WO2011092473A1 - Novel compounds and their effects on feeding behaviour - Google Patents
Novel compounds and their effects on feeding behaviour Download PDFInfo
- Publication number
- WO2011092473A1 WO2011092473A1 PCT/GB2011/000110 GB2011000110W WO2011092473A1 WO 2011092473 A1 WO2011092473 A1 WO 2011092473A1 GB 2011000110 W GB2011000110 W GB 2011000110W WO 2011092473 A1 WO2011092473 A1 WO 2011092473A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- xaa
- pyy
- analogue
- group
- subject
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/575—Hormones
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/22—Hormones
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/04—Anorexiants; Antiobesity agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
- A61P3/10—Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
-
- B—PERFORMING OPERATIONS; TRANSPORTING
- B65—CONVEYING; PACKING; STORING; HANDLING THIN OR FILAMENTARY MATERIAL
- B65G—TRANSPORT OR STORAGE DEVICES, e.g. CONVEYORS FOR LOADING OR TIPPING, SHOP CONVEYOR SYSTEMS OR PNEUMATIC TUBE CONVEYORS
- B65G23/00—Driving gear for endless conveyors; Belt- or chain-tensioning arrangements
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/575—Hormones
- C07K14/57545—Neuropeptide Y
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- B—PERFORMING OPERATIONS; TRANSPORTING
- B65—CONVEYING; PACKING; STORING; HANDLING THIN OR FILAMENTARY MATERIAL
- B65G—TRANSPORT OR STORAGE DEVICES, e.g. CONVEYORS FOR LOADING OR TIPPING, SHOP CONVEYOR SYSTEMS OR PNEUMATIC TUBE CONVEYORS
- B65G2812/00—Indexing codes relating to the kind or type of conveyors
- B65G2812/02—Belt or chain conveyors
- B65G2812/02267—Conveyors having endless traction elements
- B65G2812/02277—Common features for chain conveyors
- B65G2812/02287—Driving means
- B65G2812/02306—Driving drums
- B65G2812/02316—Driving drums with means for assuring constant linear speed of chains
Definitions
- This application relates to the use of agents to control appetite, feeding, food intake, energy expenditure and calorie intake, particularly in the field of obesity.
- peripheral administration of peptide YY (hereinafter PYY), or an agonist thereof, to a subject results in decreased food intake, caloric intake, and appetite, and an alteration in energy metabolism.
- PYY or agonist thereof is preferably an N-terminally deleted PYY molecule PYY 3-36 NH 2 .
- the present invention is based on the discovery that analogues of PYY in which specific amino acid residues are deleted and/or substituted can also be administered to a subject in order to cause decreased food intake, decreased caloric intake, decreased appetite and an alteration in energy metabolism.
- the analogues of the present invention exhibit improved potency and/or longer duration of action and/or fewer side effects than native PYY.
- an analogue of PYY comprising an amino acid sequence represented by formula (I) Xaa 2 -Ile-Xaa 4 -Pro-Xaa 6 -Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Xaa l6 -Xaa 17 -Xaa 18 -Xaa 19 - Tyr-Xaa 2l -Xaa 22 -Ala-Leu-Xaa 25 -His-Tvr-Leu-Asn-Xaa 30 -Val-Thr-Arg-Gln-Arg-Tyr-NH 2
- Xaa 2 is selected from the group consisting of Pro and Gly;
- Xaa 4 is selected from the group consisting of Arg, His, Lys and Orn;
- Xaa 6 is selected from the group consisting of Asp, Glu, His, Lys, Ser, Thr and Val;
- Xaa 16 is selected from the group consisting of Asn, Asp, Gin and Glu;
- Xaa 17 is selected from the group consisting of He, Leu and Val;
- Xaa 18 is selected from the group consisting of Ala, Asn, Asp and Val;
- Xaa 19 is selected from the group consisting of Arg and His;
- Xaa 21 is selected from the group consisting of His, Phe, Trp and Tyr;
- Xaa 22 is selected from the group consisting of Ala, He, Leu and Val;
- Xaa 25 is selected from the group consisting of Arg, Gin and His;
- Xaa 30 is selected from the group consisting of Arg, His, Leu and Lys; or a compound that is a variant and/or derivative thereof; or a salt and/or solvate thereof, including a salt of such a variant and/or derivative, and a solvate of such a variant and/or derivative and/or salt, a variant being an amino acid sequence having up to two amino acids other than Xaa 2 , Xaa 4 , Xaa 6 , Xaa 16 , Xaa 17 , Xaa 18 , Xaa 19 , Xaa 21 , Xaa 22 , Xaa 25 and Xaa 30 replaced with a different amino acid.
- an analogue of PYY according to the invention for use as a medicament.
- a pharmaceutical composition comprising an analogue of PYY according to the invention together with a pharmaceutically acceptable carrier and optionally other therapeutic ingredients.
- an analogue of PYY according to the invention or a pharmaceutical composition comprising an analogue of PYY according to the invention, for use in the reduction of appetite in a subject, for use in the reduction of food intake in a subject, or for use in the reduction of calorie intake in a subject.
- a method for treating a disease or disorder or other non-desired physiological state comprising subcutaneous administration of an analogue of PYY according to the invention, or a pharmaceutical composition comprising an analogue of PYY according to the invention.
- a method for treating a metabolic disorder in the subject in need thereof comprising administering to the subject an analogue of PYY according to the invention, or a pharmaceutical composition comprising an analogue of PYY according to the invention.
- an analogue of PYY according to the invention for the manufacture of a medicament for the treatment of a metabolic disorder.
- FIG 1 shows the amino acid sequence of PYY analogues of the invention (Analogue
- Figures 2 to 6 show the results of animal feeding studies described in Examples 2 to 6.
- Figures 7 and 8 show the results of rat pharmacokinetic studies described in Example 7a.
- Figure 9 shows the results of animal feeding studies described in Example 8.
- Figures 10 to 13 show the results of animal feeding studies described in Example 9.
- Figure 14 shows the results of animal feeding studies described in Example 10.
- Figures 15 to 26 show the results of in vitro solubility experiments described in Example
- Figure 27 shows the results of rat pharmacokinetic studies described in Example 12.
- Figure 28 onwards show the results of rat pharmacokinetic studies described in Example
- Animal Living multi-cellular vertebrate organisms, a category that includes, for example, mammals and birds.
- mammal includes both human and non-human mammals.
- subject includes both human and veterinary subjects.
- Appetite A natural desire, or longing for food.
- appetite is measured by a survey to assess the desire for food. Increased appetite generally leads to increased feeding behavior.
- appetite suppressants Compounds that decrease the desire for food.
- Commercially available appetite suppressants include, but are not limited to,
- amfepramone diethylpropion
- phentermine mazindol and phenylpropanolamine fenfluramine, dexfenfluramine, and fluoxetine.
- Body Mass Index A mathematical formula for measuring body mass, also sometimes called Quetelet's Index. BMI is calculated by dividing weight (in kg) by height 2 (in meters 2 ). The current standards for both men and women accepted as "normal" are a BMI of 20-24.9 kg/m 2 . In one embodiment, a BMI of greater than 25 kg/m can be used to identify an obese subject. Grade I obesity corresponds to a BMI of 25-29.9 kg/m 2 .
- Grade II obesity corresponds to a BMI of 30-40 kg/m ; and Grade III obesity corresponds to a BMI greater than 40 kg/m 2 (Jequier, Am. J Clin. Nutr. 45:1035-47, 1987).
- Ideal body weight will vary among species and individuals based on height, body build, bone structure, and sex.
- Conservative substitutions The replacement of an amino acid residue by another, biologically similar residue in a polypeptide.
- the term "conservative variation” also includes the use of a substituted amino acid, i.e. an amino with one or more atoms replaced with another atom or group, in place of a parent amino acid provided that antibodies raised to the substituted polypeptide also immunoreact with the unsubstituted polypeptide.
- Diabetes A failure of cells to transport endogenous glucose across their membranes either because of an endogenous deficiency of insulin and/or a defect in insulin sensitivity. Diabetes is a chronic syndrome of impaired carbohydrate, protein, and fat metabolism owing to insufficient secretion of insulin or to target tissue insulin resistance.
- IDDM insulin-dependent diabetes mellitus
- NIDDM non-insulin dependent diabetes mellitus
- Diabetes type I or insulin dependent diabetes mellitus (IDDM) is caused by the destruction of ⁇ cells, which results in insufficient levels of endogenous insulin.
- IDDM insulin dependent diabetes mellitus
- Diabetes type II or non-insulin dependent diabetes, results from a defect in both the body' s sensitivity to insulin, and a relative deficiency in insulin production.
- Food intake The amount of food consumed by an individual.
- Food intake can be measured by volume or by weight.
- food intake may be the total amount of food consumed by an individual.
- food intake may be the amount of proteins, fat, carbohydrates, cholesterol, vitamins, minerals, or any other food component, of the individual.
- Protein intake refers to the amount of protein consumed by an individual.
- fat intake “carbohydrate intake,” “cholesterol intake,” “vitamin intake,” and “mineral intake” refer to the amount of proteins, fat, carbohydrates, cholesterol, vitamins, or minerals consumed by an individual.
- Hyperpolarization A decrease in the membrane potential of a cell. Inhibitory neurotransmitters inhibit the transmission of nerve impulses via hyperpolarization. This hyperpolarization is called an inhibitory postsynaptic potential (IPSP). Although the threshold voltage of the cell is uncharged, a hyperpolarized cell requires a stronger excitatory stimulus to reach threshold.
- IIPSP inhibitory postsynaptic potential
- a normal daily diet can be expressed in terms of caloric intake, protein intake, carbohydrate intake, and/or fat intake.
- a normal daily diet in humans generally comprises the following: about 2,000, about 2,400, or about 2,800 to significantly more calories.
- a normal daily diet in humans generally includes about 12 g to about 45 g of protein, about 120 g to about 610 g of carbohydrate, and about 11 g to about 90 g of fat.
- a low calorie diet would be no more than about 85%, and preferably no more than about 70%, of the normal caloric intake of a human individual.
- the caloric and nutrient requirements vary depending on the species and size of the animal.
- cal/kg day About 30% to about 40% should be protein, about 7% to about 10% should be from carbohydrate, and about 50% to about 62.5% should be derived from fat intake.
