WO2011133105A1 - Novel allergen - Google Patents
Novel allergen Download PDFInfo
- Publication number
- WO2011133105A1 WO2011133105A1 PCT/SE2011/050503 SE2011050503W WO2011133105A1 WO 2011133105 A1 WO2011133105 A1 WO 2011133105A1 SE 2011050503 W SE2011050503 W SE 2011050503W WO 2011133105 A1 WO2011133105 A1 WO 2011133105A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- horse
- allergen
- equ
- allergy
- kda
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/35—Allergens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/08—Antiallergic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/57—Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2
- A61K2039/577—Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2 tolerising response
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2800/00—Detection or diagnosis of diseases
- G01N2800/24—Immunology or allergic disorders
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
- G01N33/6854—Immunoglobulins
Definitions
- the present invention relates to the field of allergy. More specifically, the invention relates to the identification of novel allergens from mammals and to diagnosis and treatment of allergy towards mammals.
- allergens hypersensitivity are known as allergens (Breiteneder et al. 1997). These include products of grasses, trees, weeds, animal dander, insects, food, drugs and chemicals.
- the antibodies involved in atopic allergy belong primarily to the immunoglobulin E isotype (IgE). IgE binds to basophils mast cells and dendritic cells via a specific high affinity receptor FceRI. Upon exposure to an allergen, allergen-specific IgE antibodies on the cell surface become cross linked leading to the release of inflammatory mediators such as histamine and leukotrienes resulting in physiological manifestations of allergy (Akdis 2006).
- Diagnostic tests for allergy involve the detection of IgE antibodies from patients with a specificity to proteins from an allergen source.
- an aqueous extract from the allergen source containing a mixture of proteins, is used in these tests.
- the allergenic proteins present in crude extract have only partly been identified and characterised.
- Diagnostic test procedures for detection of specific IgE antibodies in patients can either utilize an in vitro immunoassay using serum from the patient, or be a skin prick test (SPT), performed by topical application of the specific extract on the skin of the patient (Wainstein et al. 2007).
- allergens Apart from reducing symptoms of allergy by e. g. anti-histamines, more long-term and curative treatment of allergy can be performed with specific immunotherapy.
- Application of the disease causing allergenic extract most commonly either subcutaneously or sublingually, that causes a specific activation of a protective immune response to the allergenic proteins.
- a specific activation of the immune system alleviates the symptoms of allergy upon subsequent environmental exposure of the same allergen (Akdis et al. 2007).
- regular immunotherapy has been to use one or several purified allergenic proteins instead of a crude natural extract. Such immunotherapy has been successfully performed for grass pollen allergic patients (Jutel et al. 2005) and it has also been suggested for treating allergy against animal dander (Gronlund et al. 2009).
- Horse dander is an increasingly common cause of respiratory allergy (Liccardi et al. 201 1), with symptoms including rhinitis, conjunctivitis, bronchial inflammation and asthma.
- Occupational exposure to horse allergens is a significant risk factor for allergic sensitisation (Tutluoglu et al. 2002) but considerable concentrations of allergens can be detected also in other places such as schools (Kim et al. 2005).
- IgE sensitisation to horse dander was in one study shown to be associated with a high risk of developing asthma (Ronmark et al. 2003).
- Extracts of horse hair and dander contain a complexity of allergenic proteins and four horse allergens have so far been identified: Equ c 1 , Equ c 2, Equ c 3 and Equ c 4/5.
- the first two are both members of the lipocalin protein family and have been purified from their natural source (Dandeu et al. 1993; Goubran Botros et al. 1998) while only Equ c 1 has been expressed as a recombinant protein (Gregoire et al. 1996).
- the amino acid sequence of Equ c 1 is 67% similar to that of the cat allergen Fel d 4 (Smith et al. 2004).
- Equ c 3 horse serum albumin, is a relatively conserved protein showing extensive cross-reactivity to other mammalian albumins (Goubran Botros et al. 1996). Equ c 4/5, was first purified and reported as an IgE binding protein in horse dander (Goubran Botros et al. 1998; Goubran Botros et al. 2001) and only later identified as horse sweat latherin (McDonald et al. 2009).
