levels pre- treatment or to a standard range typical of that patient population) for at least about 3 days (e.g., about 7 days, about 2 weeks, about 3 weeks, about 1 month, about 5 weeks, about 6 weeks, about 7 weeks, about 2 months, about 9 weeks, about 10 weeks, about 11 weeks, or about 3 months) after administration of a single dose of the therapeutic.
  • BMD is can be measured "total body” (e.g., head, trunk, arms, and legs) or at the hip (e.g., total hip and/or femoral neck), spine (e.g., lumbar spine), wrist, finger, shin bone and/or heel.
  • hip e.g., total hip and/or femoral neck
  • spine e.g., lumbar spine
  • wrist finger, shin bone and/or heel.
  • T-score a patient's BMD is compared to the peak density of a 30-year old healthy adult (i.e., a "young adult"), creating the so-called "T-score.”
  • a patient's BMD also may be compared to an "age-matched" bone density (see, e.g., World Health
  • a BMD value within 1 standard deviation of the young adult reference mean (T-score ⁇ -l) is "normal.” Low bone mass (osteopenia) is indicated by a BMD value more than 1 standard deviation below the young adult mean, but less than 2 standard deviations (T-score ⁇ -l and>-2.5).
  • T-score of more than 2.5 standard deviations below the norm supports a diagnosis of osteoporosis. If a patient additionally suffers from one or more fragility fractures, the patient qualifies as having severe osteoporosis.
  • the therapeutic may be administered to a patient to improve bone mineral density regardless of the patient's T-score.
  • the therapeutic may be administered at a dose and for a time period effective to increase BMD in the patient by at least about 1% (about 2%, about 3%, about
  • BMD is increased by at least about 8% (e.g., at least about 10%, about 12%, about 15%, or about 18%). In other embodiments, BMD is increased by the therapeutic at least about 20% (e.g., at least about 22%, about 25%, or about 28%)) at the hip, spine, wrist, finger, shin bone, and/or heel. In yet other embodiments, BMD is increased at least about 30%> (e.g., at least about 32%, about 35%, about 38%, or about 40%). In other words, the BMD can be increased to the range of about 1 to about 2.5 standard deviations (preferably a range of about 0 to about 1 standard deviations) below the normal BMD of a healthy young adult.
  • Bone is one of the principal regulators of calcium levels in the bloodstream. Osteoclast-mediated bone resorption releases stored calcium into the systemic circulation, while osteoblast-mediated bone formation removes calcium from circulation to incorporate into bone tissue. In normal bone modeling/remodeling, these processes cycle to maintain healthy, strong bone and maintain free calcium levels at about 8.5 mg/dL to about 10.5 mg/dL (e.g., about 2.2 mmol/L to about 2.6 mmol/L). Bone disorders, other illnesses, and even certain therapies can disrupt systemic calcium levels with dire consequences.
  • Hypercalcemia is associated with high levels of calcium in the blood (e.g., greater than 12 mg/dL or 3 mmol/L). Extraordinarily high calcium levels leads to, for example, fatigue, confusion, constipation, decreased appetite, frequent urination, heart problems, and bone pain. Hypocalcemia is an electrolyte imbalance indicated by an abnormally low level of calcium in the blood (e.g., less than about 9 mg/dL or 2.2 mmol/L). Calcium levels of ⁇ 7.5 mg/dL ( ⁇ 1.87 mmol/L) or less are considered severe hypocalcemia and may be accompanied by clinical symptoms.
  • the inventive methods are useful for treating or preventing bone -related disorders, such as bone -related disorders associated with abnormal osteoblast or osteoclast activity.
  • the therapeutics of the present invention can be administered to a human suffering from a bone related disorder selected from the group consisting of achondroplasia, cleidocranial dysostosis, enchondromatosis, fibrous dysplasia, Gaucher's Disease, hypophosphatemia, X-linked
  • hypophosphatemic rickets Marfan's syndrome, multiple hereditary exotoses, neurofibromatosis, osteogenesis imperfecta, osteopetrosis, osteopoikilosis, sclerotic lesions, pseudoarthrosis, pyogenic osteomyelitis, periodontal disease, anti-epileptic drug induced bone loss, primary and secondary hyperparathyroidism, familial hyperparathyroidism syndromes, weightlessness induced bone loss, osteoporosis in men, postmenopausal bone loss, spinal fusion, osteoarthritis, renal osteodystrophy, infiltrative disorders of bone, oral bone loss, osteonecrosis of the jaw, juvenile Paget's disease, melorheostosis, metabolic bone diseases, mastocytosis, sickle cell anemia/disease, organ transplant related bone loss, kidney transplant related bone loss, systemic lupus erythematosus, ankylosing spondylitis, epilepsy, juvenile arthritides, th
  • ischemic bone disease such as Legg-Calve-Perthes disease and regional migratory osteoporosis
  • anemic states conditions caused by steroids, glucocorticoid-induced bone loss, heparin-induced bone loss, bone marrow disorders, scurvy, malnutrition, calcium deficiency, osteoporosis, osteopenia, alcoholism, chronic liver disease, postmenopausal state, chronic inflammatory conditions, rheumatoid arthritis, inflammatory bowel disease, ulcerative colitis, inflammatory colitis, Crohn's disease, oligomenorrhea, amenorrhea, pregnancy, diabetes mellitus, hyperthyroidism, thyroid disorders, parathyroid disorders, Cushing's disease, acromegaly, hypogon
  • inventive methods need not cure the patient of the disorder or completely protect against the onset of a bone-related disorder to achieve a beneficial biological response.
  • the methods may be used prophylactically, meaning to protect, in whole or in part, against a bone-related disorder or symptom thereof.
  • the methods also may be used therapeutically to ameliorate, in whole or in part, a bone-related disorder or symptom thereof, or to protect, in whole or in part, against further progression of a bone-related disorder or symptom thereof.
  • the materials and methods of the invention are particularly useful for increasing bone mineral density and maintaining the increased BMD over a period of time.
  • the invention provides a method of treating a bone-related disorder, which method comprises (a) administering one or more amounts of a sclerostin binding agent effective to increase BMD measured for the total body (e.g., head, trunk, arms, and legs) or at the hip (e.g., total hip and/or femoral neck), spine (e.g., lumbar spine), wrist, finger, shin bone and/or heel by about 1%, about 2%, about 3%, about 6%, about 8%, about 10%, about 12%, about 15%, about 18%, about 20%, about 25%, or 30% or more.
  • a sclerostin binding agent effective to increase BMD measured for the total body (e.g., head, trunk, arms, and legs) or at the hip (e.g., total hip and/or femoral neck), spine (e.g., lumbar spine),
  • One or more administrations of a pharmaceutical composition comprising the sclerostin binding agent may be carried out over a therapeutic period of, for example, about 1 month to about 18 months (e.g., about 2 months, about 3 months, about 4 months, about 5 months, about 6 months, about 7 months, about 8 months, about 9 months, about 10 months, or about 11 months).
  • the method further includes (b) subsequently administering one or more amounts of a sclerostin binding agent effective to maintain bone mineral density.
  • step (a) maintain bone mineral density
  • step (b) e.g., a patient can require alternate treatment phases for increasing bone density and maintaining bone density.
  • DK 1 inhibitors as described herein, alone or in combination with another anabolic agent, e.g., a sclerostin inhibitor such as a neutralizing antibody, is beneficial to any condition requiring bone repair whether it is aggravated by an underlying bone loss condition or not.
  • a sclerostin inhibitor such as a neutralizing antibody
  • fracture repair such as delayed healing or nonunion healing.
  • certain indications described herein may or may not be exacerbated by bone loss associated with, for example, osteoporosis, or any other bone loss condition described herein.
  • compositions of the present invention are useful for improving outcomes in orthopedic procedures, periodontal diseases, oral bone loss, dental procedures, dental implants, implant surgery, joint replacement, bone grafting, bone cosmetic surgery and bone repair such as fracture healing, spinal fusion, implant fixation (e.g., joint replacement such as hip or knew), non-union healing, delayed union healing and facial reconstruction.
  • One or more compositions may be administered before, during and/or after the procedure, replacement, graft, surgery or repair.
  • the use of the foregoing therapeutic modalities including antibodies or immunologically functional fragments in the treatment of a variety of diseases is disclosed.
  • Certain methods involve administering to a patient in need thereof an effective amount of an antibody or immunologically active fragment as described herein to treat arthritis, diseases responsive to stem cell renewal, inflammatory diseases, neurological diseases, ocular diseases, renal diseases, pulmonary diseases, and skin diseases.
  • Some treatment methods involve treating rheumatoid arthritis, psoriatic arthritis or osteoarthritis.
  • Certain antibodies and fragments are used to treat a disease that: (a) is responsive to stem cell renewal and is selected from the group consisting of diabetes, chronic heart failure and diseases of the muscle; (b) is an inflammatory disease selected from the group consisting of Crohn's disease, colitis, and inflammatory bowel disease; (c) is a neurological disease selected from the group consisting of Alzheimer's disease, Parkinson's disease, and Huntington's disease; (d) is an ocular disease selected from the group consisting of macular degeneration and retinopathies; (e) is a renal disease selected from the group consisting of end stage renal disease, chronic renal disease, glomerulonephritis, tubulointerstitial nephritis, and IgA nephropathy; (f) is a pulmonary disease selected from the group consisting of chronic obstructive pulmonary disease, idiopathic pulmonary fibrosis, and cystic fibrosis; or (g) is a skin disease resulting from chemotherapy- induced damage to
  • Sclerostin inhibitors e.g., sclerostin binding agents
  • sclerostin binding agents have been shown to promote bone formation and inhibit (or slow) bone resorption with minimal fluctuations in systemic calcium levels (e.g., calcium levels fluctuate 10% or less from baseline serum calcium levels).
  • systemic calcium levels e.g., calcium levels fluctuate 10% or less from baseline serum calcium levels.
  • Hypercalcemia and hypocalcemia can result from, for example, chronic kidney disease, renal diseases, renal failure, primary or secondary hyperparathyroidism, pseudohyperparathyroidism,
  • hypoparathyroidism pseudohypoparathyroidism
  • magnesium depletion alcoholism
  • bisphosphonate therapy severe hypermagnesemia, vitamin D deficiency, hyperphosphatemia, acute pancreatitis, hungry bone syndrome, chelation, osteoblastic metastases, sepsis, surgery, chemotherapy, neoplasia syndrome, familial hypocalciuric hypercalcemia, sarcoidosis, tuberculosis, berylliosis, histoplasmosis, Candidiasis, Coccidioidomycosis, histiocytosis X, Hodgkin's or Non-Hodgkin's lymphoma, Crohn's disease, Wegener's granulomatosis, leukemia, pneumonia, silicone-induced granulomas, immobilization, or drug therapy, such as
  • thiazide diuretics lithium, estrogens, fluorides, glucose, and insulin.
  • serum calcium fluctuations are a side effect of many existing bone-related therapies, such as bisphosphonate and parathyroid hormone therapy. Because of the potentially life- threatening consequences of calcium imbalance, patients susceptible to hypocalcemia or hypercalcemia may need to forego certain therapy options.
  • the amount of sclerostin binding agent administered to a human in the context of this aspect of the invention is an amount that does not result in hypocalcemia or hypercalcemia (e.g., clinically-significant hypocalcemia or hypercalcemia).
  • the invention provides a method of treating a bone-related disorder in a human suffering from or at risk of hypocalcemia or hypercalcemia or a human in which treatment with bisphosphonate, a parathyroid hormone, or parathyroid hormone analog is contraindicated.
  • the method comprises administering to the human an amount of a sclerostin binding agent effective to increase the level of a marker of bone formation, such as serum levels of BSAP, P1NP, and/or OstCa and/or reduce the level of a marker of bone resorption, such as CTX.
  • a marker of bone formation such as serum levels of BSAP, P1NP, and/or OstCa
  • CTX reduce the level of a marker of bone resorption
  • immunologically functional fragment thereof as described herein (e.g., an antibody or immunologically functional fragment that comprises at least one light chain CDR selected from the group consisting of SEQ ID NOs: 97 to 227 and 228.
  • the patient is one who suffers from cancer that metastasizes to bone, and in another aspect, the patient is one who suffers from multiple myeloma.
  • compositions alone or in combination with one or more other therapeutics, can be useful for the formulation of a medicament.
  • Antibodies of the present invention are suitable for treatment of bone related disorders. The antibody depicted in SEQ ID NO: 1
  • compositions of the present invention include dysplasias, wherein growth or development of bone is abnormal.
  • Representative examples of such conditions include achondroplasia, cleidocranial dysostosis, enchondromatosis, fibrous dysplasia, Gaucher' s Disease, Marfan' s syndrome, multiple hereditary exotoses, neurofibromatosis, osteogenesis imperfecta, osteopetrosis, osteopoikilosis, sclerotic lesions, pseudoarthrosis, and pyogenic osteomyelitis.
  • Other conditions that may be treated or prevented include a wide variety of causes of osteopenia, osteoporosis and bone loss.
  • Representative examples of such conditions include periodontal disease, anti-epileptic drug induced bone loss, primary and secondary hyperparathyroidism, familial hyperparathyroidism syndromes, weightlessness induced bone loss, osteoporosis in men, postmenopausal bone loss, osteoarthritis, renal osteodystrophy, infiltrative disorders of bone, oral bone loss, osteonecrosis of the jaw, juvenile Paget's disease, melorheostosis, metabolic bone diseases, mastocytosis, sickle cell disease, ischemic bone disease (such as Legg-Calve-Perthes disease, regional migratory osteoporosis), anemic states, conditions caused by steroids, glucocorticoid-induced bone loss, heparin-induced bone loss, bone marrow disorders, scurvy, malnutrition, calcium deficiency, idi
  • the epitope tagged versions of human DKKl were cloned into an expression vector for expression in CHO cells.
  • Human DKKl variants containing either the FLAG or Fc epitopes were purified from conditioned medium for use as an antigen to generate anti-huDKKl antibodies.
  • Epitope-tagged huDKKl was purified from concentrated conditioned media (CM). Other protein production and purification procedures known to those skilled in the art may also be used.
  • Recombinant FL AG-tagged human DKK 1 FLAG-DKK 1
  • DKKl-fc recombinant Fc- tagged human DKKl
  • Monoclonal antibodies against DKKl were developed by sequentially immunizing XenoMouse ® mice (Abgenix, Inc. Fremont, CA) (see, e.g., United States Patent No. 7,435,871 and the description therein).
  • XenoMouse animals were immunized via footpad route for all injections.
  • Anti-DKK antibody titers in the serum from immunized XenoMouse mice were determined by ELISA.
  • Lymph nodes were harvested and pooled from each cohort. The total effluent was collected as the CD90-negative fraction (most of these cells were expected to be B cells). The fusion was performed by mixing washed enriched B cells from above and nonsecretory myeloma P3X63Ag8.653 cells purchased from ATCC, catalogue CRL 1580 (Kearney et al, J. Immunol. 123, 1979, 1548-1550) at a ratio of 1 :1. Electro-cell fusion (ECF) was performed using a fusion generator, model ECM2001, Genetronic, Inc., San Diego, CA. The fusion chamber size used was 2.0 mL
  • Hybridoma Culture Medium (DMEM (JRH Biosciences)). The cells were incubated and then centrifuged. The cells were resuspended in a small volume of Hybridoma Selection Medium (Hybridoma Culture Medium supplemented with 0.5x HA (Sigma, catalogue A9666)), and the volume was adjusted appropriately with more Hybridoma Selection Medium. The cells were mixed gently and pipetted into 96-well plates and allowed to grow.
  • hybridoma supernatants were screened for DK 1 -specific monoclonal antibodies.
  • the ELISA plates were coated with 50 ⁇ of Flag tagged rhDKKl (2 ⁇ g/mL) then incubated at 4°C overnight. After incubation, the plates were washed with Washing Buffer three times and then 200 ⁇ Blocking Buffer were added and the plates were incubated at room temperature. After incubation, the plates were washed with Washing Buffer three times. Aliquots (50 ⁇ ) of hybridoma supernatants and positive and negative controls were added, and the plates incubated at room temperature for 2 h.
  • ELISA one set for hlgG detection, one set for human Ig kappa light chain detection and the other set for human lambda light chain detection in order to demonstrate fully human composition for both IgG and Ig kappa or IgG and Ig lambda or IgG and Ig kappa plus lambda.
  • the three sets of antigen coated ELISA procedures were identical to the descriptions above except the three different detection antibodies were used separately. Final selection was based on a positive signal on antigen and a negative signal on irrelevant antigen.
  • Hybridomas secreting antibodies deemed to be of functional interest were single- cell cloned by limiting dilution. Screening of single-cell cloned hybridomas for DK 1 antibody was performed by ELISA as described above. Hybridoma clones were cultured in Hybridoma Culture Medium and expanded using standard tissue culture techniques to produce exhausted culture supernatant containing secreted monoclonal antibody. Freezer stocks of hybridoma clones were also generated.
  • the culture medium was removed from each well and the complex in growth medium was added to the well.