- One of skill in the art can readily identify the normal daily diet of an individual of any species.
- Obesity A condition in which excess body fat may put a person at health risk (see Barlow and Dietz, Pediatrics 102:E29, 1998; National Institutes of Health, National Heart, Lung, and Blood Institute (NHLBI), Obes. Res. 6 (suppl. 2):51 S-209S, 1998). Excess body fat is a result of an imbalance of energy intake and energy expenditure. For example, the Body Mass Index (BMI) may be used to assess obesity. In one commonly used convention, a BMI of 25.0 kg/m 2 to 29.9 kg/m 2 is overweight, while a BMI of 30 kg/m 2 or greater is obese.
- BMI Body Mass Index
- waist circumference is used to assess obesity.
- men a waist circumference of 102 cm or more is considered obese, while in women a waist circumference of 89 cm or more is considered obese.
- Strong evidence shows that obesity affects both the morbidity and mortality of individuals.
- an obese individual is at increased risk for heart disease, non-insulin dependent (type 2) diabetes, hypertension, stroke, cancer (e.g. endometrial, breast, prostate, and colon cancer), dyslipidemia, gall bladder disease, sleep apnea, reduced fertility, and osteoarthritis, amongst others (see Lyznicki et al., Am. Fam. Phys. 63:2185, 2001).
- Overweight An individual who weighs more than their ideal body weight.
- An overweight individual can be obese, but is not necessarily obese.
- an overweight individual is any individual who desires to decrease their weight.
- an overweight individual is an individual with a BMI of 25.0 kg/m 2 to 29.9 kg/m 2
- Pegylated and pegylation the process of reacting a poly(alkylene glycol), preferably an activated poly(alkylene glycol) to form a covalent bond.
- a facilitator may be used, for example an amino acid, e.g. lysine.
- pi is an abbreviation for isoelectric point.
- IEP is the pH at which a particular molecule carries no net electric charge. At a pH below its pi a protein or peptide carries a net positive charge. At a pH above its pi a protein or peptide carries a net negative charge.
- PYY PYY
- the term PYY as used herein refers to a peptide YY polypeptide, a hormone secreted into the blood by cells lining the lower small intestine (the ileum) and the colon.
- Naturally occurring wild type PYY sequences for various species are shown in Table 1. Table 1 : PYY sequence of various species
- Pipid frog Xenopus tropicalis
- YPIKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY [SEQ ID NO.: 15] Atlantic salmon (Salmo salar)
- YPPKPENPGEDAPPEELAKYYTALRHYINLITRQRY [SEQ ID NO.: 16]
- Cattle (bos taurus)
- YP AKPQAPGEHASPDELNRYYTSLRHYLNLVTRQRF SEQ ID NO. : 17]
- Peripheral Administration Administration outside of the central nervous system.
- Peripheral administration does not include direct administration to the brain.
- Peripheral administration includes, but is not limited to intravascular, intramuscular, subcutaneous, inhalation, oral, rectal, transdermal or intra-nasal administration.
- Polypeptide A polymer in which the monomers are amino acid residues which are joined together through amide bonds. When the amino acids are alpha-amino acids, either the L- optical isomer or the D-optical isomer can be used, the L-isomers being preferred.
- the terms "polypeptide” or "protein” as used herein encompass any amino acid sequence and include modified sequences such as glycoproteins, The term “polypeptide” is specifically covers naturally occurring proteins, as well as those which are recombinantly or synthetically produced.
- polypeptide fragment refers to a portion of a polypeptide, for example a fragment which exhibits at least one useful sequence in binding a receptor.
- Subcutaneous administration is administration of a substance to the subcutaneous layer of fat which is found between the dermis of the skin and the underlying tissue. Subcutaneous administration may be by an injection using a hypodermic needle fitted, for example, to a syringe or a "pen" type injection device. Other administration methods may be used for example microneedles. Injection with a hypodermic needle typically involves a degree of pain on behalf of the recipient. Such pain may be masked by use of a local anaesthetic or analgesic. However, the usual method used to reduce the perceived pain of injections is to merely distract the subject
- compositions having a pH of between pH4 and pHIO are usually regarded as tolerably comfortable.
- Therapeutically effective amount A dose sufficient to prevent advancement, or to cause regression of a disorder, or which is capable of relieving a sign or symptom of a disorder, or which is capable of achieving a desired result.
- a dose sufficient to prevent advancement, or to cause regression of a disorder, or which is capable of relieving a sign or symptom of a disorder, or which is capable of achieving a desired result.
- a dose sufficient to prevent advancement, or to cause regression of a disorder, or which is capable of relieving a sign or symptom of a disorder, or which is capable of achieving a desired result.
- a desired result In several embodiments, a
- therapeutically effective amount of a compound of the invention is an amount sufficient to inhibit or halt weight gain, or an amount sufficient to decrease appetite, or an amount sufficient to reduce caloric intake or food intake or increase energy expenditure.
- an analogue of PYY comprising an amino acid sequence represented by formula (I)
- Xaa 2 is selected from the group consisting of Pro and Gly;
- Xaa 4 is selected from the group consisting of Arg, His, Lys and Orn;
- Xaa 6 is selected from the group consisting of Asp, Glu, His, Lys, Ser, Thr and Val;
- Xaa 16 is selected from the group consisting of Asn, Asp, Gin and Glu;
- Xaa 17 is selected from the group consisting of He, Leu and Val;
- Xaa 18 is selected from the group consisting of Ala, Asn, Asp and Val;
- Xaa 19 is selected from the group consisting of Arg and His;
- Xaa 21 is selected from the group consisting of His, Phe, Trp and Tyr;
- Xaa is selected from the group consisting of Ala, He, Leu and Val;
- Xaa 25 is selected from the group consisting of Arg, Gin and His;
- Xaa 30 is selected from the group consisting of Arg, His, Leu and Lys; or a compound that is a variant and/or derivative thereof; or a salt and/or solvate thereof, including a salt of such a variant and/or derivative, and a solvate of such a variant and/or derivative and/or salt, a variant being an amino acid sequence having up to two amino acids other than Xaa , Xaa 4 , Xaa 6 , Xaa 16 , Xaa 17 , Xaa 18 , Xaa 19 , Xaa 21 , Xaa 22 , Xaa 25 and Xaa 30 replaced with a different amino acid.
- the PYY analogues of the invention comprise a sequence in which Xaa is Pro or Gly. According to certain embodiments Xaa 2 is Pro. According to other embodiments Xaa 2 is Gly.
- Xaa is Pro.
- the PYY analogues of the invention comprise an amino acid sequence in which Xaa 4 is selected from the group consisting of Arg, His, Lys and Orn.
- Xaa 4 is selected from the group consisting of His and Lys.
- Xaa 4 is His.
- Xaa 4 is Lys.
- Xaa 6 is selected from the group consisting of Asp, Glu, His, Lys, Ser, Thr and Val.
- Xaa 6 is selected from the group consisting of His, Ser and Glu or from the group consisting of His, Ser, Glu and Val, or from the group consisting of His and Val.
- Xaa 6 is His.
- Xaa is Val.
- Xaa is selected from the group consisting of Ser and Glu.
- Xaa 6 is Ser.
- Xaa 6 is Glu.
- Xaa is selected from the group consisting of Asn, Asp, Gin and Glu.
- Xaa is selected from the group consisting of Gin and Glu.
- Xaa 16 is Gin.
- Xaa 16 is Glu.
- Xaa is selected from the group consisting of He, Leu and Val.
- Xaa is selected from the group consisting of He and Leu.
- Xaa is He. In other embodiments, Xaa is Leu.
- Xaa is selected from the group consisting of Ala, Asn, Asp and Val.
- Xaa is selected from the group consisting of Ala, Asn and Val. More preferably, Xaa 18 is selected from the group consisting of Asn and Val. In some embodiments of the invention, Xaa 18 is Asn. In other embodiments, Xaa 18 is Val.
- Xaa 19 is selected from the group consisting of Arg and His. In some embodiments of the invention, Xaa 19 is Arg. In other embodiments, Xaa 19 is His.
- Xaa is selected from the group consisting of His, Phe, Trp and Tyr.
- Xaa is selected from the group consisting of His, Phe and Tyr.
- Xaa 21 is selected from the group consisting of Phe and Tyr. In some embodiments of the invention, Xaa 21 is Phe. In other embodiments, Xaa 21 is Tyr.
- Xaa 22 is selected from the group consisting of Ala, lie, Leu and Val. Preferably, Xaa 22 is selected from the group consisting of Ala and lie. In some embodiments of the invention, Xaa 22 is Ala. In other embodiments, Xaa 22 is lie.
- Xaa is selected from the group consisting of Arg, Gin and His.
- Xaa is selected from the group consisting of Arg and His.
- Xaa 25 is Arg. In other embodiments, Xaa 25 is His.
- Xaa 30 is selected from the group consisting of Arg, His, Leu and Lys.
- Xaa 30 is selected from the group consisting of His, Lys and Leu. More preferably, Xaa 30 is selected from the group consisting of His and Lys.
- Xaa is His. In other embodiments, Xaa 30 is Lys.
- Xaa 2 is Pro
- Xaa 4 is selected from the group consisting of His and Lys
- Xaa 16 is selected from the group consisting of Gin and Glu
- Xaa 17 is selected from the group consisting of He and Leu
- Xaa 21 is selected
- Xaa 17 is selected from the group consisting of He and Leu
- Xaa 18 is selected from the group consisting of Val and Asn
- Xaa 21 is selected from the group consisting of Phe and Tyr
- Aaa 22 is selected from the group consisting of He and Ala. The residues at other positions may be as described above.
- Xaa 2 is Pro
- Xaa 4 is selected from the group consisting of His and Lys
- Xaa 16 is Glu
- Xaa 17 is selected from the group consisting of He and Leu
- Xaa 21 is selected from the group consisting of His, Phe and Tyr
- Xaa is selected from the group consisting of Ala and He.
- Xaa 2 is Pro
- Xaa 4 is selected from the group consisting of His and Lys
- Xaa 16 is Glu
- Xaa 17 is selected from the group consisting of He and Leu
- Xaa 21 is selected from the group consisting of His
- Phe and Tyr is selected from the group consisting of Ala and He
- Xaa 25 is Arg.