- Equ c 1 is claimed to be the most important one of the known horse allergens (Dandeu et al. 1993) and IgE antibody recognition of the recombinant protein was present in 76% of a population of horse allergic subjects studied (Saarelainen et al. 2008). In another study using purified native allergens, only 33% of horse allergic patients were sensitized to Equ c 2 and 23% to Equ c 4/5 (Goubran Botros et al.
- a well designed laboratory immunoassay for specific IgE antibodies can detect most cases of sensitization to horse using natural horse dander extract.
- a miniaturized or non-laboratory immunoassay such as an allergen microarray or a doctor's office test
- the combination of less favourable assay conditions, lower capacity for antibody-binding allergen reagent and natural allergen extract of limited potency may cause insufficient diagnostic sensitivity.
- a similar situation may exist also for immunoassays for specific IgE to other animal epithelia.
- allergens may be useful not only as reagents for increased sensitivity in routine diagnostic tests, but also in different types of component-resolved
- Equ c 15k The novel horse protein, herein referred to as Equ c 15k, consists of one 5 kDa amino acid chain and one 10 kDa amino acid chain joined together by disulfide bridges. Considering the fact that the two polypeptide chains are encoded by separate genes, this study demonstrates the presence of a heterodimeric protein that has not previously been anticipated by bioinformatic studies of the horse genome. It is in all aspects distinct from previously known horse allergens. This allergen represents an important addition to the panel of known horse allergens and will be useful in the diagnosis of horse allergy.
- the present invention relates to an isolated horse allergen, Equ c 15k belonging to the secretoglobin family, showing an electrophoretic mobility (apparent molecular weight) corresponding to approximately 15 kDa under non-reducing conditions, and comprising a first peptide chain having a molecular weight in the order of 5 kDa and a second peptide chain having a molecular weight in the order of 10 kDa, linked together by one or more disulfide bonds.
- This aspect of the invention also comprises variants and fragments of Equ c 15k, sharing epitopes for antibodies therewith, such that the variants and fragments cross-react with such antibodies to at least about 50%.
- variants and fragments include, for example, related allergens from the same species. Also in the other aspects of the invention
- Equ c 15k is, for simplicity, used to also include such variants and fragments thereof.
- the invention relates to an isolated nucleic acid encoding the allergen according to the first-mentioned aspect, as well as to a vector containing the nucleic acid molecule, and to a host cell containing the vector. Recombinant proteins or peptides produced by such a vector-containing host cell may be glycosylated or not depending on the host cell used.
- the invention relates to the use of Equ c 15k for the manufacture of a composition for diagnosis of Type I allergy.
- the invention relates to an allergen composition "spiked" with Equ c 15k.
- an allergen composition may be an allergen extract or a mixture of purified or recombinant allergen components having no or a low Equ c 15k content, wherein Equ c 15k is added in order to bind IgE from patients whose IgE would not bind, or bind poorly, to the other allergen components in the composition.
- This aspect of the invention also relates to a method for producing such a composition, which method comprises the step of adding Equ c 15k to an allergen composition, such as an allergen extract (optionally spiked with other components) or a mixture of purified native or recombinant allergen components.
- the invention relates to an in vitro diagnostic method for diagnosing a Type I allergy in a patient, wherein a body fluid sample, such as a blood or serum sample from the patient, is brought into contact with Equ c 15k or a composition according to the previous aspect, whereby it can be determined whether or not the patient sample contains IgE antibodies that bind specifically to the Equ c 15k.
- a diagnostic method may be carried out in any manner known in the art.
- the Equ c 15k may e.g. be immobilized on a solid support, such as in a conventional laboratory immunoassay, in a microarray or in a lateral flow assay, or used as a fluid-phase reagent.
- the invention relates to a diagnostic kit for performing the method according to the previous aspect.
- the wildtype Equ c 15k molecule may, as mentioned above, be replaced with fragments or variants of Equ c 15k, natural or man-made, sharing epitopes for antibodies with the wildtype protein, as defined below.