  • the growth medium in the wells was removed three hours later and replaced with conditioned medium containing Wnt3a, recombinant human DKKl and anti-DKKl hybridoma conditioned medium.
  • the stromal cell line ST2 derived from mouse bone marrow, was used as an additional screen for isolating anti-DKKl antibodies with neutralizing activity.
  • ST2 cells differentiate into osteoblasts which express the osteoblast marker protein alkaline phosphatase (ALP).
  • ALP osteoblast marker protein alkaline phosphatase
  • the induction of ALP by Wnt3a in these cells can be blocked by adding the Wnt inhibitor DKKl to the culture medium.
  • ALP expression can be restored under these conditions by exposing the cells to an agent capable of neutralizing DKKl activity, such as a neutralizing anti-DKKl antibody.
  • DKKl in the ELISA assays and 25 were positive in one or both of the neutralization assays (TCR/lef reporter assay or ST2 cell assay).
  • the hybridomas exhibiting the best activity from each of the three campaigns are shown in table 3.
  • Total RNA was prepared from anti-DK l hybridoma cell lines. DNA sequences were provided by Abgenix or obtained by sequencing of cloned RACE (rapid amplification of cDNA ends) PCR (polymerase chain reaction) products.
  • the anti DKKl cell lines were created by transfecting CHO host cells with the expression plasmids pDC323-anti DKKl kappa and pDC324 [anti-DKKl-IgG2] for 2.40.3, 6.35.5, 6.116.6 HC-IgG2 and LC-kappa using a standard electroporation procedure. After transfection of the host cell line with the expression plasmids the cells were grown in -GHT selection medium containing 4% dialysed fetal bovine serum (ds or dfFBS) for 2-3 weeks to allow for selection of the plasmid and recovery of the cells.
  • ds or dfFBS dialysed fetal bovine serum
  • Serum was then removed from the medium and the cells were grown in GHT selective medium until they achieved > 85% viability.
  • This pool of transfected cells was then cultured in medium containing [150-300] nM MTX followed by medium containing 500-1000nM MTX to select for high expressing cells.
  • Anti-huDKKl - 1 antibody expressing cell lines were expanded using aseptic cell culture techniques. Cells were inoculated into a bioreactor upon expansion and the culture fed as needed. At harvest, cells were centrifuged and conditioned media filtered. Human anti-huDKKl antibodies were purified from conditioned medium on Protein A sepharose. Purified DKKl antibody was buffer exchanged to the buffer of choice.
  • Liquid volumes used in this example were those typically used in 96-well plate ELISAs (e.g. 50-200 ul/well).
  • Ab-X and Ab-Y, in this example were assumed to have molecular weights of about 145 Kd and to have 2 DKKl binding sites per antibody molecule.
  • An anti- DKKl antibody (Ab-X) was coated (e.g. 50 ul of 1 ug/ml) onto a 96-well ELISA plate for at least one hour. After this coating step the antibody solution was removed, the plate washed with wash solution and was then blocked using an appropriate blocking solution and procedures known in the art.
  • Blocking solution was removed from the ELISA plate and a second anti-DKKl antibody (Ab-Y), which was being tested for its ability to cross-block the coated antibody, was added in excess (e.g. 50 ul of 10 ug/ml) in blocking solution to the appropriate wells of the ELISA plate.
  • Ab-Y anti-DKKl antibody
  • a limited amount e.g. 50 ul of 10 ng/ml
  • huDKKl in blocking solution was then added to the appropriate wells and the plate was incubated for at least one hour at room temperature while shaking and the plate was then washed.
  • An appropriate amount of a DKKl detection reagent in blocking solution was added to the ELISA plate and incubated for at least one hour at room temperature.
  • the plate was then washed with wash solution and developed with an appropriate reagent.
  • the background signal for the assay was defined as the signal obtained in wells with the coated antibody (in this case Ab-X), second solution phase antibody (in this case Ab-Y), DKKl buffer only (i.e. no DKKl) and DKKl detection reagents.
  • the positive control signal for the assay was defined as the signal obtained in wells with the coated antibody (in this case Ab-X), second solution phase antibody buffer only (i.e. no second solution phase antibody), DKKl and DKKl detection reagents.
  • the ELISA assay needs to be run in such a manner so as to have the positive control signal be at least 6 times the background signal.
  • Ab-X and Ab-Y are defined as cross-blocking if, either in format 1 or in format 2, the solution phase anti-DKKl antibody was able to cause a reduction of between 60% and 100%, specifically between 70%> and 100%, and more specifically between 80%> and 100%, of the DKKl detection signal (i.e. the amount of DKKl bound by the coated antibody) as compared to the DKKl detection signal obtained in the absence of the solution phase anti-DKKl antibody (i.e. the positive control wells).
  • the term 'cross block' is not intended to encompass only complete blockage of binding of the test molecule, rather it can include a range of decreased binding less than 100% as described here.
  • Antibodies that are cross blocked from binding human DKKl by the binding of antibody depicted in SEQ ID NOs: 42 and 44 include those that have 60% reduction in binding to human DKKl , 70% reduction in binding to human DKKl , 80% reduction in binding to human DKKl , 90% reduction in binding to human DKKl or 95% reduction in binding to human DKKl .
  • Antibodies that cross block binding of human DKKl by the binding of antibody depicted in SEQ ID NOs: 42 and 44 include those that reduce its binding by 60% in binding to human DKKl , 70% reduction in binding to human DKKl , 80% reduction in binding to human DKKl , 90% reduction in binding to human DKKl or 95% reduction in binding to human DKKl .
  • Antibodies that were capable of cross blocking one another are referred to herein as being in the same bin.
  • a tagged version of DKKl is used in the ELISA, such as a N- terminal His-tagged DKKl (R & D Systems, Minneapolis, MN, USA; 2005 catalog number 1406-ST-025)
  • an appropriate type of DKKl detection reagent would include an HRP labeled anti-His antibody.
  • N-terminal His-tagged DKKl one could also use C-terminal His-tagged DKKl .
  • various other tags and tag binding protein combinations that are known in the art could be used in this ELISA-based cross-blocking assay (e.g. HA tag with anti-HA antibodies; FLAG tag with anti-FLAG antibodies; biotin tag with streptavidin).
  • the human anti-huDK l neutralizing antibodies described herein recognize two distinct epitopes as evident by the inability of the antibodies to cross block one another.
  • the first epitope is referred to as 11H10 that has been described previously (United States Patent No. 7,709,611).
  • the second epitope is described below and is referred to as 5.25.1 (SEQ ID NOs: 42 and 44).
  • DKKl contains two disulfide-rich domains located near the N-terminus and at the end of the C-terminus, referred to here as the N- and C-terminal disulfide domains.
  • the N-terminal disulfide domain (hereinafter, "disulfide domain 1" or "Dl") contains 55 amino acids residues (amino acids 85-139 of SEQ ID NO:2) and has 10 cysteines forming 5
  • the C-terminal disulfide domain (hereinafter, "disulfide domain 2", or “D2") contains 75 amino acids (amino acids 189-263 of SEQ ID NO:2) and contains 10 cysteines that also form 5 intramolecular disulfide bridges. These two disulfide domains are separated by a stretch of about 50 amino acids.
  • Disulfide domain 2 (D2) of DKKl has been proposed to have a molecular structure similar to the canonical colipase fold, the crystal structure of which has been determined using porcine colipase (Aravind, A. and Koonin, E.V., Current Biology 8:R477-479 (1998)).
  • Intramolecular disulfide linkages among the 10 cysteine residues in the N-terminal Dl domain of DKK molecule have recently been determined.
  • the DKKl proteolytic digestion was carried out in the absence or presence of antibody 5.25.1 and then subjected to HPLC peptide mapping. A partial or complete reduction in the height of an HPLC peak and/or the detection of a newly generated peak in a sample exposed to antibody may be observed.
  • CNBr cleavage of hDKKl generated two large fragments. These were CNBrl and CNBr2, which represented, respectively, D2 and Dl disulfide domains.
  • CNBrl consisted of two peptides (amino acids 179-206 of SEQ ID NO:2 and amino acids 207-266 [or 274 if including the added C-terminal flag peptide] of SEQ ID NO:2) held together by 5 disulfide bonds.
  • CNBr2 similarly consisted of two peptides (amino acids 32-122 of SEQ ID NO:2 and amino acids 127-178 of SEQ ID NO:2), also held together by 5 disulfide bonds (Table 4).
  • Peptide is derived from trypsin digestion of HuDKKl in the presence of 5.25.1 antibody.
  • T2 and T3 are large peptide fragments consisted of five small peptides (3 to 13 amino acids in length) held together by the five disulfide bonds in Dl domain with amino acids 74-102, 103-115, 121-123, 124-134, 135-147 of SEQ ID:2 (Table 4).
  • Human DKK1 was also incubated with 5.25.1 at a molar ratio of 1 : 1 to 1 :3 in PBS buffer for 1 h at room temperature. Aliquot of the DKKl/antibody complex was then digested by trypsin under conditions as described above. HPLC peptide mapping profile of the tryptic digest is completely identical to that obtained from the DKKl digest in the absence of antibody 5.25.1, except that T2 and T3 peaks disappeared and a new peak T4 (retention time 41.3 minutes using 1 mm column or 44.3 minutes using 2.1 mm i.d. column) became detectable.
  • T4 is also the N- terminal domain Dl peptide, but only contains a single amino acid sequence with amino acids 74-147 of sequence ID NO:2 (Table 4). In Biacore binding assay, T4 binds to 5.25.1 and can compete for 5.25.1 binding with Sensorchip surface-bound DKKl .
  • AspN3 is a partial digestion product whose sequence contains both Domains Dl and D2 sequences. Two other peaks, AspN4 and AspN5, were also isolated and confirmed to be disulfide-linked peptides in domain D2, AspN4 or AspN5 does not compete with DK 1 for 5.25.1 binding.
  • Trypsin cleavage (R at position 102, and RKRRKR between positions 115 and 120 and K at position 134 in Figure 1) generates five peptides linked by disulfides. This Dl domain tryptic peptide fraction loses 5.25.1 binding activity.
  • Antibody 5.25.1 can bind to DK 1 to protect all cleavage sites on D 1 domain from trypsin proteolysis (R at position 99, and RKRRKR between positions 115 and 120 and K at position 134).
  • the obtained Dl tryptic fragment, recovered at a distinct retention time, is a single polypeptide chain, indicating that all Arg and Lys's in Dl are protected from proteolysis and therefore are closely located at the epitope region or involved in epitope binding. Binding activity is maintained in Dl fragments generated Asp N or CNBr cleavage.
  • the observed minimal fragment size for Dl domain is amino acids 78-141, except that Asp-N had clipped the peptide bond between Gly 105 and Asp at position 105, leaving this large disulfide loop (formed between Cys 97 and Cys 111) not being connected together.
  • CNBr cleavage for removal of amino acids 123-126 (sequence of ARG-HIS- ALA-MET) and AspN cleavage of Glyl 14-Aspl 15 peptide bond do not influence CNBr2 and AspNl (or AspN2) fragments from 5.25.1 binding, therefore, sequences in these region are not in the epitope.
  • a highly negatively charged region (amino acids 83-91) in Dl is resistant to GluC and AspN digestion in the absence of Ab, indicating that this region is not accessible for proteolysis (may be due to steric hindrance) and is also inaccessible to 5.25.1.
  • epitopes residing in HuDK l for 5.25.1 binding include discontinuous sequences at the N-terminal disulfide domain Dl : amino acids 98-104, 107-121, and 129-140 of SEQ ID NO:2. And the Dl domain disulfide bonds have to remain intact to retain a correct conformation or three-dimensional structure for 5.25.1 to bind.
  • One hundred pM, 300 pM, or 1000 pM of the antibody was mixed with various concentrations of human, mouse or cyno DKKl, ranging in concentration from 1 pM to 50 nM, and equilibrated at room temperature for 8 hours. The mixtures were then passed over the DKKl -coated beads. The amount of bead-bound anti-DKKl antibody was quantified using goat anti-human-IgG antibody labeled with a fluorescent tag (Cy5; Jackson Immuno Research, West Grove, PA). The amount of fluorescent signal measured was proportional to the concentration of free anti-DKKl antibody in each reaction mixture at equilibrium. The dissociation equilibrium constant (Kd) was obtained from nonlinear regression of the competition curves using a dual-curve one-site homogeneous binding model using the KinExA software. Results of the KinExA assays for the selected antibodies are shown in table 6.
  • FIG. 2 A rfiDKKl-flag was incubated with LRP6-His and 5 ⁇ g of one of the neutralizing DKKl antibodies from either the 11H10 bin (5.80.1, 6.37.5 or rl 1H10) or the 5.25.1 bin (5.25.1, 5.77.1). The mixture was immunoprecipitated with an anti-his antibody that would bind his-tagged LRP6 and pull down associated DKKl . The immunoprecipitated was then subjected to Western blotting analysis using an anti-flag antibody that recognized rfiDKKl .
  • mice In the first experiment four-week-old male BDF-1 mice (APR 233757, Charles River) were injected subcutaneously over a three-week period with one of three doses of the purified 2.40.2 monoclonal antibody (5, 10, or 20 mg/kg). Five mice were used per group.
  • Negative control mice were injected with vehicle (PBS), and positive control mice were injected with parathyroid hormone (amino acids 1-34), which is known to stimulate increased bone density in these mice (Dempster et al, Endocrine Reviews 14(6):690-709 (1993)).
  • PBS vehicle
  • PTH parathyroid hormone
  • the antibodies described herein have been used to detect DKKl levels in human samples, including but not limited to serum. To develop this type of assay it was important that two antibodies be selected that did not recognize the same epitope, such as the two distinct epitopes described herein. To assay for DKKl in human serum or other tissues a standard curve was first established using recombinant huDKKl . It was preferable that this standard curve was established in human serum lacking, or containing low levels, of huDKKl .
  • the range of the standard curve we use for serum is between 25 pg/ml and 10 ng/ml huDKKl, although this range may need to be adjusted depending upon the minimal and maximal values of huDKKl obtained in the samples being analyzed.
  • An example of the protocol used is as follows, but modifications obvious to those skilled in the art may be taken depending upon the specific antibodies and samples utilized.
  • the antibodies described herein can also be used to detect DKKl in serum isolated from animal models of disease.
  • the protocol as described above was used to detect DKKl levels in a rat chronic kidney disease (CKD) model.
  • An extract of diseased and controls kidneys were prepared and the level of rat DKKl protein was determined.
  • the data are shown in Figure 7 and demonstrate that DKKl protein levels are approximately five-fold elevated at 3 -weeks after induction of kidney damage with the pharmacological agent.
  • Sclerostin and DKKl are negative regulators of bone formation.
  • Inhibition of sclerostin by systemic treatment with a sclerostin monoclonal antibody (Scl-Ab) significantly increased bone formation, bone mass and bone strength in animal models of osteoporosis (Li XD, et al. J Bone Miner Res 2009; 24:578).
  • Treatment with Scl-Ab enhanced fracture healing in animal models of bone repair (Ke HZ, et al. Trans ORS 2009; 34:22; Ominsky M, et al. ASBMR abstract Sept 2009; Denver, CO).
  • neutralization of DKKl by systemic administration of the monoclonal antibody rl 1H10 (DKKl-Ab) increased bone mineral density
  • DKKl-Ab may have a synergetic effect on stimulating bone formation and increasing bone strength in fractured and non-fractured bone in an adult rat model.
  • SD Sprague-Dawley
  • rats mean body weight 580g
  • unilateral closed femoral mid-diaphyseal fracture as reported previously (Bonnarens F, et al. J Orthop Res 1984; 2: 97-101).
  • an 18 gauge syringe needle was inserted into the medullary canal through the femoral condyles, and served as an internal fixation.
  • the femur then underwent transverse fracture via blunt impact loading at the anterior (lateral) aspect of the thigh.
  • Bone mineral content (BMC, threshold of 800 mg/cc) of the central 1 mm of the fracture callus were assessed after subtraction of the original cortex as previously described (Taylor DK, et al. J Bone Miner Res 2009; 24: 1043-1054).
  • Callus bone volume as a percent of total volume (BV/TV) was quantified using a variable threshold (570 mg/cc for vehicle, Scl-Ab and DKKl-Ab; 615 mg/cc for Combination).
  • regions spanning 10% of the femur height at the midshaft (threshold 800 mg/cc) for cortical bone and distal femur trabecular bone (threshold 450 mg/cc for vehicle and DKKl-Ab, 550 mg/cc for
  • DKKl-Ab did not significantly affect diaphyseal BMD, cortical bone area and cancellous bone BV/TV and bone strength in intact contralateral femurs.
  • Scl-Ab significantly increased mid-diaphyseal cortical bone BMD by 6% and cortical bone area by 10%, and distal femur cancellous bone BV/TV by 43%, respectively, compared with vehicle.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Medicinal Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Physical Education & Sports Medicine (AREA)
  • Immunology (AREA)
  • Engineering & Computer Science (AREA)
  • Veterinary Medicine (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Genetics & Genomics (AREA)
  • Biochemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Molecular Biology (AREA)
  • Biophysics (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Orthopedic Medicine & Surgery (AREA)
  • Rheumatology (AREA)
  • Endocrinology (AREA)
  • Microbiology (AREA)
  • Mycology (AREA)
  • Epidemiology (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
PCT/US2011/058025 2010-10-27 2011-10-27 Dkk1 antibodies and methods of use Ceased WO2012058393A2 (en)