- Xaa 2 is Pro
- Xaa 4 is Lys
- Xaa 6 is selected from the group consisting of Glu and Ser
- Xaa 16 is Glu
- Xaa 17 is Leu
- Xaa 18 is Asn
- Xaa 21 is Tyr
- Xaa 22 is Ala
- Xaa 25 is Arg
- Xaa 30 is selected from the group consisting of His, Leu and Lys.
- Xaa 2 is Pro
- Xaa 4 is Lys
- Xaa 6 is selected from the group consisting of Glu and Ser
- Xaa 16 is Glu
- Xaa 17 is Leu
- Xaa 18 is Asn
- Xaa 19 is His
- Xaa 21 is Tyr
- Xaa 22 is Ala
- Xaa 25 is Arg
- Xaa 30 is selected from the group consisting of His, Leu and Lys.
- Xaa 2 is Pro
- Xaa 4 is Lys
- Xaa 6 is selected from the group consisting of Glu and Ser
- Xaa 16 is Glu
- Xaa 17 is Leu
- Xaa 18 is Asn
- Xaa 19 is His
- Xaa 21 is Tyr
- Xaa 22 is Ala
- Xaa 25 is Arg
- Xaa 30 is His.
- Xaa 2 is Pro
- Xaa 4 is Lys
- Xaa 6 is Glu
- Xaa 16 is Glu
- Xaa 17 is Leu
- Xaa 18 is Asn
- Xaa 19 is His
- Xaa 21 is Tyr
- Xaa 22 is Ala
- Xaa 2 is Pro
- Xaa 4 is selected from the group consisting of His and Lys
- Xaa 16 is selected from the group consisting of Gin and Glu
- Xaa 17 is selected from the group consisting of lie and Leu
- Xaa 21 is selected from the group consisting of His, Phe and Tyr
- Xaa 22 is selected from the group consisting of Ala and He
- Xaa is His.
- Xaa 2 is Pro
- Xaa 4 is selected from the group consisting of His and Lys
- Xaa 16 is selected from the group consisting of Gin and Glu
- Xaa 17 is selected from the group consisting of He and Leu
- Xaa 19 is His
- Xaa 21 is selected from the group consisting of His
- Phe and Tyr is selected from the group consisting of Ala and He
- Xaa 30 is His.
- Xaa 2 is Pro
- Xaa 4 is His
- Xaa 16 is selected from the group consisting of Gin and Glu
- Xaa 17 is selected from the group consisting of He and Leu
- Xaa 19 is His
- Xaa 21 is selected from the group consisting of His
- Phe and Tyr is selected from the group consisting of Ala and He
- Xaa 30 is His.
- Xaa 2 is Pro
- Xaa 4 is His
- Xaa 6 is His
- Xaa 16 is selected from the group consisting of Gin and Glu
- Xaa 17 is selected from the group consisting of lie and Leu
- Xaa 19 is His
- Xaa 21 is selected from the group consisting of His
- Phe and Tyr is selected from the group consisting of Ala and He
- Xaa 30 is His.
- Xaa 2 is Pro
- Xaa 4 is His
- Xaa 6 is His
- Xaa 16 is Glu
- Xaa 17 is selected from the group consisting of He and Leu
- Xaa 19 is His
- Xaa 21 is selected from the group consisting of His
- Phe and Tyr
- Xaa 22 is selected from the group consisting of Ala and He
- Xaa 25 is Arg
- Xaa 30 is His.
- Xaa 2 is Pro
- Xaa 4 is His
- Xaa 6 is His
- Xaa 16 is Glu
- Xaa 17 is lie
- Xaa 19 is His
- Xaa 21 is selected from the group consisting of His
- Phe and Tyr
- Xaa is selected from the group consisting of Ala and He
- Xaa 25 is Arg
- Xaa 30 is His.
- Xaa 2 is Pro
- Xaa 4 is His
- Xaa 6 is His
- Xaa 16 is Glu
- Xaa 17 is He
- Xaa 18 is Val
- Xaa 19 is His
- Xaa 21 is selected from the group consisting of His
- Phe and Tyr
- Xaa 22 is selected from the group consisting of Ala and He
- Xaa 25 is Arg
- Xaa 30 is His.
- Xaa 2 is Pro
- Xaa 4 is His
- Xaa 6 is His
- Xaa 16 is Glu
- Xaa 17 is He
- Xaa 18 is Val
- Xaa 19 is His
- Xaa 21 is Phe
- Xaa 22 is selected from the group consisting of Ala and He
- Xaa 25 is Arg
- Xaa 30 is His.
- Xaa 2 is Pro
- Xaa 4 is His
- Xaa 6 is His
- Xaa 16 is Glu
- Xaa 17 is He
- Xaa 18 is Val
- Xaa 19 is His
- Xaa 21 is Phe
- Xaa 22 is He
- Xaa 25 is Arg
- Xaa 30 is His.
- PYY analogues of the formula (I) include, but are not limited to, the PYY analogues specifically described in the Examples and figures herein.
- Compounds according to the present invention preferably have a more sustained effect on food intake reduction or have a stronger effect on food intake reduction than human PYY.
- Increased duration of appetite suppression can be particularly important to avoid the effect known as "escape".
- a short duration of appetite suppressant may reduce appetite or the time covered by one meal and in that meal the subject typically eats less food.
- the appetite suppressant is then metabolized or otherwise removed from circulation as a subject then by the time the next meal the subject can regain its "normal" appetite.
- the subject may in fact have an increased appetite at the time of the second meal. If the subject satisfies that appetite it is possible for the food intake over the two meals in total to be no lower than the food intake would have been without the appetite suppressant. That is to say, the subject may have "escaped” from the effects of the appetite suppressant. "Escape” can be reduced by using additional doses of appetite suppressant or by using an appetite suppressant with a longer duration of action. If the subject has a reduced appetite for longer, then the degree to which it can make up the deficit from one meal in the next meal is reduced and as there is a practical limit to total capacity in a particular single meal.
- the compounds of the invention are selective for the Y2 receptor. That is say, they bind with a higher affinity to Y2 compared with other receptors such as Yl, Y3, Y4, Y5 and Y6. Those receptors are recognized based on binding affinity, pharmacology and sequence. Most, if not all, of the receptors are G protein coupled receptors.
- the Yl receptor is generally considered to be postsynaptic and alleviates many of the known actions of neuropeptide Y in the periphery.
- this receptor was described as having poor affinity for C-terminal fragments of neuropeptide Y, such as the 13-36 fragment, but interacts with the full length neuropeptide Y and peptide YY with equal affinity (see PCT publication WO 93/09227).
- the Y2 receptor is distinguished from Yl by exhibiting affinity for C- terminal fragments of neuropeptide Y.
- the Y2 receptor is most often differentiated by the affinity of neuropeptide Y(13-36), although the 3-36 fragment of neuropeptide Y and peptide YY provides improved affinity and selectivity (see Dumont et al, Society for Neuroscience Abstracts 19:726, 1993).
- Signal transmission through both the Yl and the Y2 receptors are coupled to the inhibition of adenylate cyclase. Binding to the Y2 receptor was also found to reduce the intracellular levels of calcium in the synapse by selective inhibition of N-type calcium channels.
- the Y2 receptor like the Yl receptors, exhibits differential coupling to second messengers (see U.S. Patent No. 6,355,478).
- Y2 receptors are found in a variety of brain regions, including the hippocampus, substantia nigra-lateralis, thalamus, hypothalamus, and brainstem.
- the human, murine, monkey and rat Y2 receptors have been cloned (e.g., see U.S. Patent No. 6,420,352 and U.S. Patent No. 6,355,478).
- An analogue of PYY according to the invention has preferably no overall ionic charge in solution (i.e., in a solution approximating to physiological conditions, such as, for example, those found in the tissue fluid or plasma). It is hypothesised that an absence of net charge under in vivo conditions limits its in vivo solubility and that this contributes to a slower absorption after subcutaneous administration of a high concentration peptide and thus prolonged presence in the circulation.
- analogues of PYY 3-36 NH 2 contain at least one of the amino acids corresponding to positions 4, 6, 19, 21, 25 or 30 in the native PYY 3-36 NH 2 molecule substituted for histidine. More preferably, more than one substitution to histidine is made. According to certain embodiments 2, 3 or 4 of the amino acid residues at positions 4, 6, 19, 21, 25 and 30 of the native PYY 3-36 NH 2 sequence are substituted for histidine residues. Preferably the total number of resultant histidine residues in the sequence of the claimed analogue is at least 2.
- histidine is a unique amino acid in being not charged at pH 7.4 (i.e. under physiological conditions in the circulation or subcutaneously following subcutaneous administration). However, it is fully charged at pH 5 (or lower) since the pi of the NH side chain of histidine is about 6.0. According to certain preferred embodiments an analogue of PYY according to the invention has low or no overall charge at
- physiological pH pH 7.4 and is preferably formulated as part of a composition having a pH of about pH5 (for example from pH4.5 to pH6.0 - a lower pH than approximately pH 4 or 5 may be undesirable for an injectable composition because it is likely to increase pain at the injection site) so as to exhibit histidine ionisation and preferably an overall net change at such a lower pH.
- An increase in the number of charged residues increases the solubility of an injectable composition in the vial and therefore allows a small volume injection of a relatively concentrated peptide solution to be given.
- the analogue is exposed to physiological pH at which the number of ionised residues and especially the number of ionised histidine residues falls and therefore solubility decreases. This causes the peptide to precipitate subcutaneously. The presence of His residues enhances this effect.
- P YY analogues according to the invention have a combination of the following preferred features:
- a peptide sequence which at pH 7.4 has no net charge and may have relatively few charged groups and hydrophilic groups overall to decrease intrinsic solubility.
- the differential solubility of peptides containing histidine residues is greatly enhanced if formulated together with zinc ions. This is because zinc ions will bind to uncharged histidine residues in aqueous solution. It is believed that zinc ions are able to bind simultaneously to up to 4 uncharged histidines. This allows zinc to co-ordinate with histidine residues in several individual peptide molecules and thereby weakly cross-link the peptide molecule to other similar peptide molecules leading to a fall in solubility. However, zinc ions do not bind to charged histidine.
- histidine containing peptides in a composition containing zinc ions will be cross-linked by weak ionic bonds at pH 7.4 but not at pH 5.0.
- the presence of His residues bound to zinc ions therefore enhances precipitation of the peptide after subcutaneous injection but does not affect solubility in the vial or syringe before administration.