- the invention further relates to a method of treatment of Type I allergy comprising administering to a patient in need of such treatment Equ c 15k or a modified Equ c 15k, as explained below.
- This aspect of the invention also relates to the use of the Equ c 15k in such immunotherapy, including e.g. component-resolved immunotherapy (Valenta et al. 2007).
- the Equ c 15k may be used in its natural form or in a recombinant form displaying
- Equ c 15k may be used in a modified form, generated chemically or genetically, in order to abrogate or attenuate its IgE antibody binding capacity, while preferably being capable of eliciting an IgG response in a treated individual.
- modifications include, but are not limited to, fragmentation, truncation, tandemerization or aggregation of the molecule, deletion of internal segment(s), substitution of amino acid residue(s), domain rearrangement, or disruption at least in part of the tertiary structure by disruption of disulfide bridges or its binding to another macromolecular structure, or other low molecular weight compounds.
- the individual 10 kDa and/ or 5 kDa subunits of Equ c 15k which display reduced IgE binding activity as compared to the intact molecule, are used as modified Equ c 15k.
- the Equ c 15k protein may be purified from its natural source, such as from urine, saliva or other body fluids, or from tissue, such as hair or dander, from horse. It may also, as mentioned above, be produced by recombinant DNA technology or chemically synthesized by methods known to a person skilled in the art.
- the invention also relates to the Equ c 15k for use in prophylactic or therapeutic treatment of Type 1 allergy, as well as in diagnosis.
- the allergenic horse protein described here belongs to the secretoglobin protein family, specifically one subfamily which comprises tetrameric proteins formed by two heterodimeric subunits.
- the heterodimer consists of two chains derived from different genes linked together by disulfide bridges (Klug et al. 2000).
- the horse secretoglobin described here is a 15 kDa heterodimer, herein referred to as Equ c 15k, consisting of a 5 ⁇ 2 kDa and a 10 ⁇ 2 kDa subunit, respectively, which for the purposes of this invention are referred to as the 5 and 10 kDa subunits, respectively.
- the molecular weight assignments are according to their apparent molecular weight as observed in SDS-PAGE, as described in Example 4 below. It is understood that the apparent molecular weights will vary depending on the separation conditions, including electrophoretic separation medium and concentration thereof, linear or gradient buffer used, etc. Also, the 10 kDa subunit contains an N-glycosylation site, the occupation of which by a glycan structure may affect the apparent molecular weight.
- the amino acid sequence of the 5 kDa chain has the predicted amino acid sequence ATCPAVATDIASFFLLPDSLFKLQLIKYQAPPEAKDATMQVKQCINEIS AGDRYIITETLGKIVLQCGA (SEQ ID NO: 4) and a theoretical molecular weight of 7.5 kDa.
- the amino acid sequence of the 10 kDa chain has the predicted amino acid sequence
- Variants and fragments of Equ c 15k should be construed as meaning proteins or peptides with a length of at least 10 amino acids, more preferably at least 40, even more preferably at least 50 or 60 amino acid residues of each chain in the heterodimer, and a sequence identity to said Equ c 15k of at least 50 %, preferably over 60 %, 70 %, 80 %, 90 % or 95 %.
- Equ c 15k should in the context of the present invention be construed as meaning an Equ c 15k variant that has been chemically or genetically modified to change its immunological properties, e.g. as exemplified above in relation to the immunotherapy aspect of the invention.
- Variants and fragments of Equ c 15k sharing epitopes for antibodies with Equ c 15k should be construed as being those fragments and variants whose binding of antibodies, such as IgE or IgG antibodies, from a serum sample from a
- Equ c 15k sensitized patient can be significantly inhibited by Equ c 15k.
- Such an inhibition assay may e.g. be performed according to the methods described by (Mattsson et al. 2009) (the disclosure of which is incorporated by reference herein).
- a hypoallergenic modified Equ c 15k or variant or fragment of Equ c 15k should be construed as being a modified Equ c 15k or variant or fragment of Equ c 15k that is not capable of binding Equ c 15k reactive IgE antibodies from a serum sample of a representative Equ c 15k sensitized patient, as determined e.g. by the protocol according to Example 7 below or which displays no or significantly reduced biological allergen activity, as determined by a cellular activation assay such as the basophil histamine release assay (Demoly et al. 2003; Ebo et al. 2004).