Priority Applications (11)

Application Number Priority Date Filing Date Title
MX2013004726A MX354481B (es) 2010-10-27 2011-10-27 Anticuerpos dkk1 y métodos de uso.
MX2017013617A MX382826B (es) 2010-10-27 2011-10-27 Anticuerpos dkk1 y metodos de uso.
EP20213270.0A EP3838922A1 (en) 2010-10-27 2011-10-27 Dkk1 antibodies and methods of use
EP17169408.6A EP3219725B1 (en) 2010-10-27 2011-10-27 Dkk1 antibodies and methods of use
CA2815181A CA2815181C (en) 2010-10-27 2011-10-27 Dkk1 antibodies and methods of use
JP2013536812A JP6066912B2 (ja) 2010-10-27 2011-10-27 Dkk1抗体およびその使用方法
EP11779531.0A EP2632951B1 (en) 2010-10-27 2011-10-27 Dkk1 antibodies and methods of use
US13/878,619 US9879072B2 (en) 2010-10-27 2011-10-27 DKK1 antibodies and methods of use
AU2011319843A AU2011319843C1 (en) 2010-10-27 2011-10-27 DKK1 antibodies and methods of use
US15/841,065 US10800839B2 (en) 2010-10-27 2017-12-13 DKK1 antibodies and methods of use
US17/015,212 US12297260B2 (en) 2010-10-27 2020-09-09 DKK1 antibodies and methods of use