- a peptide having an overall pi of approximately 7 will have no charged residues at approximately neutral pH and a peptide comprising histidine residues in a formulation including zinc ions is advantageously soluble in the vial or syringe but precipitates subcutaneously following administration.
- a pH7 neutral peptide with histidines in a formulation including zinc ions is advantageously soluble in the vial and syringe but precipitates subcutaneously following administration. Furthermore, zinc- enhanced precipitation is gradually reversible because the concentration of zinc ions following injection will fall as zinc ions are gradually washed out of the injection site. Therefore there is observed a delay in subcutaneous absorption with much better pharmacokinetics but no loss of bio-availability. The rate of absorption for a given histidine-containing neutral peptide can be controlled by the amount of zinc added.
- the PYY analogues of the invention having at least one occurrence of two histidine residues separated from each other by 1 to 3 intervening amino acid residues (a pair of histidine residues). Such a spacing appears to be optimum for a single zinc ion to form in aqueous solution associations with both histidine residues in a pair.
- the amino acids at both positions 4 and 6 of the native PYY 3-36 NH 2 sequence are substituted for a histidine residue.
- both of the histidine residues of a pair are artificially introduced with 1 intervening amino acid residue therebetween.
- amino acid at position 30 of the native PYY 3-36 N3 ⁇ 4 sequence is substituted for a histidine residue.
- one of the histidine residues of a pair (at position 26) is naturally present and the other histidine residue of the pair (at position 30) is artificially introduced.
- an analogue according to the invention has an overall pi of between 6.5 and 8.5. More preferably between 7.0 and 8.0, more preferably between 7.1 and 7.7, more preferably between 7.2 and 7.6, more preferably the analogue has an overall pi of approximately 7.4. This means that at physiological pH the analogue has no significant overall charge.
- the overall pi of a molecule may be calculated using techniques well known to a person skilled in the art or alternatively may be determined experimentally by using isoelectric focussing.
- Peptide sequence which at pH 7.4 has no net charge and relatively few charged groups and relatively few hydrophilic groups overall so as to decrease intrinsic solubility.
- Variants include PYY analogues of the invention comprising an amino acid sequence represented by formula (I) having up to two amino acids (e.g. 0, 1 or 2) other than Xaa 2 , Xaa 4 , Xaa 6 , Xaa 16 , Xaa 17 , Xaa 18 , Xaa 19 , Xaa 21 , Xaa 22 , Xaa 25 and Xaa 30 replaced with a different amino acid (e.g., conservative substitutions and non-conservative substitutions; see, e.g., Table 2 below) which retain at least some of the activity of a corresponding non- variant molecule when in a molecule of the invention.
- formula (I) having up to two amino acids (e.g. 0, 1 or 2) other than Xaa 2 , Xaa 4 , Xaa 6 , Xaa 16 , Xaa 17 , Xaa 18 , Xaa 19 ,
- conservative substitutions are the replacements, for one another, among the aliphatic amino acids Ala, Val, Leu and He; interchange of Ser and Thr containing hydroxy residues, interchange of the acidic residues Asp and Glu, interchange between the amide residues Asn and Gin, interchange of the basic residues Lys and Arg, interchange of the aromatic residues Phe and Tyr, and interchange of the small-sized amino acids Ala, Ser, Thr, Met and Gly.
- Guidance concerning how to make phenotypically silent amino acid substitutions, ie substitutions that do not alter the expressed phenotype, is provided in Bowie et al., Science 247: 1306-1310, 1990. Table 2: Non-limiting examples of conservative amino acid substitutions
- Variants further include PYY analogues in which up to two amino acids (e.g. 0, 1 or 2) other than Xaa 2 , Xaa 4 , Xaa 6 , Xaa 16 , Xaa 17 , Xaa ]S , Xaa 19 , Xaa 21 , Xaa 22 , Xaa 25 and Xaa 30 are replaced with an amino acid present at the equivalent position in PYY derived from a species other than human.
- the sequences of PYYs of various species are included in Table 1 above.
- a compound of the invention may comprise the structure of formula (I) modified by well known processes including amidation, glycosylation, carbamylation, acylation, for example acetylation, sulfation, phosphylation, cyclization, lipidization and pegylation.
- the structure of formula (I) may be modified at random positions within the molecule, or at predetermined positions within the molecule and may include one, two, three or more attached chemical moieties.
- a compound of the invention may be a fusion protein, whereby the structure of formula (I) is fused to another protein or polypeptide (the fusion partner) using recombinant methods known in the art. Alternatively, such a fusion protein may be synthetically synthesized by any known method.
- Such a fusion protein comprises the structure of formula (I).
- Any suitable peptide or protein can be used as the fusion partner (e.g., serum albumin, carbonic anhydrase, glutathione-S-transferase or thioredoxin, etc.).
- Preferred fusion partners will not have an adverse biological activity in vivo.
- Such fusion proteins may be made by linking the carboxy-terminus of the fusion partner to the amino-terminus of the structure of formula (I) or vice versa.
- a cleavable linker may be used to link the structure of formula (I) to the fusion partner.
- a resulting cleavable fusion protein may be cleaved in vivo such that an active form of a compound of the invention is released.
- cleavable linkers include, but are not limited to, the linkers D-D-D-D-Y [SEQ ID NO.: 44], G-P-R, A-G-G and H-P-F-H-L [SEQ ID NO.: 45], which can be cleaved by enterokinase, thrombin, ubiquitin cleaving enzyme and renin, respectively. See, e.g., U.S. Patent No. 6,410,707.
- a compound of the invention may be a physiologically functional derivative of the structure of formula (I).
- physiologically functional derivative is used herein to denote a chemical derivative of a compound of formula (I) having the same physiological function as the corresponding unmodified compound of formula (I).
- a physiologically functionally derivative may be convertible in the body to a compound of formula (I).
- examples of physiologically functional derivatives include esters, amides, and carbamates; preferably esters and amides.
- esters and amides of the compounds of the invention may comprise a C ) -2 o alkyl-, C 2- 2o alkenyl-, Cs-io aryl-, Cs-io ar-Ci -20 alkyl-, or amino acid-ester or -amide attached at an appropriate site, for example at an acid group.
- suitable moieties are hydrophobic substiruents with 4 to 26 carbon atoms, preferably 5 to 19 carbon atoms.
- Suitable lipid groups include, but are not limited to, the following:
- lipidised derivative is relatively labile in the cells and thus facilitates intracellular release of the molecule from the fatty acid moieties.
- Suitable lipid-containing moieties are hydrophobic substituents with 4 to 26 carbon atoms, preferably 5 to 19 carbon atoms.
- Suitable lipid groups include, but are not limited to, the following: palmityl (C] 5 H 31 ,), oleyl (Ci 5 H 2 ), stearyl (Ci 7 H 35 ), cholate; and deoxycholate.
- Cyclization methods include cyclization through the formation of a disulfide bridge and head-to-tail cyclization using a cyclization resin.
- Cyclized peptides may have enhanced stability, including increased resistance to enzymatic degradation, as a result of their conformational constraints. Cyclization may in particular be expedient where the uncyclized peptide includes an N-terminal cysteine group.
- Suitable cyclized peptides include monomeric and dimeric head-to-tail cyclized structures. Cyclized peptides may include one or more additional residues, especially an additional cysteine incorporated for the purpose of formation of a disulfide bond or a side chain incorporated for the purpose of resin-based cyclization.
- a compound of the invention may be a pegylated structure of formula (I).
- Pegylated compounds of the invention may provide additional advantages such as increased solubility, stability and circulating time of the polypeptide, or decreased immunogenicity (see U.S. Patent No. 4,179,337).
- Chemical moieties for derivitization of a compound of the invention may also be selected from water soluble polymers such as polyethylene glycol, ethylene glycol/propylene glycol copolymers, carboxymethylcellulose, dextran, polyvinyl alcohol and the like.
- a polymer moiety for derivatisation of a compound of the invention may be of any molecular weight, and may be branched or unbranched.
- the preferred molecular weight of a polyethylene glycol for derivatisation of a compound of the invention is from about 1 kDa to about 100 kDa, the term "about" indicating that in preparations of polyethylene glycol, some molecules will weigh more, some less, than the stated molecular weight.
- Polymers of other molecular weights may be used, depending on the desired therapeutic profile, for example the duration of sustained release desired, the effects, if any on biological activity, the ease in handling, the degree or lack of antigenicity and other known effects of the polyethylene glycol to a therapeutic protein or analog.
- the polyethylene glycol may have an average molecular weight of about 200, 500, 1000, 1500, 2000, 2500, 3000, 3500, 4000, 4500, 5000, 5500, 6000, 6500, 7000, 7500, 8000, 8500, 9000, 9500, 10,000, 10,500, 11,000, 1 1,500, 12,000, 12,500, 13,000, 13,500, 14,000, 14,500, 15,000, 15,500, 16,000, 16,500, 17,000, 17,500, 18,000, 18,500, 19,000, 19,500, 20,000, 25,000, 30,000, 35,000, 40,000, 50,000, 55,000, 60,000, 65,000, 70,000, 75,000, 80,000, 85,000, 90,000, 95,000, or 100,000 kDa.
- Salts and solvates of compounds of the invention that are suitable for use in a medicament are those wherein a counterion or associated solvent is pharmaceutically acceptable.
- salts and solvates having non-pharmaceutically acceptable counterions or associated solvents are within the scope of the present invention, for example, for use as intermediates in the preparation of the compounds of formula (I) and their
- Suitable salts according to the invention include those formed with organic or inorganic acids or bases.
- Pharmaceutically acceptable acid addition salts include those formed with hydrochloric, hydrobromic, sulphuric, nitric, citric, tartaric, acetic, phosphoric, lactic, pyruvic, acetic, trifluoroacetic, succinic, perchloric, fumaric, maleic, glycollic, lactic, salicylic, oxaloacetic, methanesulfonic, ethanesulfonic, p-toluenesulfonic, formic, benzoic, malonic, naphthalene-2-sulfonic, benzenesulfonic, and isethionic acids.
- compositions of the invention include ammonium salts, alkali metal salts, for example potassium and sodium salts, alkaline earth metal salts, for example calcium and magnesium salts, and salts with organic bases, for example dicyclohexylamine and N-methyl-D-glucomine.