- Figure 1A shows the fractionation of horse dander proteins by size exclusion chromatography (SEC). Peaks A and B that were used for subsequent purification steps are indicated by arrows.
- Figure 1 B shows the purification of nEqu c 1 by hydrophobic interaction
- Figure 1C shows the purification of nEqu c 2 and Equ c 4/5 by hydrophobic interaction chromatography. Peaks E, F and G were used for subsequent
- Figure 1 D shows the purification of nEqu c 2 by anion exchange chromatography. Peaks H and I were used for subsequent analysis.
- Figure IE shows SDS-PAGE analysis of the purified proteins Equ c 1 forms A and B, Equ c 2 and Equ c 4/5 form 14 kDa and 19 kDa.
- Lane M contains molecular weight marker proteins with the molecular weight indicated to the left.
- Figure 2A compares the IgE binding of the two forms, A and B, of nEqu c 1 (from peak C and peak D respectively) using 35 horse dander reactive sera. Dotted lines indicate the 0.35 MJA/L cut-off level.
- Figure 2B compares the IgE binding of the 19 kDa and the 14 kDa forms of nEqu c 4/5 using 38 horse dander reactive sera. Dotted lines indicate the 0.35 MJA/L cutoff level.
- Figure 3 shows the purification of fractions used to search for novel IgE binding proteins.
- A Purification of fraction A by anion exchange chromatography.
- B Purification of fraction A by anion exchange chromatography.
- Figure 4 shows the purification of a 15 kDa horse dander protein.
- A Fractionation of horse dander extract by size exclusion chromatography. Peak A was used for subsequent purification steps.
- B Fractionation of peak A by hydrophobic
- Peak J pooled as indicated in the figure, was used for subsequent purification steps.
- C Fractionation of peak J by anion exchange chromatography. Peaks K and L were used for subsequent analysis and/ or further purification steps.
- D shows SDS-PAGE analysis reduced (Red) and non-reduced (Ox) samples of the purified 15 kDa horse dander protein. Lane M contains molecular weight marker proteins with the molecular weight indicated to the left.
- E Refining purification of peak K by reversed-phase chromatography. Peak M was used for subsequent immunological analysis.
- Figure 5 shows the predicted sequence of the 5 kDa and 10 kDa amino acid chains of nEqu c 15k. Amino acids identified by N-terminal sequencing are underlined and amino acids identified by MS/MS analysis are shown in bold.
- Figure 6 shows the IgE reactivity to nEqu c 15k in sera of two of the horse allergic patients (Nos. 3 and 12), as detected by immunoblotting.
- the first two strips show total protein stain and positions of the 5 and 10 kDa subunits and the 15 kDa protein, respectively, are indicated by arrows.
- the four strips to the right shows the IgE binding to reduced (Red) and non-reduced (Ox) samples of Equ c 15k.
- Figure 7 shows the correlation between the IgE reactivity of native and recombinant Equ c 15k.
- the 0.35 MJA/L and 0. 1 MJA/ L levels are indicated by dotted lines.
- Figure 8 shows levels of IgE antibodies to horse dander extract (HDE), Equ c 1 , nEqu c 2, nEqu c 3. nEqu c 4/5 and rEqu c 15k in a cohort of 25 horse dander allergic subjects. The number of observations below 0.1 kUA/L is indicated in brackets for each component. Dotted line indicates the 0.35 1 UA/ L level and solid line indicates the 0. 1 1 UA/ L level. Horizontal bars indicate median levels of IgE.
- HDE horse dander extract
- Figure 9 compares IgE antibody binding to nEqu c 15k and rFel d 1.
- the 0.35 MJA/ L and 0. 1 MJA/L levels are indicated by dotted lines.
- Figure 10 shows the ability of soluble Equ c 15k and Fel d 1 to self- and cross- inhibit IgE binding to immobilized Equ c 1 and Fel d 1.