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US40712810P 2010-10-27 2010-10-27
US61/407,128 2010-10-27

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US13/878,619 A-371-Of-International US9879072B2 (en) 2010-10-27 2011-10-27 DKK1 antibodies and methods of use
US15/841,065 Continuation US10800839B2 (en) 2010-10-27 2017-12-13 DKK1 antibodies and methods of use

Publications (2)

Publication Number Publication Date
WO2012058393A2 true WO2012058393A2 (en) 2012-05-03
WO2012058393A3 WO2012058393A3 (en) 2012-10-04

Family

ID=44910313

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2011/058025 Ceased WO2012058393A2 (en) 2010-10-27 2011-10-27 Dkk1 antibodies and methods of use

Country Status (10)

Country Link
US (3) US9879072B2 (enExample)
EP (3) EP3838922A1 (enExample)
JP (2) JP6066912B2 (enExample)
AR (2) AR083740A1 (enExample)
AU (3) AU2011319843C1 (enExample)
CA (2) CA3085710A1 (enExample)
ES (1) ES2863626T3 (enExample)
MX (3) MX382826B (enExample)
TW (2) TWI636993B (enExample)
WO (1) WO2012058393A2 (enExample)

Cited By (29)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2012118903A3 (en) * 2011-03-01 2013-03-14 Amgen Inc. Sclerostin and dkk-1 bispecific binding agents
WO2014121196A1 (en) * 2013-02-04 2014-08-07 Oncomed Pharmaceuticals, Inc. Methods and monitoring of treatment with a wnt pathway inhibitor
US8986685B2 (en) 1998-11-27 2015-03-24 Ucb Pharma S.A. Compositions and methods for increasing bone mineralization
US9089553B2 (en) 2005-05-03 2015-07-28 Amgen Inc. Method for inhibiting bone resorption
US9145457B2 (en) 2011-03-25 2015-09-29 Amgen Inc. Sclerostin antibody crystals and formulations thereof
US9157904B2 (en) 2010-01-12 2015-10-13 Oncomed Pharmaceuticals, Inc. Wnt antagonists and methods of treatment and screening
US9168300B2 (en) 2013-03-14 2015-10-27 Oncomed Pharmaceuticals, Inc. MET-binding agents and uses thereof
US9228013B2 (en) 2005-10-31 2016-01-05 OncoMed Pharmaceuticals Methods of using the FRI domain of human frizzled receptor for inhibiting Wnt signaling in a tumor or tumor cell
US9266959B2 (en) 2012-10-23 2016-02-23 Oncomed Pharmaceuticals, Inc. Methods of treating neuroendocrine tumors using frizzled-binding agents
US9273139B2 (en) 2008-09-26 2016-03-01 Oncomed Pharmaceuticals, Inc. Monoclonal antibodies against frizzled
US9296812B2 (en) 2005-05-03 2016-03-29 Amgen Inc. Sclerostin binding antibodies
US9352043B2 (en) 2010-05-14 2016-05-31 Amgen Inc. High concentration antibody formulations
EP3070098A1 (en) * 2010-06-07 2016-09-21 Enzo Biochem, Inc. Sulfation of wnt pathway proteins
US9499630B2 (en) 2010-04-01 2016-11-22 Oncomed Pharmaceuticals, Inc. Frizzled-binding agents and uses thereof
US9617323B2 (en) 2010-06-07 2017-04-11 Joshua Rabbani Sulfonated sclerostin, antibodies, epitopes and methods for identification and use therefor
US9657090B2 (en) 2011-12-28 2017-05-23 Amgen Inc. Method of treating alveolar bone loss through the use of anti-sclerostin antibodies
US9822173B2 (en) 2012-11-21 2017-11-21 Amgen Inc. Heterodimeric immunoglobulins
US9925260B2 (en) 2012-07-05 2018-03-27 Ucb Pharma S.A. Treatment for bone diseases
US10328120B2 (en) 2010-06-07 2019-06-25 Enzo Biochem, Inc. Pharmaceutical compositions targeting WNT pathway proteins
US10538584B2 (en) 2011-08-04 2020-01-21 Amgen Inc. Methods for treating bone gap defects
EP3574010A4 (en) * 2017-01-30 2020-12-16 Chugai Seiyaku Kabushiki Kaisha ANTI-SCLEROSTIN ANTIBODIES AND METHOD OF USE
US10961305B2 (en) 2016-12-21 2021-03-30 Mereo Biopharma 3 Limited Use of anti-sclerostin antibodies in the treatment of osteogenesis imperfecta
US11167011B2 (en) 2010-06-07 2021-11-09 Enzo Biochem, Inc. Methods for treating bone loss using sclerostin peptides
US11466079B2 (en) 2018-03-30 2022-10-11 Amgen Inc. C-terminal antibody variants
US11576970B2 (en) 2016-03-10 2023-02-14 UCB Biopharma SRL Pharmaceutical formulations
WO2023143444A1 (zh) * 2022-01-28 2023-08-03 上海君实生物医药科技股份有限公司 抗dkk1抗体、其药物组合物及用途
US11851483B2 (en) 2014-12-12 2023-12-26 Amgen Inc. Anti-sclerostin antibodies and their use to treat bone disorders as part of a regimen
US12194108B2 (en) 2018-03-23 2025-01-14 University Of Massachusetts Gene therapeutics for treating bone disorders
US12269898B2 (en) 2017-10-04 2025-04-08 Amgen Inc. Transthyretin immunoglobulin fusions

Families Citing this family (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
TWI636993B (zh) * 2010-10-27 2018-10-01 安美基公司 Dkk1抗體及使用方法
WO2013152860A2 (en) * 2012-04-11 2013-10-17 Dutalys Gmbh Improved antibody light chains
WO2017127706A1 (en) * 2016-01-22 2017-07-27 Yale University Compositions and methods for inhibiting dkk-1
WO2019213285A1 (en) * 2018-05-02 2019-11-07 Ortheus, Inc. Systems and methods for local modulation of wnt signaling
US11407828B2 (en) 2019-02-01 2022-08-09 Novarock Biotherapeutics, Ltd. Anti-CLauDiN 18 antibodies and methods of use thereof
CN112121147B (zh) * 2019-06-24 2023-07-04 中国人民解放军海军特色医学中心 多肽在治疗或预防骨髓瘤药物中的应用、多肽、核酸、药物及重组表达载体
CN112180094A (zh) * 2019-07-04 2021-01-05 上海东慈生物科技有限公司 Dkk1抑制剂在预防和/或治疗肿瘤恶病质与糖尿病伴随疾病中的应用
TR201920272A1 (tr) * 2019-12-15 2021-06-21 Uludamar Altay Dental i̇mplantlar, greft materyalleri̇ ve prf i̇le osseoi̇ntegrasyonun artirilmasi i̇çi̇n bi̇r terapöti̇k kompozi̇syon ve bunun lokal kullanim yöntemleri̇
WO2024253462A1 (ko) * 2023-06-07 2024-12-12 중앙대학교 산학협력단 스클레로스틴 억제제를 유효성분으로 포함하는 당뇨병성 안질환 예방 또는 치료용 약학적 조성물