- the invention provides a pharmaceutical composition
- a pharmaceutical composition comprising a compound of formula (I) together with a pharmaceutically acceptable carrier and optionally other therapeutic ingredients, together with related methods.
- the pharmaceutical composition is present in a syringe or other administration device for subcutaneous administration to humans.
- the invention further provides the compound of formula (I) or a variant, derivative, salt or solvate thereof for use as a medicament.
- the invention also provides a compound of formula (I) or a variant, derivative, salt or solvate thereof, or a pharmaceutical composition comprising a compound of formula (I), for use in the treatment of obesity or diabetes.
- the invention further provides a compound of formula (I), or a pharmaceutical composition comprising a compound of formula (I), for use in reduction of appetite in a subject, for use in reduction of food intake in a subject, or for use in reduction of calorie intake in a subject.
- the invention further provides the use of a compound of formula (I) or a variant, derivative, salt or solvate thereof for the manufacture of a medicament for the treatment of a metabolic disorder, for example a disorder of energy metabolism such as obesity or diabetes, pre-diabetes or impaired glucose tolerance.
- a metabolic disorder for example a disorder of energy metabolism such as obesity or diabetes, pre-diabetes or impaired glucose tolerance.
- the invention also provides the use of a compound of formula (I) or a variant, derivative salt or solvate thereof for the manufacture of a medicament for reducing appetite in a subject, reducing food intake in a subject, or reducing calorie intake in a subject.
- the invention further provides a method of treating a metabolic disorder, for example a disorder of energy metabolism such as obesity or diabetes, pre-diabetes or impaired glucose tolerance in a subject in need thereof comprising administering to the subject an effective amount of a compound of formula (I) or a variant, derivative, salt or solvate thereof, or a pharmaceutical composition comprising a compound of formula (I).
- a metabolic disorder for example a disorder of energy metabolism such as obesity or diabetes, pre-diabetes or impaired glucose tolerance in a subject in need thereof comprising administering to the subject an effective amount of a compound of formula (I) or a variant, derivative, salt or solvate thereof, or a pharmaceutical composition comprising a compound of formula (I).
- the invention also provides a method of reducing appetite in a subject, reducing food intake in a subject, or reducing calorie intake in a subject, comprising administering to the subject an effective amount of a compound of formula (I), or a pharmaceutical composition comprising a compound of formula (I).
- the subject to whom the compound is administered may be overweight, for example, obese.
- the subject may be diabetic, for example having insulin resistance or glucose intolerance, or both.
- the subject may have diabetes mellitus, for example, the subject may have Type II diabetes.
- the subject may be overweight, for example, obese and have diabetes mellitus, for example, Type II diabetes.
- the subject may have, or may be at risk of having, a disorder in which obesity or being overweight is a risk factor.
- cardiovascular disease for example hypertension, atherosclerosis, congestive heart failure, and dyslipidemia
- stroke gallbladder disease
- osteoarthritis sleep apnea
- reproductive disorders for example, polycystic ovarian syndrome
- cancers for example breast, prostate, colon, endometrial, kidney, and esophagus cancer
- varicose veins for example
- acnthosis nigricans eczema
- exercise intolerance insulin resistance
- hypertension hypercholesterolemia cholithiasis
- osteoarthritis orthopedic injury
- insulin resistance for example, type 2 diabetes and syndrome X
- thromboembolic disease see Kopelman, Nature 404:635-43; Rissanen et al., British Med. J. 301 , 835, 1990).
- obesity is a recognized risk factor for increased incidence of complications of general anesthesia. (See e. g.,
- Other diseases or disorders associated with obesity are birth defects, maternal obesity being associated with increased incidence of neural tube defects, carpal tunnel syndrome (CTS); chronic venous insufficiency (CVI); daytime sleepiness; deep vein thrombosis (DVT); end stage renal disease (ESRD); gout; heat disorders; impaired immune response; impaired respiratory function; infertility; liver disease; lower back pain; obstetric and gynecologic complications; pancreatititis; as well as abdominal hernias; acanthosis nigricans; endocrine abnormalities; chronic hypoxia and hypercapnia; dermatological effects; elephantitis; gastroesophageal reflux; heel spurs; lower extremity edema;
- mammegaly which causes considerable problems such as bra strap pain, skin damage, cervical pain, chronic odors and infections in the skin folds under the breasts, etc.; large anterior abdominal wall masses, for example abdominal panniculitis with frequent panniculitis, impeding walking, causing frequent infections, odors, clothing difficulties, low back pain; musculoskeletal disease; pseudo tumor cerebri (or benign intracranial hypertension), and sliding hiatil hernia.
- the present invention further provides a method for increasing energy expenditure in a subject.
- the method includes, for example, peripherally administering a therapeutically effective amount of a compound of the invention to the subject, thereby altering energy expenditure.
- Energy is burned in all physiological processes.
- the body can alter the rate of energy expenditure directly, by modulating the efficiency of those processes, or changing the number and nature of processes that are occurring. For example, during digestion the body expends energy moving food through the bowel, and digesting food, and within cells, the efficiency of cellular metabolism can be altered to produce more or less heat.
- the method of the invention involves manipulation of the arcuate circuitry, that alter food intake coordinately and reciprocally alter energy expenditure.
- Energy expenditure is a result of cellular metabolism, protein synthesis, metabolic rate, and calorie utilization.
- administration of a compound of formula (I) or a variant, derivative salt or solvate thereof results in increased energy expenditure, and decreased efficiency of calorie utilization.
- the invention also provides a method for improving a lipid profile in a subject.
- the invention also provides a method for alleviating a condition or disorder that can be alleviated by reducing nutrient availability.
- Appetite can be measured by any means known to one of skill in the art.
- decreased appetite can be assessed by a psychological assessment.
- administration of a compound of the invention results in a change in perceived hunger, satiety, and/or fullness.
- Hunger can be assessed by any means known to one of skill in the art.
- hunger is assessed using psychological assays, such as by an assessment of hunger feelings and sensory perception using a questionnaire, such as, but not limited to, a Visual Analog Score (VAS) questionnaire.
- VAS Visual Analog Score
- appetite is assessed by answering questions relating to desire for food, drink, prospective food consumption, nausea, and perceptions relating to smell or taste.
- a compound of the invention may be used for weight control and treatment, for example reduction or prevention of obesity, in particular any one or more of the following:
- a compound of the invention may be used in the control of any one or more of appetite, satiety and hunger, in particular any one or more of the following: reducing, suppressing and inhibiting appetite; inducing, increasing, enhancing and promoting satiety and sensations of satiety; and reducing, inhibiting and suppressing hunger and sensations of hunger.
- a compound of the invention may be used in maintaining any one or more of a desired body weight, a desired Body Mass Index, a desired appearance and good health.
- a subject may be a subject who desires weight loss, for example female and male subjects who desire a change in their appearance.
- a subject may desire decreased feelings of hunger, for example the subject may be a person involved in a lengthy task that requires a high level of concentration, for example soldiers on active duty, air traffic controllers, or truck drivers on long distance routes, etc.
- the present invention may also be used in treating, prevention, ameliorating or alleviating conditions or disorders caused by, complicated by, or aggravated by a relatively high nutrient availability.
- condition or disorder which can be alleviated by reducing caloric (or nutrient) availability is used herein to denote any condition or disorder in a subject that is either caused by, complicated by, or aggravated by a relatively high nutrient availability, or that can be alleviated by reducing nutrient availability, for example by decreasing food intake.
- Subjects who are insulin resistant, glucose intolerant, or have any form of diabetes mellitus, for example, type 1 , 2 or gestational diabetes can also benefit from methods in accordance with the present invention.
- Conditions or disorders associated with increased caloric intake include, but are not limited to, insulin resistance, glucose intolerance, obesity, diabetes, including type 2 diabetes, eating disorders, insulin-resistance syndromes, and Alzheimer's disease.
- a compound of formula (I) or a variant, derivative, salt or solvate thereof is preferably used in the treatment of a human.
- the compounds of the invention will typically be used to treat human subjects they may also be used to treat similar or identical conditions in other vertebrates for example other primates; farm animals for example swine, cattle and poultry; sport animals for example horses; companion animals for example dogs and cats.
- compositions While it is possible for the active ingredient to be administered alone, it is preferable for it to be present in a pharmaceutical formulation or composition. Accordingly, the invention provides a pharmaceutical formulation comprising a compound of formula (I), or a variant or derivative thereof, or a salt or solvate thereof, as defined above and a pharmaceutically acceptable excipient.
- Pharmaceutical compositions of the invention may take the form of a pharmaceutical formulation as described below.
- the pharmaceutical formulations according to the invention include those suitable for oral, parenteral (including subcutaneous, intradermal, intramuscular, intravenous, and intraarticular), inhalation (including fine particle dusts or mists which may be generated by means of various types of metered does pressurized aerosols, nebulizers or insufflators), rectal and topical (including dermal, transdermal, transmucosal, buccal, sublingual, and intraocular) administration, although the most suitable route may depend upon, for example, the condition and disorder of the recipient.
- the formulations may conveniently be presented in unit dosage form and may be prepared by any of the methods well known in the art of pharmacy. All methods include the step of bringing the active ingredient into association with the carrier which constitutes one or more accessory ingredients. In general the formulations are prepared by uniformly and intimately bringing into association the active ingredient with liquid carriers or finely divided solid carriers or both and then, if necessary, shaping the product into the desired formulation.
- Formulations of the present invention suitable for oral administration may be presented as discrete units such as capsules, cachets or tablets each containing a predetermined amount of the active ingredient; as a powder or granules; as a solution or a suspension in an aqueous liquid or a non-aqueous liquid; or as an oil-in-water liquid emulsion or a water-in- oil liquid emulsion.
- the active ingredient may also be presented as a bolus, electuary or paste.
- Various pharmaceutically acceptable carriers and their formulation are described in standard formulation treatises, e.g., Remington's Pharmaceutical Sciences by E. W.
- a tablet may be made by compression or moulding, optionally with one or more accessory ingredients.
- Compressed tablets may be prepared by compressing in a suitable machine the active ingredient in a free-flowing form such as a powder or granules, optionally mixed with a binder, lubricant, inert diluent, lubricating, surface active or dispersing agent.
- Moulded tablets may be made by moulding in a suitable machine a mixture of the powdered compound moistened with an inert liquid diluent.