- Sera from horse dander allergic patients labelled according to table 3
- horse dander sensitised subjects labelled A to E
- EXAMPLE 1 Purification and characterisation of known allergens from horse dander and serum
- Horse dander was used as a starting material for purification of Equ c 1 , Equ c 2 and Equ c 4/ 5 while Equ c 3 was purified from horse serum.
- MBS MOPS-buffered saline
- nEqu c 1 was subjected to sodium dodecyl sulfate polyacrylamide gel electrophoresis (SDS-PAGE) using the NuPAGE MES buffer system ( 10% NuPAGE gel, Invitrogen, Carlsbad, CA, USA) of a reduced sample prepared by mixing the sample 1 :3 with NuPAGE LDS sample buffer (Invitrogen) containing 100 mM ⁇ -mercaptoethanol. As an indication of apparent molecular weight the Mark 12TM standard (Invitrogen) was used. Both nEqu c 1 preparations were pure as judged by SDS-PAGE (Fig. IE).
- Equ c 1 The protein preparations was unambiguously identified as Equ c 1 by peptide mass fingerprinting (PMF) performed in a Bruker Daltonics Autoflex 2 instrument (Bruker Daltonics, Bremen, Germany) as described in (Mattsson et al. 2009).
- PMF peptide mass fingerprinting
- HIC hydrophobic interaction chromatography
- the two largest peaks were analysed by N- terminal sequencing (ProciseTM LC452, Applied Biosystems, Foster city CA, USA) and both had the sequence DQDPQSEDTY, identifying them as Equ c 2.0201 (Fig. 1 D peak H and I) .
- the peaks were pooled and immobilised to ImmunoCAPTM solid phase as described (Marknell DeWitt et al. 2002).
- HIC hydrophobic interaction chromatography
- nEqu c 4/ 5 were immobilized separately to ImmunoCAPTM solid phase as described (Marknell DeWitt et al. 2002).
- Native Equ c 3 was purified from horse serum by affinity chromatography using Blue Sepharose FF, (GE Healthcare Life Sciences), anion exchange chromatography (AIEC) and SEC essentially as described (van Eijk et al. 1999).
- Equation A and B The IgE binding activity of the two forms of Equ c 1 , named form A and B, was evaluated using a set of horse dander sensitized sera (obtained from an in-house serum collection.
- the two forms of Equ c 1 displayed equivalent IgE binding activity, as shown in Fig. 2A. Therefore only the values obtained with nEqu c 1 A were used in the analysis below.
- IgE antibody binding to the two forms of Equ c 4/5 were compared and found to be very similar, as shown in Fig. 2B.
- IgE antibody binding to horse dander extract and the purified horse allergens was examined using regular and experimental ImmunoCAPTM tests (Phadia, Uppsala, Sweden). Experimental ImmunoCAPTM tests were prepared as described above. A panel of 29 sera from horse dander sensitised individuals were used.
- Fraction A contained a 10 kDa band (reducing SDS-PAGE) obtained from an anion exchange purification step of Equ c 2 indicated by an arrow (Fig. 3A).
- Fractions B and C containing a 13 kDa and a 10 kDa band (reducing SDS-PAGE), respectively, were obtained from a HIC purification step of Equ c 1 and are indicated by arrows in Fig. 3B.
- Experimental ImmunoCAPTM (Phadia) tests were prepared as described (Marknell DeWitt et al. 2002) and used for serum analysis.
- the reduced 5 kDa and 10 kDa protein bands were analysed by N-terminal sequencing. Analysis of the 5 kDa band revealed the amino acid sequence ATxPAVATDIASFFLLPDSL (x: unresolved residue), matching residues 22-41 of the predicted Equus caballus sequence denoted "similar to LppAB" (Genbank Acc no XP_001502544) (SEQ ID NO: 1).
- Peptide mass fingerprinting (PMF) analysis by MALDI-TOF MS of in-gel trypsin digested 10 kDa band did not result in any significant match (p ⁇ 0.05) to known database entries.