Citations (59)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US3773919A (en) 1969-10-23 1973-11-20 Du Pont Polylactide-drug mixtures
EP0036676A1 (en) 1978-03-24 1981-09-30 The Regents Of The University Of California Method of making uniformly sized liposomes and liposomes so made
EP0058481A1 (en) 1981-02-16 1982-08-25 Zeneca Limited Continuous release pharmaceutical compositions
US4399216A (en) 1980-02-25 1983-08-16 The Trustees Of Columbia University Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials
EP0088046A2 (de) 1982-02-17 1983-09-07 Ciba-Geigy Ag Lipide in wässriger Phase
EP0133988A2 (de) 1983-08-02 1985-03-13 Hoechst Aktiengesellschaft Regulatorische Peptide enthaltende pharmazeutische Präparate mit protrahierter Freisetzung und Verfahren zu deren Herstellung
EP0143949A1 (en) 1983-11-01 1985-06-12 TERUMO KABUSHIKI KAISHA trading as TERUMO CORPORATION Pharmaceutical composition containing urokinase
WO1988001649A1 (en) 1986-09-02 1988-03-10 Genex Corporation Single polypeptide chain binding molecules
US4740461A (en) 1983-12-27 1988-04-26 Genetics Institute, Inc. Vectors and methods for transformation of eucaryotic cells
US4751180A (en) 1985-03-28 1988-06-14 Chiron Corporation Expression using fused genes providing for protein product
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
US4881175A (en) 1986-09-02 1989-11-14 Genex Corporation Computer based system and method for determining and displaying possible chemical structures for converting double- or multiple-chain polypeptides to single-chain polypeptides
US4912040A (en) 1986-11-14 1990-03-27 Genetics Institute, Inc. Eucaryotic expression system
WO1990004036A1 (en) 1988-10-12 1990-04-19 Medical Research Council Production of antibodies from transgenic animals
US4935233A (en) 1985-12-02 1990-06-19 G. D. Searle And Company Covalently linked polypeptide cell modulators
US4946778A (en) 1987-09-21 1990-08-07 Genex Corporation Single polypeptide chain binding molecules
US4959455A (en) 1986-07-14 1990-09-25 Genetics Institute, Inc. Primate hematopoietic growth factors IL-3 and pharmaceutical compositions
US5011912A (en) 1986-12-19 1991-04-30 Immunex Corporation Hybridoma and monoclonal antibody for use in an immunoaffinity purification system
US5013653A (en) 1987-03-20 1991-05-07 Creative Biomolecules, Inc. Product and process for introduction of a hinge region into a fusion protein to facilitate cleavage
WO1991010741A1 (en) 1990-01-12 1991-07-25 Cell Genesys, Inc. Generation of xenogeneic antibodies
US5091513A (en) 1987-05-21 1992-02-25 Creative Biomolecules, Inc. Biosynthetic antibody binding sites
WO1992003918A1 (en) 1990-08-29 1992-03-19 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
US5132405A (en) 1987-05-21 1992-07-21 Creative Biomolecules, Inc. Biosynthetic antibody binding sites
WO1992022646A1 (en) 1991-06-14 1992-12-23 Dnx Corp. Production of human hemoglobin in transgenic pigs
WO1993001227A1 (en) 1991-07-08 1993-01-21 University Of Massachusetts At Amherst Thermotropic liquid crystal segmented block copolymer
WO1993010151A1 (en) 1991-11-22 1993-05-27 Immunex Corporation Receptor for oncostatin m and leukemia inhibitory factor
US5258498A (en) 1987-05-21 1993-11-02 Creative Biomolecules, Inc. Polypeptide linkers for production of biosynthetic proteins
US5260203A (en) 1986-09-02 1993-11-09 Enzon, Inc. Single polypeptide chain binding molecules
WO1994002602A1 (en) 1992-07-24 1994-02-03 Cell Genesys, Inc. Generation of xenogeneic antibodies
WO1994010308A1 (en) 1992-10-23 1994-05-11 Immunex Corporation Methods of preparing soluble, oligomeric proteins
US5457035A (en) 1993-07-23 1995-10-10 Immunex Corporation Cytokine which is a ligand for OX40
US5476786A (en) 1987-05-21 1995-12-19 Creative Biomolecules, Inc. Biosynthetic antibody binding sites
US5530101A (en) 1988-12-28 1996-06-25 Protein Design Labs, Inc. Humanized immunoglobulins
US5545806A (en) 1990-08-29 1996-08-13 Genpharm International, Inc. Ransgenic non-human animals for producing heterologous antibodies
WO1996033735A1 (en) 1995-04-27 1996-10-31 Abgenix, Inc. Human antibodies derived from immunized xenomice
US5625126A (en) 1990-08-29 1997-04-29 Genpharm International, Inc. Transgenic non-human animals for producing heterologous antibodies
US5633425A (en) 1990-08-29 1997-05-27 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
US5661016A (en) 1990-08-29 1997-08-26 Genpharm International Inc. Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
WO1998024893A2 (en) 1996-12-03 1998-06-11 Abgenix, Inc. TRANSGENIC MAMMALS HAVING HUMAN IG LOCI INCLUDING PLURAL VH AND Vλ REGIONS AND ANTIBODIES PRODUCED THEREFROM
US5770429A (en) 1990-08-29 1998-06-23 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
US5789650A (en) 1990-08-29 1998-08-04 Genpharm International, Inc. Transgenic non-human animals for producing heterologous antibodies
US5814318A (en) 1990-08-29 1998-09-29 Genpharm International Inc. Transgenic non-human animals for producing heterologous antibodies
US5874299A (en) 1990-08-29 1999-02-23 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
US5877397A (en) 1990-08-29 1999-03-02 Genpharm International Inc. Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
WO1999010494A2 (en) 1997-08-25 1999-03-04 Genentech, Inc. Agonist antibodies to the thrombopoietin receptor, and their therapeutic uses
WO2000009560A2 (en) 1998-08-17 2000-02-24 Abgenix, Inc. Generation of modified molecules with increased serum half-lives
US6162963A (en) 1990-01-12 2000-12-19 Abgenix, Inc. Generation of Xenogenetic antibodies
US6255458B1 (en) 1990-08-29 2001-07-03 Genpharm International High affinity human antibodies and human antibodies against digoxin
US6270964B1 (en) 1997-01-31 2001-08-07 Odyssey Pharmaceuticals Inc. Protein fragment complementation assays for the detection of biological or drug interactions
US6300129B1 (en) 1990-08-29 2001-10-09 Genpharm International Transgenic non-human animals for producing heterologous antibodies
US6344541B1 (en) 1998-09-25 2002-02-05 Amgen Inc. DKR polypeptides
US6713610B1 (en) 1990-01-12 2004-03-30 Raju Kucherlapati Human antibodies derived from immunized xenomice
WO2006119107A2 (en) 2005-05-03 2006-11-09 Ucb Pharma S.A. Sclerostin binding agents
US7435871B2 (en) 2001-11-30 2008-10-14 Amgen Fremont Inc. Transgenic animals bearing human Igλ light chain genes
WO2009047356A1 (en) 2007-10-12 2009-04-16 Novartis Ag Compositions and methods for use for antibodies against sclerostin
US20100076178A1 (en) 2008-04-29 2010-03-25 Abbott Laboratories Dual Variable Domain Immumoglobulins and Uses Thereof
US7709611B2 (en) 2004-08-04 2010-05-04 Amgen Inc. Antibodies to Dkk-1
US9300829B2 (en) 2014-04-04 2016-03-29 Canon Kabushiki Kaisha Image reading apparatus and correction method thereof
US9401875B2 (en) 2012-06-01 2016-07-26 Nippon Telegraph And Telephone Corporation Packet transfer processing method and packet transfer processing device

Family Cites Families (12)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6565841B1 (en) 1991-03-15 2003-05-20 Amgen, Inc. Pulmonary administration of granulocyte colony stimulating factor
US5470582A (en) 1992-02-07 1995-11-28 Syntex (U.S.A.) Inc. Controlled delivery of pharmaceuticals from preformed porous polymeric microparticles
US20040038860A1 (en) * 2002-05-17 2004-02-26 Allen Kristina M. Reagents and methods for modulating dkk-mediated interactions
AR060017A1 (es) * 2006-01-13 2008-05-21 Novartis Ag Composiciones y metodos de uso para anticuerpos de dickkopf -1
EP2121755A1 (en) * 2007-02-08 2009-11-25 Merck & Co., Inc. Antibodies specific for dkk-1
WO2010032059A2 (en) * 2008-09-19 2010-03-25 Medimmune Llc Targeted binding agents directed to cd105 and uses thereof
PE20120475A1 (es) * 2009-05-12 2012-05-05 Pfizer Anticuerpos especificos para dkk-1
TWI636993B (zh) * 2010-10-27 2018-10-01 安美基公司 Dkk1抗體及使用方法
JP2014509588A (ja) * 2011-03-01 2014-04-21 アムジエン・インコーポレーテツド 二特異性結合剤
SI2739311T1 (en) * 2011-08-04 2018-07-31 Amgen Inc. Method for the treatment of bone defect defects
ES2813524T3 (es) * 2011-12-28 2021-03-24 Amgen Inc Método para tratar la pérdida de hueso alveolar mediante el uso de anticuerpos antiesclerostina
UY35148A (es) * 2012-11-21 2014-05-30 Amgen Inc Immunoglobulinas heterodiméricas