- the tablets may optionally be coated or scored and may be formulated so as to provide slow or controlled release of the active ingredient therein.
- the present compounds can, for example, be administered in a form suitable for immediate release or extended release. Immediate release or extended release can be achieved by the use of suitable pharmaceutical compositions comprising the present compounds, or, particularly in the case of extended release, by the use of devices such as subcutaneous implants or osmotic pumps.
- the present compounds can also be administered liposomally.
- compositions according to the invention are suitable for subcutaneous administration, for example by injection.
- the composition may contain metal ion for example copper, iron, aluminium, zinc, nickel or cobalt ions. The presence of such ions may limit solubility and thus delay absorption into the circulatory system from the site of subcutaneous administration.
- the composition contains zinc ions. Zinc ions may be present at any suitable concentration for example at a molar ratio to peptide molecules of 10:1 to 1 : 10, 8:1 to 1 :8, 5: 1 to 1 :5, 4: 1 to 1 :4, 3:1 to 1 :3, 2: 1 to 1 :2 or 1 :1.
- compositions for oral administration include suspensions which can contain, for example, microcrystalline cellulose for imparting bulk, alginic acid or sodium alginate as a suspending agent, methylcellulose as a viscosity enhancer, and sweeteners or flavoring agents such as those known in the art; and immediate release tablets which can contain, for example, microcrystalline cellulose, dicalcium phosphate, starch, magnesium stearate and/or lactose and/or other excipients, binders, extenders, disintegrants, diluents and lubricants such as those known in the art.
- the compounds of formula (I) or variant, derivative, salt or solvate thereof can also be delivered through the oral cavity by sublingual and/or buccal administration.
- Molded tablets, compressed tablets or freeze- dried tablets are exemplary forms which may be used.
- Exemplary compositions include those formulating the present compound(s) with fast dissolving diluents such as mannitol, lactose, sucrose and/or cyclodextrins. Also included in such formulations may be high molecular weight excipients such as celluloses (avicel) or polyethylene glycols (PEG).
- Such formulations can also include an excipient to aid mucosal adhesion such as hydroxypropyl cellulose (HPC), hydroxypropyl methyl cellulose (HPMC), sodium carboxy methyl cellulose (SCMC), maleic anhydride copolymer (e.g., Gantrez), and agents to control release such as polyacrylic copolymer (e.g. Carbopol 934).
- HPC hydroxypropyl cellulose
- HPMC hydroxypropyl methyl cellulose
- SCMC sodium carboxy methyl cellulose
- maleic anhydride copolymer e.g., Gantrez
- agents to control release such as polyacrylic copolymer (e.g. Carbopol 934).
- Lubricants, glidants, flavors, coloring agents and stabilizers may also be added for ease of fabrication and use.
- Formulations for parenteral administration include aqueous and non-aqueous sterile injection solutions which may contain anti-oxidants, buffers, bacteriostats and solutes which render the formulation isotonic with the blood of the intended recipient; and aqueous and non-aqueous sterile suspensions which may include suspending agents and thickening agents.
- the formulations may be presented in unit-dose or multi-dose containers, for example sealed ampoules and vials, and may be stored in a freeze-dried (lyophilised) condition requiring only the addition of the sterile liquid carrier, for example saline or water-for-injection, immediately prior to use.
- compositions for parenteral administration include injectable solutions or suspensions which can contain, for example, suitable nontoxic, parenterally acceptable diluents or solvents, such as mannitol, 1,3-butanediol, water, Ringer's solution, an isotonic sodium chloride solution, or other suitable dispersing or wetting and suspending agents, including synthetic mono- or diglycerides, and fatty acids, including oleic acid, or Cremaphor.
- suitable nontoxic, parenterally acceptable diluents or solvents such as mannitol, 1,3-butanediol, water, Ringer's solution, an isotonic sodium chloride solution, or other suitable dispersing or wetting and suspending agents, including synthetic mono- or diglycerides, and fatty acids, including oleic acid, or Cremaphor.
- An aqueous carrier may be, for example, an isotonic buffer solution at a pH of from about 3.0 to about 8.0, preferably at a pH of from about 3.5 to about 7.4, for example from 3.5 to 6.0, for example from 3.5 to about 5.0.
- Useful buffers include sodium citrate-citric acid and sodium phosphate-phosphoric acid, and sodium acetate/acetic acid buffers.
- the composition preferably does not include oxidizing agents and other compounds that are known to be deleterious to PYY and related molecules. Excipients that can be included are, for instance, other proteins, such as human serum albumin or plasma preparations.
- the pharmaceutical composition may also contain minor amounts of non-toxic auxiliary substances, such as wetting or emulsifying agents, preservatives, and pH buffering agents and the like, for example sodium acetate or sorbitan monolaurate.
- compositions for nasal aerosol or inhalation administration include solutions in saline, which can contain, for example, benzyl alcohol or other suitable preservatives, absorption promoters to enhance bioavailability, and/or other solubilizing or dispersing agents such as those known in the art.
- saline which can contain, for example, benzyl alcohol or other suitable preservatives, absorption promoters to enhance bioavailability, and/or other solubilizing or dispersing agents such as those known in the art.
- a suitable propellant e.g., dichlorodifluoro-methane, trichlorofluoromethane
- the dosage unit can be determined by providing a valve to deliver a metered amount.
- Capsules and cartridges of e.g., gelatin for use in an inhaler or insufflator can be formulated to contain a powder mix of the compound and a suitable powder base, for example lactose or starch.
- a compound of the invention is administered as an aerosol from a metered dose valve, through an aerosol adapter also known as an actuator.
- a stabilizer is also included, and/or porous particles for deep lung delivery are included (e.g., see U.S. Patent No. 6,447,743).
- Formulations for rectal administration may be presented as a retention enema or a suppository with the usual carriers such as cocoa butter, synthetic glyceride esters or polyethylene glycol. Such carriers are typically solid at ordinary temperatures, but liquefy and/or dissolve in the rectal cavity to release the drug.
- Formulations for topical administration in the mouth include lozenges comprising the active ingredient in a flavoured basis such as sucrose and acacia or tragacanth, and pastilles comprising the active ingredient in a basis such as gelatin and glycerine or sucrose and acacia.
- exemplary compositions for topical administration include a topical carrier such as Plastibase (mineral oil gelled with polyethylene).
- Preferred unit dosage formulations are those containing an effective dose, as hereinbefore recited, or an appropriate fraction thereof, of the active ingredient.
- the formulations of this invention may include other agents conventional in the art having regard to the type of formulation in question, for example those suitable for oral administration may include flavouring agents.
- the compounds of the invention are also suitably administered as sustained-release systems.
- sustained-release systems of the invention include suitable polymeric materials, for example semi-permeable polymer matrices in the form of shaped articles, e.g., films, or mirocapsules; suitable hydrophobic materials, for example as an emulsion in an acceptable oil; or ion exchange resins; and sparingly soluble derivatives of the compound of the invention, for example, a sparingly soluble salt.
- Sustained-release systems may be administered orally; rectally; parenterally; intracistemally; intravaginally; intraperitoneally; topically, for example as a powder, ointment, gel, drop or transdermal patch; bucally; or as an oral or nasal spray.
- Preparations for administration can be suitably formulated to give controlled release of compounds of the invention.
- the pharmaceutical compositions may be in the form of particles comprising one or more of biodegradable polymers, polysaccharide jellifying and/or bioadhesive polymers, amphiphilic polymers, agents capable of modifying the interface properties of the particles of the compound of formula (I). These compositions exhibit certain biocompatibility features which allow a controlled release of the active substance. See U.S. Patent No. 5,700,486.
- a compound of the invention may be delivered by way of a pump (see Langer, supra; Sefton, CRC Crit. Ref. Biomed Eng. 14:201 , 1987; Buchwald et al., Surgery 88:507, 1980; Saudek et al., N. Engl. J. Med. 321 :574, 1989) or by a continuous subcutaneous infusions, for example, using a mini-pump.
- An intravenous bag solution may also be employed.
- the key factor in selecting an appropriate dose is the result obtained, as measured by decreases in total body weight or ratio of fat to lean mass, or by other criteria for measuring control or prevention of obesity or prevention of obesity-related conditions, as are deemed appropriate by the practitioner.
- compounds of the invention are delivered by way of an implanted pump, described, for example, in U.S. Patent No. 6,436,091 ; U.S. Patent No. 5,939,380; U.S. Patent No. 5,993,414.
- Implantable drug infusion devices are used to provide patients with a constant and long term dosage or infusion of a drug or any other therapeutic agent. Essentially such device may be categorized as either active or passive.
- a compound of the present invention may be formulated as a depot preparation. Such a long acting depot formulation can be administered by implantation, for example subcutaneously or intramuscularly; or by intramuscular injection.
- the compounds can be formulated with suitable polymeric or hydrophobic materials, for example as an emulsion in an acceptable oil; or ion exchange resins; or as a sparingly soluble derivatives, for example, as a sparingly soluble salt.
- a therapeutically effective amount of a compound of the invention may be administered as a single pulse dose, as a bolus dose, or as pulse doses administered over time.
- a bolus administration of a compound of the invention is provided, followed by a time period wherein no a compound of the invention is administered to the subject, followed by a second bolus administration.
- pulse doses of a compound of the invention are administered during the course of a day, during the course of a week, or during the course of a month.
- a therapeutically effective amount of a compound of the invention is administered with a therapeutically effective amount of another agent, for example an additional appetite suppressant, a food-intake-reducing, plasma glucose-lowering or plasma lipid-altering agent.
- an additional appetite suppressant include amfepramone (diethylpropion), phentermine, mazindol and phenylpropanolamine, fenfluramine, dexfenfluramine, and fluoxetine.
- the compound of the invention can be administered simultaneously with the additional appetite suppressant, or it may be administered sequentially.
- the compound of the invention is formulated and administered with an appetite suppressant as a single dose.
- a compound of the invention may be administered whenever the effect, e.g., appetite suppression, decreased food intake, or decreased caloric intake, is desired, or slightly before to whenever the effect is desired, such as, but not limited to about 10 minutes, about 15 minutes, about 30 minutes, about 60 minutes, about 90 minutes, or about 120 minutes, before the time the effect is desired.