- GSGCQLLEDWEK and TITAELSPAEYVEAVQEFIPDEATEK respectively, corresponding to residues 1 - 13 and 14-39 of SEQ ID NO: 5.
- Equ c 15k This protein is hereinafter referred to as Equ c 15k.
- the predicted full length sequences precursor sequences of the two chains of Equ c 15k are shown in Fig. 5 (5 kDa fragment - SEQ ID NO: 6; 10 kDa fragment - SEQ ID NO 7) where the amino acids identified by N-terminal sequencing are underlined and those identified by MS-MS analysis are shown in bold.
- the precursor sequence for the 5 kDa fragment includes an N- terminal signal peptide of 21 amino acids
- the precursor sequence for the 10 kDa fragment includes an N-terminal signal peptide of 18 amino acids.
- signal peptide prediction of the precursor sequence using SignalP results in the same mature sequences as those obtained experimentally for both the 5 kDa and 10 kDa chains.
- the SDS-PAGE analysis in Fig. 4D provides evidence that the 5 and 10 kDa amino acid chains are held together by one or more disulfide bridges under non-reducing conditions, thereby forming a heterodimeric protein.
- the analysis links together a gene encoding a the sequence SEQ ID No 4 with a different gene encoding SEQ ID No 5 that together make up a previously unknown heterodimeric secretoglobin protein.
- a synthetic Equ c 15k single chain gene was designed by combining nucleotide sequences encoding the amino acid sequences of the 5 kDa and the 10 kDa subunits with a sequence encoding a linker peptide comprising 3x (Gly-Gly-Gly-Gly- Ser).
- the full-length synthetic gene was cloned into the Ndel and Xhol sites of vector pET23a(+) (Novagen, Madison, WI, USA), adding a C-terminal hexahistidine tag to enable protein purification by immobilised metal ion affinity chromatography (IMAC).
- IMAC immobilised metal ion affinity chromatography
- the amino acid sequence for the whole recombinant protein is shown in SEQ ID NO: 8.
- the nucleotide sequence was designed for optimal codon usage in E. coli (DNA2.0, Menlo Park, OA, USA).
- the nucleic acid sequence encoding the whole recombinant protein is shown in SEQ ID NO: 9.
- the plasmid DNA construct was transformed into E. coli strain BL21 -AI (Invitrogen) and the recombinant Equ c 15k single chain protein was produced using a 3 -litre bioreactor (Belach Bioteknik, Solna, Sweden).
- harvested cells was resuspended in 20 mM Tris-HCl pH 8.0 and lysed by passing the suspension through an Emulsanderx C5 homogenizor (Avestin, Ottawa, Ontario, Canada) at 10 000- 15 000 kPa. After centrifugation of the suspension, the pelleted inclusion bodies were dissolved in 6 M Guanidine-HCl, 20 mM Tris pH 8.0, 0.5 M NaCl, 5 mM imidazol and filtered through 0.45 ⁇ mixed cellulose filters (Millipore). The filtered supernatant was applied to a Chelating Sepharose FF column (GE Healthcare Life Sciences), charged with NiS0 4 .
- Equ c 15k was immobilised to experimental ImmunoCAPTM and the IgE reactivity to sera from 36 horse dander sensitized subjects was determined as described (Marknell DeWitt et al. 2002).
- the levels of specific IgE antibodies to horse dander extract, nEqu c 1 , nEqu c 2, nEqu c 3 and nEqu c 4/5 and rEqu c 15k among the 25 horse allergic subjects were determined using ImmunoCAPTM (Fig. 8, Table 3). In Table 3, all ImmunoCAPTM levels are displayed as 1 UA/ L and the origin of each patient is indicated by ES (Spain) or SE (Sweden). Recorded allergic symptoms on exposure to horse are rhinitis (rhin), asthma (astm), urticaria (urt) or anaphylaxis (anaph).
- the corresponding relative concentration of IgE antibody to nEqu c 1 was 52%, whereas for nEqu c 2, nEqu c 3 and nEqu c 4/5 the relative concentrations were 35%, 69% and 9%, respectively, among sera specifically reactive to those allergens. Twenty-four of the 25 sera showed IgE antibody binding to horse dander extract. All of those sera showed binding to at least one of the five individual horse allergens tested. The sum of the IgE binding levels to the individual component matched or exceeded that to horse dander extract.