Patent Citations (71)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US3773919A (en) 1969-10-23 1973-11-20 Du Pont Polylactide-drug mixtures
EP0036676A1 (en) 1978-03-24 1981-09-30 The Regents Of The University Of California Method of making uniformly sized liposomes and liposomes so made
US4399216A (en) 1980-02-25 1983-08-16 The Trustees Of Columbia University Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials
EP0058481A1 (en) 1981-02-16 1982-08-25 Zeneca Limited Continuous release pharmaceutical compositions
EP0088046A2 (de) 1982-02-17 1983-09-07 Ciba-Geigy Ag Lipide in wässriger Phase
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
EP0133988A2 (de) 1983-08-02 1985-03-13 Hoechst Aktiengesellschaft Regulatorische Peptide enthaltende pharmazeutische Präparate mit protrahierter Freisetzung und Verfahren zu deren Herstellung
EP0143949A1 (en) 1983-11-01 1985-06-12 TERUMO KABUSHIKI KAISHA trading as TERUMO CORPORATION Pharmaceutical composition containing urokinase
US4740461A (en) 1983-12-27 1988-04-26 Genetics Institute, Inc. Vectors and methods for transformation of eucaryotic cells
US4751180A (en) 1985-03-28 1988-06-14 Chiron Corporation Expression using fused genes providing for protein product
US4935233A (en) 1985-12-02 1990-06-19 G. D. Searle And Company Covalently linked polypeptide cell modulators
US4959455A (en) 1986-07-14 1990-09-25 Genetics Institute, Inc. Primate hematopoietic growth factors IL-3 and pharmaceutical compositions
US5260203A (en) 1986-09-02 1993-11-09 Enzon, Inc. Single polypeptide chain binding molecules
US4881175A (en) 1986-09-02 1989-11-14 Genex Corporation Computer based system and method for determining and displaying possible chemical structures for converting double- or multiple-chain polypeptides to single-chain polypeptides
WO1988001649A1 (en) 1986-09-02 1988-03-10 Genex Corporation Single polypeptide chain binding molecules
US5455030A (en) 1986-09-02 1995-10-03 Enzon Labs, Inc. Immunotheraphy using single chain polypeptide binding molecules
US4912040A (en) 1986-11-14 1990-03-27 Genetics Institute, Inc. Eucaryotic expression system
US5011912A (en) 1986-12-19 1991-04-30 Immunex Corporation Hybridoma and monoclonal antibody for use in an immunoaffinity purification system
US5013653A (en) 1987-03-20 1991-05-07 Creative Biomolecules, Inc. Product and process for introduction of a hinge region into a fusion protein to facilitate cleavage
US5482858A (en) 1987-05-21 1996-01-09 Creative Biomolecules, Inc. Polypeptide linkers for production of biosynthetic proteins
US5091513A (en) 1987-05-21 1992-02-25 Creative Biomolecules, Inc. Biosynthetic antibody binding sites
US5132405A (en) 1987-05-21 1992-07-21 Creative Biomolecules, Inc. Biosynthetic antibody binding sites
US5476786A (en) 1987-05-21 1995-12-19 Creative Biomolecules, Inc. Biosynthetic antibody binding sites
US5258498A (en) 1987-05-21 1993-11-02 Creative Biomolecules, Inc. Polypeptide linkers for production of biosynthetic proteins
US4946778A (en) 1987-09-21 1990-08-07 Genex Corporation Single polypeptide chain binding molecules
WO1990004036A1 (en) 1988-10-12 1990-04-19 Medical Research Council Production of antibodies from transgenic animals
US5545807A (en) 1988-10-12 1996-08-13 The Babraham Institute Production of antibodies from transgenic animals
US6180370B1 (en) 1988-12-28 2001-01-30 Protein Design Labs, Inc. Humanized immunoglobulins and methods of making the same
US5693762A (en) 1988-12-28 1997-12-02 Protein Design Labs, Inc. Humanized immunoglobulins
US5693761A (en) 1988-12-28 1997-12-02 Protein Design Labs, Inc. Polynucleotides encoding improved humanized immunoglobulins
US5585089A (en) 1988-12-28 1996-12-17 Protein Design Labs, Inc. Humanized immunoglobulins
US5530101A (en) 1988-12-28 1996-06-25 Protein Design Labs, Inc. Humanized immunoglobulins
WO1991010741A1 (en) 1990-01-12 1991-07-25 Cell Genesys, Inc. Generation of xenogeneic antibodies
US6162963A (en) 1990-01-12 2000-12-19 Abgenix, Inc. Generation of Xenogenetic antibodies
US6673986B1 (en) 1990-01-12 2004-01-06 Abgenix, Inc. Generation of xenogeneic antibodies
US6713610B1 (en) 1990-01-12 2004-03-30 Raju Kucherlapati Human antibodies derived from immunized xenomice
US5661016A (en) 1990-08-29 1997-08-26 Genpharm International Inc. Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
US5877397A (en) 1990-08-29 1999-03-02 Genpharm International Inc. Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
WO1992003918A1 (en) 1990-08-29 1992-03-19 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
US5569825A (en) 1990-08-29 1996-10-29 Genpharm International Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
US6300129B1 (en) 1990-08-29 2001-10-09 Genpharm International Transgenic non-human animals for producing heterologous antibodies
US6255458B1 (en) 1990-08-29 2001-07-03 Genpharm International High affinity human antibodies and human antibodies against digoxin
US5625126A (en) 1990-08-29 1997-04-29 Genpharm International, Inc. Transgenic non-human animals for producing heterologous antibodies
US5633425A (en) 1990-08-29 1997-05-27 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
US5545806A (en) 1990-08-29 1996-08-13 Genpharm International, Inc. Ransgenic non-human animals for producing heterologous antibodies
EP0546073B1 (en) 1990-08-29 1997-09-10 GenPharm International, Inc. production and use of transgenic non-human animals capable of producing heterologous antibodies
US5874299A (en) 1990-08-29 1999-02-23 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
US5814318A (en) 1990-08-29 1998-09-29 Genpharm International Inc. Transgenic non-human animals for producing heterologous antibodies
US5789650A (en) 1990-08-29 1998-08-04 Genpharm International, Inc. Transgenic non-human animals for producing heterologous antibodies
US5770429A (en) 1990-08-29 1998-06-23 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
WO1992022646A1 (en) 1991-06-14 1992-12-23 Dnx Corp. Production of human hemoglobin in transgenic pigs
WO1993001227A1 (en) 1991-07-08 1993-01-21 University Of Massachusetts At Amherst Thermotropic liquid crystal segmented block copolymer
US5262522A (en) 1991-11-22 1993-11-16 Immunex Corporation Receptor for oncostatin M and leukemia inhibitory factor
WO1993010151A1 (en) 1991-11-22 1993-05-27 Immunex Corporation Receptor for oncostatin m and leukemia inhibitory factor
US5426048A (en) 1991-11-22 1995-06-20 Immunex Corporation DNA encoding a fusion receptor for oncostatin M and leukemia inhibitory factor
WO1994002602A1 (en) 1992-07-24 1994-02-03 Cell Genesys, Inc. Generation of xenogeneic antibodies
WO1994010308A1 (en) 1992-10-23 1994-05-11 Immunex Corporation Methods of preparing soluble, oligomeric proteins
US5457035A (en) 1993-07-23 1995-10-10 Immunex Corporation Cytokine which is a ligand for OX40
WO1996033735A1 (en) 1995-04-27 1996-10-31 Abgenix, Inc. Human antibodies derived from immunized xenomice
WO1998024893A2 (en) 1996-12-03 1998-06-11 Abgenix, Inc. TRANSGENIC MAMMALS HAVING HUMAN IG LOCI INCLUDING PLURAL VH AND Vλ REGIONS AND ANTIBODIES PRODUCED THEREFROM
US6270964B1 (en) 1997-01-31 2001-08-07 Odyssey Pharmaceuticals Inc. Protein fragment complementation assays for the detection of biological or drug interactions
WO1999010494A2 (en) 1997-08-25 1999-03-04 Genentech, Inc. Agonist antibodies to the thrombopoietin receptor, and their therapeutic uses
WO2000009560A2 (en) 1998-08-17 2000-02-24 Abgenix, Inc. Generation of modified molecules with increased serum half-lives
US6344541B1 (en) 1998-09-25 2002-02-05 Amgen Inc. DKR polypeptides
US7435871B2 (en) 2001-11-30 2008-10-14 Amgen Fremont Inc. Transgenic animals bearing human Igλ light chain genes
US7709611B2 (en) 2004-08-04 2010-05-04 Amgen Inc. Antibodies to Dkk-1
WO2006119107A2 (en) 2005-05-03 2006-11-09 Ucb Pharma S.A. Sclerostin binding agents
WO2009047356A1 (en) 2007-10-12 2009-04-16 Novartis Ag Compositions and methods for use for antibodies against sclerostin
US20100076178A1 (en) 2008-04-29 2010-03-25 Abbott Laboratories Dual Variable Domain Immumoglobulins and Uses Thereof
US9401875B2 (en) 2012-06-01 2016-07-26 Nippon Telegraph And Telephone Corporation Packet transfer processing method and packet transfer processing device
US9300829B2 (en) 2014-04-04 2016-03-29 Canon Kabushiki Kaisha Image reading apparatus and correction method thereof

Non-Patent Citations (165)