- the effect e.g., appetite suppression, decreased food intake, or decreased caloric intake
- slightly before to whenever the effect is desired such as, but not limited to about 10 minutes, about 15 minutes, about 30 minutes, about 60 minutes, about 90 minutes, or about 120 minutes, before the time the effect is desired.
- a therapeutically effective amount of a compound of the invention will be dependent on the molecule utilized, the subject being treated, the severity and type of the affliction, and the manner and route of administration.
- a therapeutically effective amount of a compound of the invention may vary from about 0.01 ⁇ per kilogram (kg) body weight to about 1 g per kg body weight, for example about 0.1 ⁇ g to about 20 mg per kg body weight, for example about 1 ⁇ g to about 5 mg per kg body weight, or about 5 ⁇ g to about 1 mg per kg body weight.
- a compound of the invention may be administered to a subject at from 5 to 1000 nmol per kg bodyweight, for example at from 10 to 750 nmol per kg bodyweight, for example at from 20 to 500 nmol per kg bodyweight, in particular at from 30 to 240 nmol per kg bodyweight.
- doses correspond to dosages of from 375 nmol to 75 ⁇ , for example from 750nmol to 56.25 ⁇ ⁇ , for example from 1.5 to 37.5 ⁇ , in particular from 2.25 to 18 ⁇ .
- a compound of the invention may be administered to a subject at 0.5 to 135 picomole (pmol) per kg body weight, for example 5 to 100 picomole (pmol) per kg body weight, for example 10 to 90 picomole (pmol) per kg body weight, for example about 72 pmol per kg body weight.
- a compound of the invention is administered in a dose of about 1 nmol or more, 2 nmol or more, or 5 nmol or more.
- the dose of the compound of the invention is generally not more than 100 nmol, for example, the dose is 90 nmols or less, 80 nmols or less, 70 nmols or less, 60 nmols or less, 50 nmols or less, 40 nmols or less, 30 nmols or less, 20 nmols or less, 10 nmols.
- a dosage range may comprise any combination of any of the specified lower dose limits with any of the specified upper dose limits.
- examples of non-limiting dose ranges of compounds of the invention are within the range of from 1 to 100 nmols, from 2 to 90 mols, from 5 to 80 nmols.
- nmol of a compound of the invention is administered, for example about 2 to about 20 nmol, for example about 10 nmol is administered as a subcutaneous injection.
- the exact dose is readily determined by one of skill in the art based on the potency of the specific compound utilized, the route of delivery of the compound and the age, weight, sex and physiological condition of the subject.
- Suitable doses of compounds of the invention also include those that result in a reduction in calorie intake, food intake, or appetite, or increase in energy expenditure that is equivalent to the reduction in calorie intake, food intake, or appetite, or to increase the energy expenditure, caused by the normal postprandial level of PYY.
- Examples of doses include, but are not limited to doses that produce the effect demonstrated when the serum levels of PYY are from about 40 pM to about 60 pM, or from about 40 pM to about 45 pM, or about 43 pM.
- the doses discussed above may be given, for example, once, twice, three-times or four- times a day. Alternatively, they may be give once every 2, 3 or 4 days. In a slow release formulation containing zinc, it may be possible to give a dose once every 3, 6, 7, 8, 9, 10, 11 , 12, 13, 14, 15, 16, 17, 18, 19, 20 or 21 days. According to certain embodiments they may be administered once shortly before each meal to be taken.
- analogue of PYY has an amino acid sequence given in one of the specific sequences set out in Figure 1.
- the invention is illustrated by the following non-limiting Examples.
- Peptides were made by a standard automated fluorenylmethoxycarbonyl (Fmoc) solid phase peptide synthesis (SPPS) method. Peptide synthesis was carried out on a tryclic amide linker resin. Amino acids were attached using the Fmoc strategy. Each amino acid was added sequentially from the C- to the N-termini. Peptide couplings were mediated by the reagent TBTU. Peptide cleavage from the resin was achieved with trifluoracetic acid in the presence of scavengers. Native PYY 3-36 NH 2 is obtained as described previously (WO03/026591); de novo synthesis using tryclic amide resin and Fmoc chemistry is also possible.
- Fmoc fluorenylmethoxycarbonyl
- SPPS solid phase peptide synthesis
- NPYR200000 Missouri S&T cDNA resource centre
- Morgan DG Lambert PD
- Smith DM Wilding JPH & Bloom SR.
- mice were individually housed in IVC cages. Animals were randomised into treatment groups, with stratification by body weight. Mice were fasted overnight (16hrs) prior to peptide or vehicle administration. All peptide solutions were prepared freshly,
- Figure 1 shows the amino acid sequences of example ⁇ analogues of the invention (Analogue Nos. 1-19), the result of binding experiments, and the results of experiments in which the appetite suppressant effects in mice of compounds of the invention have been compared with human PYY 3-36 NH 2 .
- the first column contains the Analogue number, and the second column contains a Reference number. Subsequent columns show the amino acid sequence of each example PYY analogue.
- the column headed "Binding Ratio" shows strength of binding to the human Y2 Receptor of each example PYY analogue relative to human PYY 3-36 NH 2 .
- a value of greater than 1.0 indicates binding to the human Y2 receptor greater than that shown by human PYY 3-36 NH 2 .
- Food Intake Ratio shows the reduction in food intake relative to saline during the time period 0 to 24 hours (time measured from administration of peptide) for each example PYY analogue, expressed as a ratio to the reduction in food intake relative to saline shown by animals administered native human PYY 3-36 NH 2 .
- a value of greater than 1.0 indicates a reduction of food intake better than that achieved with human PYY 3-36 N3 ⁇ 4.
- mice were injected with PYY 3-36 NH 2 (50 nmol/kg) or with Analogue No. 1 (50 nmol/kg) having the sequence
- mice were injected with PYY 3-36 NH 2 (50 nmol/kg) or with Analogue No. 3 (50 nmol/kg) having the sequence
- mice were injected with PYY 3-36 NH 2 (50 nmol/kg) or with Analogue No. 2 (50 nmol/kg) having the sequence
- Each injection was of 20 ⁇ total volume/rat at a concentration of 10 mg/ml or 20 mg/ml of peptide and of 1 zinc ion (as ZnCl 2 ) per peptide molecule.
- Plasma peptide levels were measured by a general PYY RIA using the same analogue as a standard as that which was being measured in each case.
- Example 7a A similar experiment to Example 7a was carried out with analogues 19, 15, 20, 21 , 26, 24, 22, 23 and 26 (see Figure 1 for sequences). Blood was collected and analysed at lhr, 3hr, 6hr, 1 day, 2 day, 4 day and 7 day time points.
- Results Results are presented in Figures 28 onwards and show that despite endogenous PYY having a half life of only several minutes, the levels of circulatory analogues can remain elevated for several days.
- Example 8 Feeding study in rats
- Each peptide was administered at a concentration of 200 nmol/kg and of 1 zinc ion (as ZnCl 2 ) per peptide molecule in a 20 ⁇ volume.
- the rats were given free access to food and water.
- Each treatment group contained 7-9 rats, with the exception of the saline treatment group which contained 12 rats.
- Food intake and body weight were measured at the time of injection. Rats were weighed every day - the change in mean body weight in grams (corrected for saline) is plotted on Figure 9, where it can be seen that weight loss of about 40g per rat was obtained with daily administration of Analogue No. 12.
- mice received once daily subcutaneous injectons of saline (0.9% w/v), PYY 3-36 NH 2 at
- Injection volume was ⁇ ⁇ for all treatment groups and mice were dosed for 51 days, at 16:00 hrs. Mice were fed 60 minutes after injection and had access to food until 07:30 hrs the following day when food was weighed and removed.
- Figure 1 1 shows the change in mean body weight expressed as a % of the mean body weight of the saline group.
- PYY 3-36 NH 2 had no sustained effect on mean body weight compared to saline.
- Figure 12 shows the food intake in grams for each of the treatment groups over the course of the study.
- Figure 13 shows the cumulative food intake in grams expressed relative to the cumulative food intake in grams of the saline group.
- PYY 3-36 NH 2 had no sustained effect on cumulative food intake compared to saline.
- a reduction in food intake compared to the saline group was achieved with administration of Analogue No. 15.
- Each peptide was administered at a concentration of 200 nmol/kg and of 1 zinc ion (as ZnCl 2 ) per peptide molecule.
- PYY 3-36 NH 2 and Analogue No. 15 were also administered at a concentration of 1000 nmol/kg and of 1 zinc ion (as ZnCl 2 ) per peptide molecule.
- Each injection was of 20 ⁇ total volume/rat. The rats were given free access to food and water.
- Each treatment group contained 8 rats, with the exception of the saline treatment group which contained 12 rats. Food intake and body weight were measured daily at the time of injection.
- Figure 14 shows the change in mean body weight expressed as a % of the mean body weight of the saline group.
- administration of either Analogue No. 12 or Analogue No. 15 resulted in a reduction in mean body weight compared to the saline group.
- Peptide analogues of human PYY having the following sequences:
- Analogue No. 12 Pro He Lys Pro Glu Ala Pro Gly Glu Asp Ala
- Arg Tyr NH 2 [SEQ ID NO.: 26] were obtained.
- the peptides were dissolved at a concentration of lmg/ml in a solution of ZnCl 2 having a pH of 4.5 in which zinc ions were present at various concentrations in order to give molecular ratios of zinc ions to peptide molecules of 2: 1 , 10: 1 or 50: 1.
- the pH of all peptide solutions was observed to be below pH 3.8 in all cases.
- Bovine serum albumin (BSA) was added to all solutions at a concentration of 0.5% w/v except for solutions for which the results are labelled "no BSA". Both the peptide and BSA was observed to be completely soluble in all cases.
- 0.2M NaOH was added to all samples in order to precipitate the peptides.
- the precipitate was pelleted by centrifugation.
- the precipitate was washed a further number of times (typically 5 further times or until the precipitate completely dissolved) using fresh saline at pH7.4 + 0.5% v/w BSA each time.
- the washes were spaced by 1 hour during which the sample was held at 37 degrees Celsius on a shaking tray. After these repeated washings any remaining precipitate was resuspended in saline at pH4.5 to completely resolubilise it.
- the amount of precipitate present in each wash solution and the final resuspension solution was assayed using a radioimmunoassay.