- Equ c 15k belongs to the secretoglobin protein family
- the immunological relationship to the major cat allergen, Fel d 1 which belongs to the same protein family, was investigated.
- Equ c 15k and Fel d 1 Eight sera displaying significant IgE antibody binding reactivity to both Fel d 1 and Equ c 15k were tested for cross-inhibition, using both rEqu c 15k and rFel d 1 on solid phase as well as nEqu c 15k and rFel d 1 as inhibitors at a final
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Immunology (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Molecular Biology (AREA)
- Engineering & Computer Science (AREA)
- Organic Chemistry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Microbiology (AREA)
- Biochemistry (AREA)
- Urology & Nephrology (AREA)
- Hematology (AREA)
- Biomedical Technology (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Zoology (AREA)
- Mycology (AREA)
- Toxicology (AREA)
- Epidemiology (AREA)
- Gastroenterology & Hepatology (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Biotechnology (AREA)
- Cell Biology (AREA)
- General Physics & Mathematics (AREA)
- Analytical Chemistry (AREA)
- Pathology (AREA)
- Food Science & Technology (AREA)
- Physics & Mathematics (AREA)
- Pulmonology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
Priority Applications (10)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP11772331.2A EP2560990B1 (en) | 2010-04-23 | 2011-04-26 | Novel allergen |
| JP2013506115A JP2013528364A (ja) | 2010-04-23 | 2011-04-26 | 新規のアレルゲン |
| DK11772331.2T DK2560990T3 (en) | 2010-04-23 | 2011-04-26 | Novel allergen |
| US13/642,259 US9164101B2 (en) | 2010-04-23 | 2011-04-26 | Allergen |
| AU2011243277A AU2011243277B2 (en) | 2010-04-23 | 2011-04-26 | Novel allergen |
| CN201180020467.7A CN103108883B (zh) | 2010-04-23 | 2011-04-26 | 新型变应原 |
| ES11772331.2T ES2592956T3 (es) | 2010-04-23 | 2011-04-26 | Nuevo Alérgeno |
| RU2012150039A RU2608494C2 (ru) | 2010-04-23 | 2011-04-26 | Новый аллерген |
| CA2794556A CA2794556C (en) | 2010-04-23 | 2011-04-26 | 15 kda secretoglobin horse allergen |
| US14/869,362 US9724407B2 (en) | 2010-04-23 | 2015-09-29 | Horse allergen and methods |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| SE1050406-6 | 2010-04-23 | ||
| SE1050406 | 2010-04-23 |
Related Child Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US13/642,259 A-371-Of-International US9164101B2 (en) | 2010-04-23 | 2011-04-26 | Allergen |
| US14/869,362 Division US9724407B2 (en) | 2010-04-23 | 2015-09-29 | Horse allergen and methods |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2011133105A1 true WO2011133105A1 (en) | 2011-10-27 |
Family
ID=44834387
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/SE2011/050503 Ceased WO2011133105A1 (en) | 2010-04-23 | 2011-04-26 | Novel allergen |
Country Status (10)
| Country | Link |
|---|---|
| US (2) | US9164101B2 (https=) |
| EP (1) | EP2560990B1 (https=) |
| JP (2) | JP2013528364A (https=) |
| CN (1) | CN103108883B (https=) |
| AU (1) | AU2011243277B2 (https=) |
| CA (1) | CA2794556C (https=) |
| DK (1) | DK2560990T3 (https=) |
| ES (1) | ES2592956T3 (https=) |
| RU (1) | RU2608494C2 (https=) |
| WO (1) | WO2011133105A1 (https=) |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2016013971A1 (en) | 2014-07-21 | 2016-01-28 | Phadia Ab | Novel allergen |
Family Cites Families (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| RU2285042C2 (ru) * | 2000-11-16 | 2006-10-10 | Альк-Абелло А/С | Новые мутантные аллергены |