* Cited by examiner, † Cited by third party
Title
"Current Protocols in Molecular Biology", 1989, JOHN WILEY & SONS, pages: 6.3.1 - 6.3.6
A. R. GENNARO,: "Remington's Pharmaceutical Sciences, 18th Edition,", 1990, MACK PUBLISHING COMPANY
ADAMCS ET AL., NATURE, vol. 318, 1985, pages 533 - 38
ALEXANDER ET AL., MOL. CELL BIOL., vol. 7, 1987, pages 1436 - 44
ARAVIND, A., KOONIN, E.V., CURRENT BIOLOGY, vol. 8, 1998, pages R477 - 479
ASHKENAZI ET AL., PNAS USA, vol. 88, 1991, pages 10535
AUSUBEL ET AL.,: "Current Protocols in Molecular Biology", 1995, JOHN WILEY & SONS, INC.
AUSUBEL ET AL.: "Current Protocols in Molecular Biology", 1992, GREENE PUBLISHING ASSOCIATES
BAFICO ET AL., NATURE CELL BIOL, vol. 3, 2001, pages 683
BAJADA ET AL., BONE, vol. 45, no. 4, 2009, pages 726 - 35
BALEMANS ET AL., HUM. MOL. GENET., vol. 10, 2001, pages 537 543
BAUM, EMBO J., vol. 13, 1994, pages 3992 - 4001
BEMOIST, CHAMBON, NATURE, vol. 290, 1981, pages 304 - 10
BIANCHI, MCGREW, BIOTECH BIOTECHNOL BIOENG, vol. 84, no. 4, 2003, pages 439 - 44
BIRD, SCIENCE, vol. 242, 1988, pages 423
BLOOM ET AL., PROTEIN SCIENCE, vol. 6, 1997, pages 407
BONNARENS F ET AL., J ORTHOP RES, vol. 2, 1984, pages 97 - 101
BOWIE ET AL., SCIENCE, vol. 253, 1991, pages 164 - 170
BOYDEN ET AL., N ENG J MED., vol. 346, no. 20, 2002, pages 1513 - 1521
BRANDCN AND TOOZC: "Introduction to Protein Structure", 1991, GARLAND PUBLISHING
BRENNAN ET AL., SCIENCE, vol. 229, 1985, pages 81 - 83
BRENNER ET AL., CURR. OP. STRUCT. BIOL., vol. 7, 1997, pages 369 - 376
BRINSTER ET AL., NATURE, vol. 296, 1982, pages 39 - 42
BRUGGERMANN ET AL., YEAR IN IMMUNOL., vol. 7, 1993, pages 33
BRUNKOW ET AL., AM. J. HUM. GENET., vol. 68, 2001, pages 577 589
BYRN ET AL., NATURE, vol. 344, 1990, pages 677
CARILLO ET AL., SIAM J. APPLIED MATH., vol. 48, 1988, pages 1073
CHEN ET AL., INTERNATIONAL IMMUNOLOGY, vol. 5, 1993, pages 647 - 656
CHEUNG ET AL., VIROLOGY, vol. 176, 1990, pages 546 - 552
CHOTHIA ET AL., NATURE, vol. 342, 1989, pages 878 - 883
CHOTHIA, LESK, J. MOL. BIOL., vol. 196, 1987, pages 901 - 917
CHOU ET AL., ADV. ENZYRNOL. RELAT. AREAS MOL. BIOL., vol. 47, 1978, pages 45 - 148
CHOU ET AL., ANN. REV. BIOCHEM., vol. 47, 1979, pages 251 - 276
CHOU ET AL., BIOCHEMISTRY, vol. 113, 1974, pages 211 - 222
CHOU ET AL., BIOCHEMISTRY, vol. 13, 1974, pages 222 - 245
CHOU ET AL., BIOPHYS. J., vol. 26, 1979, pages 367 - 384
CHU ET AL., GENE, vol. 13, 1981, pages 197
CREIGHTON,: "Proteins, Structures and Molecular Principles", 1984, FRCCMAN AND COMPANY
D. V. GOCDDCL,: "Methods Enzymol", vol. 185, 1990, ACADEMIC PRESS
DAVIS ET AL.: "Basic Methods in Molecular Biology", 1986, ELSEVIER
DAYHOFF ET AL., ATLAS OF PROTEIN SEQUENCE AND STRUCTURE, vol. 5, 1978, pages 345 - 352
DE GRAAF ET AL., METHODS MOL BIOL., vol. 178, 2002, pages 379 - 87
DEBOER ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 80, 1983, pages 21 - 25
DELMAS ET AL., OSTEOPOROS INT., vol. 6, 2000, pages 2 - 17
DEMPSTER ET AL., ENDOCRINE REVIEWS, vol. 14, no. 6, 1993, pages 690 - 709
E. S. GOLUB AND D. R. GREN,: "Immunology--A Synthesis, 2nd Edition", 1991, SINAUER ASSOCIATES
EPPSTEIN ET AL., PROC. NATL. ACAD. SCI. USA, vol. 82, 1985, pages 3688 - 3692
EVANS ET AL., J. MED. CHCM., vol. 30, 1987, pages 1229
FANSLOW ET AL., SEMIN. IMMUNOL., vol. 6, 1994, pages 267 - 78
FAUCHERE, ADV. DRUG RES., vol. 15, 1986, pages 29
FEDI ET AL., J BIOL CHEM, vol. 274, no. 27, 1999, pages 19465 - 72
FISHWILD ET AL., NATURE BIOTECHNOLOGY, vol. 14, 1996, pages 845 - 851
FROST, JEE, BONE AND MINERAL, vol. 18, 1992, pages 227 - 236
GLENNIE ET AL., J. IMMUNOL., vol. 139, 1987, pages 2367 - 2375
GLINKA ET AL., NATURE, vol. 391, 1998, pages 357 - 62
GONG ET AL., CELL, vol. 107, 2001, pages 513 - 23
GRAHAM ET AL., VIROLOGY, vol. 52, 1973, pages 456
GRIBSKOV ET AL., METH. ENZYM., vol. 183, 1990, pages 146 - 159
GRIBSKOV ET AL., PROC. NAT. ACAD. SCI., vol. 84, 1987, pages 4355 - 4358
GRIBSKOV, M. AND DEVEREUX, J.,: "Sequence Analysis Primer", 1991, M. STOCKTON PRESS
GRIFFIN, A. M., AND GRIFFIN, H. G.,: "Computer Analysis of Sequence Data, Part 1", 1994, HUMANA PRESS
GROSSCHCDL, CCLL, vol. 38, 1984, pages 647 - 58
GUINNCSS-HCY, MCTAB. BONC DIS. RCLAT. RES., vol. 5, 1984, pages 177 - 181
HAMMER ET AL., SCIENCE, vol. 235, 1987, pages 53 - 58
HANAHAN, NATURE, vol. 315, 1985, pages 115 - 22
HARDING, LONBERG, ANN. N.Y ACAD. SCI, vol. 764, 1995, pages 536 - 546
HARDING, LONBERG, ANN. N.Y ACAD. SCI., vol. 764, 1995, pages 536 - 546
HARLOW AND LANE: "Antibodies: A Laboratory Manual", 1988, COLD SPRING HARBOR LABORATORY PRESS
HARLOW, LANE: "Antibodies, A Laboratory Manual", 1988, COLD SPRING HARBOR PRESS
HARLOW, LANE: "Antibodies: A Laboratory Manual", 1990, COLD SPRING HARBOR LABORATORY PRESS
HENIKOFF ET AL., PROC. NATL. ACAD. SCI. USA, vol. 89, 1992, pages 10915 - 10919
HOLLENBAUGH ET AL.: "Construction of Immunoglobulin Fusion Proteins", CURRENT PROTOCOLS IN IMMUNOLOGY, vol. 4, 1992, pages 10.19.1 - 10.19.11
HOLM ET AL., NUCL. ACID. RES., vol. 27, 1999, pages 244 - 247
HOOGENBOOM ET AL., J. MOL. BIOL., vol. 227, 1991, pages 381
HOPP ET AL., BIO/TECHNOLOGY, vol. 6, 1988, pages 1204
HOPPE ET AL., FEBS LETTERS, vol. 344, 1994, pages 191
HUSTON ET AL., PROC. NATL. ACAD. SCI. USA, vol. 85, 1988, pages 5879
JAKOBOVITS ET AL., NATURE, vol. 362, 1993, pages 255 - 258
JAKOBOVITS ET AL., PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 2551 - 2555
JEE, YAO, J. MUSCULOSKEL. NEURON. INTERACT., vol. 1, 2001, pages 193 - 207
JONES ET AL., NATURE, vol. 321, 1986, pages 522 - 25
JONES, CURR. OPIN. STRUCT. BIOL., vol. 7, 1997, pages 377 - 87
KABAT ET AL.: "Sequences of Proteins of Immunological Interest, 5th Ed.,", 1991, NIH
KABAT: "Sequences of Proteins of Immunological Interest", 1987, NATIONAL INSTITUTES OF HEALTH
KALU, BONE AND MINERAL, vol. 15, 1991, pages 175 - 192
KARPOVSKY, J. EXP. MED., vol. 160, 1984, pages 1686
KE HZ ET AL., TRANS ORS, vol. 34, 2009, pages 22
KEARNEY ET AL., J. IMMUNOL., vol. 123, 1979, pages 1548 - 1550
KELSEY ET AL., GENES AND DEVEL., vol. 1, 1987, pages 161 - 71
KENNET ET AL.: "Monoclonal Antibodies, Hybridomas: A New Dimension in Biological Analyses", 1980, PLENUM PRESS
KHOSLA, RIGGS, MAYO CLIN. PROC., vol. 70, 1995, pages 978982
KIRKLAND ET AL., J. IMMUNOL., vol. 137, 1986, pages 3614 - 3619
KOHLER, MILSTEIN, NATURE, vol. 256, 1975, pages 495
KOLLIAS ET AL., CELL, vol. 46, 1986, pages 89 - 94
KOMATSU DE ET AL., J ORTHOP RES, 2010
KORTT ET AL., BIOMOL. ENG., vol. 18, 2001, pages 95 - 108
KORTT ET AL., PROT. ENG., vol. 10, 1997, pages 423
KOSTELNY ET AL., J. IMMUNOL., vol. 148, 1992, pages 1547 - 1553
KRIANGKUM ET AL., BIOMOL. ENG., vol. 18, 2001, pages 31 - 40
KRUMLAUF ET AL., MOL. CELL. BIOL., vol. 5, 1985, pages 1639 - 48
KRUPNIK ET AL., GENE, vol. 238, 1999, pages 301 - 13
KYTE ET AL., J. MOL. BIOL., vol. 157, 1982, pages 105 - 131
LANDSCHULZ ET AL., SCIENCE, vol. 240, 1988, pages 1759
LANGER ET AL., J BIOMED MATER RES, vol. 15, 1981, pages 167 - 277
LANGER, CHEM TECH, vol. 12, 1982, pages 98 - 105
LANTTO ET AL., METHODS MOL. BIOL., vol. 178, 2002, pages 303 - 16
LEDER ET AL., CELL, vol. 45, 1986, pages 485 - 95
LESK, A. M.: "Computational Molecular Biology", 1988, OXFORD UNIVERSITY PRESS
LI XD ET AL., J BONE MINER RES, vol. 24, 2009, pages 578
LITTLE ET AL., AM J HUMAN GENETICS., vol. 70, no. 1, 2002, pages 11 - 19
LIU, MA ET AL., PROC. NATL. ACAD. SCI. USA, vol. 82, 1985, pages 8648
LONBERG ET AL., NATURE, vol. 368, 1994, pages 856 - 859
LONBERG, HUSZAR, INTERN. REV. IMMUNOL., vol. 13, 1995, pages 65 - 93
LONBERG, HUSZAR, INTERN. REV. LMMUNOL., vol. 13, 1995, pages 65 - 93
LONBERG: "Handbook of Exp. Pharmacology", vol. 113, 1994, pages: 49 - 101
MACDONALD, HEPATOLOGY, vol. 7, 1987, pages 425 - 515
MANIATIS ET AL., SCIENCE, vol. 236, 1987, pages 1237
MAO ET AL., NATURE, vol. 411, no. 17, 2001, pages 321
MAO ET AL., NATURE, vol. 417, 2002, pages 664
MARKS ET AL., BIOTECHNOLOGY, vol. 10, 1992, pages 779
MARKS ET AL., J. MOL. BIOL., vol. 222, 1991, pages 581
MASON ET AL., SCIENCE, vol. 234, 1986, pages 1372 - 78
MENDEZ ET AL., NATURE GENETICS, vol. 15, 1997, pages 146 - 156
MOGRAM ET AL., NATURE, vol. 315, 1985, pages 338 - 40
MOLDENHAUER ET AL., SCAND. J. IMMUNOL., vol. 32, 1990, pages 77 - 82
MOREL ET AL., MOLEC. IMMUNOL., vol. 25, 1988, pages 7 - 15
MORRISON ET AL., PROC. NATL. ACAD. SCI. USA, vol. 81, 1985, pages 6851 - 6855
MOULT, CURR. OP. IN BIOTECH., vol. 7, 1996, pages 422 - 427
NEEDLEMAN ET AL., J. MOL. BIOL., vol. 48, 1970, pages 443 - 453
OMINSKY M ET AL., ASBMR ABSTRACT, September 2009 (2009-09-01)
ORNITZ ET AL., COLD SPRING HARBOR SYMP. QUANT. BIOL., vol. 50, 1986, pages 399409
PADHI ET AL., J BONE MINER RES., June 2010 (2010-06-01)
PATEL, N ENG J MED, vol. 346, no. 20, 2002, pages 1572
PAUL, W.,: "Fundamental Immunology, 2nd", 1989, RAVEN PRESS
PAULUS, BEHRING INS. MITT., 1985, pages 118 - 1 32
PINKERT ET AL., GENES AND DEVEL., vol. 1, 1987, pages 268 - 76
READHEAD ET AL., CELL, vol. 48, 1987, pages 703 - 12
RIECHMANN ET AL., NATURE, vol. 332, 1988, pages 323 - 27
RIGGS, WEST J. MED., vol. 154, 1991, pages 63 77
RIZO, GIERASCH, ANN. REV. BIOCHEM., vol. 61, 1992, pages 387
SAMBROOK ET AL.: "Molecular Cloning: A Laboratory Manual", 2001
SAMBROOK ET AL.: "Molecular Cloning: A Laboratory Manual, 2d ed.,", 1989, COLD SPRING HARBOR LABORATORY PRESS
SAMBROOK, FRITSCH, MANIATIS: "Molecular Cloning: A Laboratory Manual", 1989, COLD SPRING HARBOR LABORATORY PRESS
SANI, NATURE, vol. 314, 1985, pages 283 - 86
SEMENOV ET AL., CURR BIOL, vol. 11, 2001, pages 951 - 61
SIDMAN ET AL., BIOPOLYMERS, vol. 22, 1983, pages 547 - 556
SIPPL, STRUCTURE, vol. 4, 1996, pages 15 - 19
SMITH, D. W.,: "Biocomputing Informatics and Genome Projects", 1993, ACADEMIC PRESS
SONGSIVILAI, LACHMANN, CLIN. EXP. IMMUNOL., vol. 79, 1990, pages 315 - 321
STAHLI ET AL., METHODS IN ENZYMOLOGY, vol. 9, 1983, pages 242 - 253
SWIFT ET AL., CELL, vol. 38, 1984, pages 63946
TAYLOR DK ET AL., J BONE MINER RES, vol. 24, 2009, pages 1043 - 1054
TAYLOR ET AL., INTERNATIONAL IMMUNOLOGY, vol. 6, 1994, pages 579 - 591
TAYLOR ET AL., NUCLEIC ACIDS RESEARCH, vol. 20, 1992, pages 6287 - 6295
THORNTON, NATURE, vol. 354, 1991, pages 105
TUAILLON ET AL., J. IMMUNOL., vol. 152, 1994, pages 2912 - 2920
VEBER, FREIDINGER, TINS, 1985, pages 392
VERHOEYEN ET AL., SCIENCE, vol. 239, 1988, pages 1534 - 36
VILLA-KAMAROFF ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 75, 1978, pages 3727 - 31
VON HEINJE, G.: "Sequence Analysis in Molecular Biology", 1987, ACADEMIC PRESS
VOSS ET AL., TRENDS BIOCHEM. SCI., vol. 11, 1986, pages 287
WAGNER ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 78, 1981, pages 1444 - 45
WARD ET AL., NATURE, vol. 334, 1989, pages 544
YAMAMOTO ET AL., CELL, vol. 22, 1980, pages 787 - 97
ZORN, CURR BIOL, vol. 11, 2001, pages R592 - 95