| CN101588815B (zh) * | 2006-12-22 | 2013-10-23 | 法蒂亚公司 | 新前列腺激肽释放酶过敏原 |
-
2011
- 2011-04-26 EP EP11772331.2A patent/EP2560990B1/en active Active
- 2011-04-26 CA CA2794556A patent/CA2794556C/en active Active
- 2011-04-26 AU AU2011243277A patent/AU2011243277B2/en active Active
- 2011-04-26 ES ES11772331.2T patent/ES2592956T3/es active Active
- 2011-04-26 RU RU2012150039A patent/RU2608494C2/ru active
- 2011-04-26 CN CN201180020467.7A patent/CN103108883B/zh active Active
- 2011-04-26 US US13/642,259 patent/US9164101B2/en active Active
- 2011-04-26 DK DK11772331.2T patent/DK2560990T3/en active
- 2011-04-26 JP JP2013506115A patent/JP2013528364A/ja active Pending
- 2011-04-26 WO PCT/SE2011/050503 patent/WO2011133105A1/en not_active Ceased
-
2015
- 2015-09-29 US US14/869,362 patent/US9724407B2/en active Active
-
2016
- 2016-02-19 JP JP2016029444A patent/JP6280578B2/ja active Active
Non-Patent Citations (8)
Cited By (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2016013971A1 (en) | 2014-07-21 | 2016-01-28 | Phadia Ab | Novel allergen |
| CN106604929A (zh) * | 2014-07-21 | 2017-04-26 | 法迪亚股份有限公司 | 新型过敏原 |
| US10753946B2 (en) | 2014-07-21 | 2020-08-25 | Phadia Ab | Allergen |
| CN106604929B (zh) * | 2014-07-21 | 2021-11-05 | 法迪亚股份有限公司 | 新型过敏原 |
Also Published As
| Publication number | Publication date |
|---|---|
| EP2560990A4 (en) | 2013-11-27 |
| CN103108883A (zh) | 2013-05-15 |
| JP6280578B2 (ja) | 2018-02-14 |
| JP2016175891A (ja) | 2016-10-06 |
| CN103108883B (zh) | 2015-06-03 |
| EP2560990A1 (en) | 2013-02-27 |
| DK2560990T3 (en) | 2016-09-26 |
| US9164101B2 (en) | 2015-10-20 |
| CA2794556C (en) | 2018-12-04 |
| AU2011243277B2 (en) | 2014-01-16 |
| RU2608494C2 (ru) | 2017-01-18 |
| US20130045233A1 (en) | 2013-02-21 |
| ES2592956T3 (es) | 2016-12-02 |
| RU2012150039A (ru) | 2014-05-27 |
| JP2013528364A (ja) | 2013-07-11 |
| CA2794556A1 (en) | 2011-10-27 |
| US9724407B2 (en) | 2017-08-08 |
| US20160082101A1 (en) | 2016-03-24 |
| AU2011243277A1 (en) | 2012-10-25 |
| EP2560990B1 (en) | 2016-06-22 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US9274114B2 (en) | Prostate kallikrein allergen | |
| US9724407B2 (en) | Horse allergen and methods | |
| EP3171890B1 (en) | Novel allergen | |
| RU2592674C2 (ru) | Аллергены, полученные рекомбинантными способами |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| WWE | Wipo information: entry into national phase |
Ref document number: 201180020467.7 Country of ref document: CN |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 11772331 Country of ref document: EP Kind code of ref document: A1 |
|
| DPE1 | Request for preliminary examination filed after expiration of 19th month from priority date (pct application filed from 20040101) | ||
| WWE | Wipo information: entry into national phase |
Ref document number: 8382/DELNP/2012 Country of ref document: IN |
|
| ENP | Entry into the national phase |
Ref document number: 2794556 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 13642259 Country of ref document: US |
|
| ENP | Entry into the national phase |
Ref document number: 2013506115 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2011243277 Country of ref document: AU Date of ref document: 20110426 Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2011772331 Country of ref document: EP |
|
| ENP | Entry into the national phase |
Ref document number: 2012150039 Country of ref document: RU Kind code of ref document: A |