Cited By (62)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US8986685B2 (en) 1998-11-27 2015-03-24 Ucb Pharma S.A. Compositions and methods for increasing bone mineralization
US9791462B2 (en) 1998-11-27 2017-10-17 Ucb Pharma, S.A. Compositions and methods for increasing bone mineralization
US10273293B2 (en) 2005-05-03 2019-04-30 Amgen Inc. Method for inhibiting bone resorption
US9089553B2 (en) 2005-05-03 2015-07-28 Amgen Inc. Method for inhibiting bone resorption
US10562964B2 (en) 2005-05-03 2020-02-18 Amgen Inc. Methods for isolating antibodies that bind sclerostin
US9296812B2 (en) 2005-05-03 2016-03-29 Amgen Inc. Sclerostin binding antibodies
US11939372B2 (en) 2005-05-03 2024-03-26 Amgen Inc. Binding agents
US9228013B2 (en) 2005-10-31 2016-01-05 OncoMed Pharmaceuticals Methods of using the FRI domain of human frizzled receptor for inhibiting Wnt signaling in a tumor or tumor cell
US9732139B2 (en) 2005-10-31 2017-08-15 Oncomed Pharmaceuticals, Inc. Methods of treating cancer by administering a soluble receptor comprising a human Fc domain and the Fri domain from human frizzled receptor
US11091537B2 (en) 2007-09-17 2021-08-17 Amgen Inc. Method for inhibiting bone resorption
US12421304B2 (en) 2007-09-17 2025-09-23 Amgen Inc. Method for inhibiting bone resorption
US9573998B2 (en) 2008-09-26 2017-02-21 Oncomed Pharmaceuticals, Inc. Antibodies against human FZD5 and FZD8
US9273139B2 (en) 2008-09-26 2016-03-01 Oncomed Pharmaceuticals, Inc. Monoclonal antibodies against frizzled
US9579361B2 (en) 2010-01-12 2017-02-28 Oncomed Pharmaceuticals, Inc. Wnt antagonist and methods of treatment and screening
US9157904B2 (en) 2010-01-12 2015-10-13 Oncomed Pharmaceuticals, Inc. Wnt antagonists and methods of treatment and screening
US9499630B2 (en) 2010-04-01 2016-11-22 Oncomed Pharmaceuticals, Inc. Frizzled-binding agents and uses thereof
US11040102B2 (en) 2010-05-14 2021-06-22 Amgen Inc. High concentration antibody formulations
US10064946B2 (en) 2010-05-14 2018-09-04 Amgen Inc. High concentration antibody formulations
US12178873B2 (en) 2010-05-14 2024-12-31 Amgen Inc. High concentration antibody formulations
US9352043B2 (en) 2010-05-14 2016-05-31 Amgen Inc. High concentration antibody formulations
US10899827B2 (en) 2010-06-07 2021-01-26 Enzo Biochem, Inc. Antibodies specific for sulfation sites of sclerostin
US9617323B2 (en) 2010-06-07 2017-04-11 Joshua Rabbani Sulfonated sclerostin, antibodies, epitopes and methods for identification and use therefor
US11167011B2 (en) 2010-06-07 2021-11-09 Enzo Biochem, Inc. Methods for treating bone loss using sclerostin peptides
US10626170B2 (en) 2010-06-07 2020-04-21 Enzo Biochem, Inc. Sulfonated sclerostin, antibodies, epitopes and methods for identification and use therefor
US9493541B2 (en) 2010-06-07 2016-11-15 Joshua Rabbani Antibodies specific for sulfated sclerostin
US11667703B2 (en) 2010-06-07 2023-06-06 Enzo Biochem, Inc. Sulfonated sclerostin, antibodies, epitopes and methods for identification and use therefor
US10328120B2 (en) 2010-06-07 2019-06-25 Enzo Biochem, Inc. Pharmaceutical compositions targeting WNT pathway proteins
US11938167B2 (en) 2010-06-07 2024-03-26 Enzo Biochem, Inc. Pharmaceutical compositions and methods targeting Wnt pathway proteins
EP3070098A1 (en) * 2010-06-07 2016-09-21 Enzo Biochem, Inc. Sulfation of wnt pathway proteins
US11639382B2 (en) 2010-06-07 2023-05-02 Enzo Biochem, Inc. Antibodies specific for sulfation sites of Wnt pathway proteins
WO2012118903A3 (en) * 2011-03-01 2013-03-14 Amgen Inc. Sclerostin and dkk-1 bispecific binding agents
US9133272B2 (en) 2011-03-01 2015-09-15 Amgen Inc. Bispecific binding agents
US9920114B2 (en) 2011-03-25 2018-03-20 Amgen Inc. Antibody formulations
US9145457B2 (en) 2011-03-25 2015-09-29 Amgen Inc. Sclerostin antibody crystals and formulations thereof
US9617333B2 (en) 2011-03-25 2017-04-11 Amgen Inc. Sclerostin antibody crystals and formulations thereof
US10538584B2 (en) 2011-08-04 2020-01-21 Amgen Inc. Methods for treating bone gap defects
US9913900B2 (en) 2011-12-28 2018-03-13 Amgen Inc. Method of treating alvelor bone loss through the use of anti-sclerostin antibodies
US9657090B2 (en) 2011-12-28 2017-05-23 Amgen Inc. Method of treating alveolar bone loss through the use of anti-sclerostin antibodies
US9925260B2 (en) 2012-07-05 2018-03-27 Ucb Pharma S.A. Treatment for bone diseases
US10799583B2 (en) 2012-07-05 2020-10-13 Ucb Pharma, S.A. Treatment for bone diseases
US11896667B2 (en) 2012-07-05 2024-02-13 Ucb Pharma S.A. Treatment for bone diseases
US9266959B2 (en) 2012-10-23 2016-02-23 Oncomed Pharmaceuticals, Inc. Methods of treating neuroendocrine tumors using frizzled-binding agents
US11466078B2 (en) 2012-11-21 2022-10-11 Amgen Inc. Heterodimeric immunoglobulins
US10233237B2 (en) 2012-11-21 2019-03-19 Amgen Inc. Heterodimeric immunoglobulins
US9822173B2 (en) 2012-11-21 2017-11-21 Amgen Inc. Heterodimeric immunoglobulins
EP2950885A4 (en) * 2013-02-04 2016-09-14 Oncomed Pharm Inc METHODS AND SURVEILLANCE OF TREATMENT BY AN INHIBITOR OF THE WNT PATH
WO2014121196A1 (en) * 2013-02-04 2014-08-07 Oncomed Pharmaceuticals, Inc. Methods and monitoring of treatment with a wnt pathway inhibitor
JP2016510411A (ja) * 2013-02-04 2016-04-07 オンコメッド ファーマシューティカルズ インコーポレイテッド Wnt経路インヒビターによる処置の方法およびモニタリング
US9987357B2 (en) 2013-02-04 2018-06-05 Oncomed Pharmaceuticals, Inc. Methods and monitoring of treatment with a WNT pathway inhibitor
US9359444B2 (en) 2013-02-04 2016-06-07 Oncomed Pharmaceuticals Inc. Methods and monitoring of treatment with a Wnt pathway inhibitor
US9168300B2 (en) 2013-03-14 2015-10-27 Oncomed Pharmaceuticals, Inc. MET-binding agents and uses thereof
US11851483B2 (en) 2014-12-12 2023-12-26 Amgen Inc. Anti-sclerostin antibodies and their use to treat bone disorders as part of a regimen
US11576970B2 (en) 2016-03-10 2023-02-14 UCB Biopharma SRL Pharmaceutical formulations
US10961305B2 (en) 2016-12-21 2021-03-30 Mereo Biopharma 3 Limited Use of anti-sclerostin antibodies in the treatment of osteogenesis imperfecta
US12173058B2 (en) 2016-12-21 2024-12-24 Mereo Biopharma 3 Limited Use of anti-sclerostin antibodies in the treatment of osteogenesis imperfecta
US12209121B2 (en) 2017-01-30 2025-01-28 Chugai Seiyaku Kabushiki Kaisha Anti-sclerostin antibodies and methods of use
EP3574010A4 (en) * 2017-01-30 2020-12-16 Chugai Seiyaku Kabushiki Kaisha ANTI-SCLEROSTIN ANTIBODIES AND METHOD OF USE
US12269898B2 (en) 2017-10-04 2025-04-08 Amgen Inc. Transthyretin immunoglobulin fusions
US12194108B2 (en) 2018-03-23 2025-01-14 University Of Massachusetts Gene therapeutics for treating bone disorders
US11858983B2 (en) 2018-03-30 2024-01-02 Amgen Inc. C-terminal anti-sclerostin antibody variants
US11466079B2 (en) 2018-03-30 2022-10-11 Amgen Inc. C-terminal antibody variants
WO2023143444A1 (zh) * 2022-01-28 2023-08-03 上海君实生物医药科技股份有限公司 抗dkk1抗体、其药物组合物及用途

Also Published As

Publication number Publication date
AR118047A2 (es) 2021-09-15
EP3219725B1 (en) 2020-12-16
JP6353500B2 (ja) 2018-07-04
EP2632951A2 (en) 2013-09-04
AU2011319843A1 (en) 2013-05-09
AU2011319843B2 (en) 2016-03-10
US9879072B2 (en) 2018-01-30
CA2815181A1 (en) 2012-05-03
TWI636994B (zh) 2018-10-01
AR083740A1 (es) 2013-03-20
US12297260B2 (en) 2025-05-13
MX2021001494A (es) 2021-04-28
US10800839B2 (en) 2020-10-13
JP2013545734A (ja) 2013-12-26
AU2018201333B2 (en) 2020-01-16
TW201305198A (zh) 2013-02-01
TWI636993B (zh) 2018-10-01
AU2011319843C1 (en) 2017-02-02
AU2018201333A1 (en) 2018-03-15
EP2632951B1 (en) 2017-08-02
EP3219725A3 (en) 2017-11-22
EP3219725A2 (en) 2017-09-20
EP3838922A1 (en) 2021-06-23
US20210040189A1 (en) 2021-02-11
US20130209475A1 (en) 2013-08-15
JP2017043619A (ja) 2017-03-02
US20180111985A1 (en) 2018-04-26
MX2013004726A (es) 2013-08-29
MX354481B (es) 2018-03-07
AU2016203722A1 (en) 2016-06-23
ES2863626T3 (es) 2021-10-11
JP6066912B2 (ja) 2017-01-25
TW201710291A (zh) 2017-03-16
WO2012058393A3 (en) 2012-10-04
CA2815181C (en) 2020-09-15
MX382826B (es) 2025-03-13
CA3085710A1 (en) 2012-05-03

Similar Documents

Publication Publication Date Title
US12297260B2 (en) DKK1 antibodies and methods of use
US7709611B2 (en) Antibodies to Dkk-1
EP2681242B1 (en) Sclerostin and dkk-1 bispecific binding agents
WO2014144817A2 (en) Inhibitory polypeptides specific to wnt inhibitors

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 11779531

Country of ref document: EP

Kind code of ref document: A2

WWE Wipo information: entry into national phase

Ref document number: 13878619

Country of ref document: US

ENP Entry into the national phase

Ref document number: 2815181

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2013536812

Country of ref document: JP

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: MX/A/2013/004726

Country of ref document: MX

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2011319843

Country of ref document: AU

Date of ref document: 20111027

Kind code of ref document: A

REEP Request for entry into the european phase

Ref document number: 2011779531

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 2011779531

Country of ref document: EP