- Example 12 comparison with and without Zn 2+
- Example 7 The method of Example 7 was adapted to inject rats with 1 mg/ml of subcutaneous human PYY 3-36 NH 2 in compositions containing zinc (as ZnCl 2 ) at a molecular ratio of 10: 1 Zn : peptide and compositions free of zinc. Plasma peptide was measured at 5, 10, 15, 30, 45 and 60 minutes.
- the composition containing zinc provided a later peak at circa 30 mins (i.e. slower release) of plasma PYY 3-36 NH 2 than did the zinc-free composition (peak at circa 10 to 15 min).
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Endocrinology (AREA)
- Gastroenterology & Hepatology (AREA)
- Zoology (AREA)
- Biochemistry (AREA)
- Genetics & Genomics (AREA)
- Molecular Biology (AREA)
- Biophysics (AREA)
- Toxicology (AREA)
- Engineering & Computer Science (AREA)
- Diabetes (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Mechanical Engineering (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Hematology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Obesity (AREA)
- Emergency Medicine (AREA)
- Child & Adolescent Psychology (AREA)
- Immunology (AREA)
- Epidemiology (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Peptides Or Proteins (AREA)
Priority Applications (11)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP11701543.8A EP2528942B1 (en) | 2010-01-27 | 2011-01-27 | Novel compounds and their effects on feeding behaviour |
| AU2011210165A AU2011210165B2 (en) | 2010-01-27 | 2011-01-27 | Novel compounds and their effects on feeding behaviour |
| SG2012052973A SG182578A1 (en) | 2010-01-27 | 2011-01-27 | Novel compounds and their effects on feeding behaviour |
| MX2012008792A MX2012008792A (es) | 2010-01-27 | 2011-01-27 | Compuestos novedosos y sus efectos en el comportamiento alimenticio. |
| KR1020127021836A KR20120127610A (ko) | 2010-01-27 | 2011-01-27 | 신규 화합물 및 식습관에 대한 이의 효과 |
| CN2011800075873A CN102741278A (zh) | 2010-01-27 | 2011-01-27 | 新化合物及其对摄食行为的作用 |
| JP2012550512A JP2013518090A (ja) | 2010-01-27 | 2011-01-27 | 新規化合物及び摂食行動に対するそれらの効果 |
| RU2012136530/10A RU2012136530A (ru) | 2010-01-27 | 2011-01-27 | Новые соединения, влияющие на пищевое поведение |
| BR112012018703A BR112012018703A2 (pt) | 2010-01-27 | 2011-01-27 | compostos e seus efeitos sobre o comportamento alimentar |
| US13/575,133 US9018160B2 (en) | 2010-01-27 | 2011-01-27 | Peptide tyrosine tyrosine analogues |
| CA2788013A CA2788013A1 (en) | 2010-01-27 | 2011-01-27 | Novel compounds and their effects on feeding behaviour |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| GBGB1001333.2A GB201001333D0 (en) | 2010-01-27 | 2010-01-27 | Novel compounds and their effects on feeding behaviour |
| GB1001333.2 | 2010-01-27 |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2011092473A1 true WO2011092473A1 (en) | 2011-08-04 |
| WO2011092473A8 WO2011092473A8 (en) | 2012-08-02 |
Family
ID=42084054
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/GB2011/000110 Ceased WO2011092473A1 (en) | 2010-01-27 | 2011-01-27 | Novel compounds and their effects on feeding behaviour |
Country Status (13)
| Country | Link |
|---|---|
| US (1) | US9018160B2 (https=) |
| EP (1) | EP2528942B1 (https=) |
| JP (1) | JP2013518090A (https=) |
| KR (1) | KR20120127610A (https=) |
| CN (1) | CN102741278A (https=) |
| AU (1) | AU2011210165B2 (https=) |
| BR (1) | BR112012018703A2 (https=) |
| CA (1) | CA2788013A1 (https=) |
| GB (1) | GB201001333D0 (https=) |
| MX (1) | MX2012008792A (https=) |
| RU (1) | RU2012136530A (https=) |
| SG (1) | SG182578A1 (https=) |
| WO (1) | WO2011092473A1 (https=) |
Cited By (10)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US8901073B2 (en) | 2011-01-27 | 2014-12-02 | Imperial Innovations Limited | Compounds and their effects on feeding behaviour |
| WO2015177573A1 (en) * | 2014-05-23 | 2015-11-26 | Imperial Innovations Limited | Peptide yy (pyy) analogues |
| WO2015177572A1 (en) | 2014-05-23 | 2015-11-26 | Imperial Innovations Limited | Peptide yy (pyy) analogues |
| JP2016519130A (ja) * | 2013-05-02 | 2016-06-30 | グラクソスミスクライン、インテレクチュアル、プロパティー、ディベロップメント、リミテッドGlaxosmithkline Intellectual Property Development Limited | 治療ペプチド |
| WO2019110982A1 (en) * | 2017-12-04 | 2019-06-13 | Imperial Innovations Limited | Analogues of pyy |
| GB2573145A (en) * | 2018-04-26 | 2019-10-30 | Univ Ulster | Peptides for metabolic disease |
| WO2020249967A1 (en) | 2019-06-12 | 2020-12-17 | Ip2Ipo Innovations Limited | Appetite suppressing compounds |
| WO2021212023A1 (en) * | 2020-04-17 | 2021-10-21 | Intarcia Therapeutics, Inc. | Long acting peptide tyrosine tyrosine (pyy) analogs and methods of use |
| US11259554B2 (en) | 2015-12-16 | 2022-03-01 | Diet4Life Aps | Dietary peptides |
| US12617830B2 (en) | 2017-12-04 | 2026-05-05 | Ip2Ipo Innovations Limited | Analogues of PYY |
Families Citing this family (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2017021890A1 (en) * | 2015-08-04 | 2017-02-09 | Goal Zero Llc | Portable solar panel system control |
| WO2019147650A1 (en) | 2018-01-23 | 2019-08-01 | Gila Therapeutics, Inc. | Peptide yy pharmaceutical formulations, compositions, and methods |
| CN114075265B (zh) * | 2020-08-13 | 2025-08-29 | 珠海市丽珠微球科技有限公司 | 一种多肽酪氨酸酪氨酸类似物以及包含其的缓释制剂 |
Citations (15)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4179337A (en) | 1973-07-20 | 1979-12-18 | Davis Frank F | Non-immunogenic polypeptides |
| WO1993009227A1 (en) | 1991-11-06 | 1993-05-13 | Garvan Institute Of Medical Research | Human neuropeptide y-y1 receptor |
| US5700486A (en) | 1990-11-22 | 1997-12-23 | Vectorpharma International S.P.A. | Pharmaceutical compositions in the form of particles suitable for the controlled release of pharmacologically active substances and process for preparing the same compositions |
| US5936092A (en) | 1995-01-25 | 1999-08-10 | The University Of Southern California | Methods and compositions for lipidization of hydrophilic molecules |
| US5939380A (en) | 1986-05-20 | 1999-08-17 | Wang; Paul Yao-Cheung | Implant preparations containing bioactive macromolecule for sustained delivery |
| US5993414A (en) | 1998-04-23 | 1999-11-30 | Medtronic, Inc. | Implantable device |
| US6093692A (en) | 1997-09-25 | 2000-07-25 | The University Of Southern California | Method and compositions for lipidization of hydrophilic molecules |
| US6355478B1 (en) | 1996-06-17 | 2002-03-12 | Eli Lilly And Company | Rhesus monkey neuropeptide Y Y2 receptor |
| US6410707B2 (en) | 1996-02-06 | 2002-06-25 | Bionebraska, Inc. | Recombinant preparation of calcitonin fragments and use thereof in the preparation of calcitonin and related analogs |
| US6420352B1 (en) | 2000-07-19 | 2002-07-16 | W. Roy Knowles | Hair loss prevention |
| US6436091B1 (en) | 1999-11-16 | 2002-08-20 | Microsolutions, Inc. | Methods and implantable devices and systems for long term delivery of a pharmaceutical agent |
| US6447743B1 (en) | 1998-02-10 | 2002-09-10 | Atofina | Method for preparing an aqueous hydrogen peroxide solution directly from hydrogen and oxygen |
| WO2003026591A2 (en) | 2001-09-24 | 2003-04-03 | Imperial College Innovations Ltd. | Modification of feeding behavior |
| WO2005077094A2 (en) * | 2004-02-11 | 2005-08-25 | Amylin Pharmaceuticals, Inc. | Pancreatic polypeptide family motifs and polypeptides comprising the same |
| WO2005089789A2 (en) * | 2004-03-17 | 2005-09-29 | 7Tm Pharma A/S | Y2 selective receptor agonists for therapeutic interventions |
Family Cites Families (19)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO1995005848A1 (en) | 1993-08-24 | 1995-03-02 | Novo Nordisk A/S | Protracted glp-1 |
| US7186692B2 (en) | 2002-12-17 | 2007-03-06 | Nastech Pharmaceutical Company Inc. | Compositions and methods for enhanced mucosal delivery and non-infused administration of Y2 receptor-binding peptides and methods for treating and preventing obesity |
| NZ579621A (en) | 2004-02-11 | 2011-03-31 | Amylin Pharmaceuticals Inc | Hybrid polypeptides with selectable properties |
| ATE471340T1 (de) | 2004-02-11 | 2010-07-15 | Amylin Pharmaceuticals Inc | Peptide der amylin familie, verfahren zu deren herstellung und verwendung |
| US8076288B2 (en) | 2004-02-11 | 2011-12-13 | Amylin Pharmaceuticals, Inc. | Hybrid polypeptides having glucose lowering activity |
| US20090186811A1 (en) | 2004-03-17 | 2009-07-23 | Thue Schwartz | Y2 Selective Receptor Agonists for Therapeutic Interventions |
| JP2007531714A (ja) | 2004-03-17 | 2007-11-08 | 7ティーエム ファーマ エイ/エス | 治療的介入のためのy2/y4選択性レセプターアゴニスト |
| EP2060266B1 (en) | 2004-03-17 | 2011-08-10 | 7TM Pharma A/S | Y4 selective receptor agonist PP2-36 for therapeutic interventions |
| CA2580991A1 (en) | 2004-10-08 | 2006-04-20 | Amylin Pharmaceuticals, Inc. | Amylin family polypeptide-6 (afp-6) analogs and methods of making and using them |
| EP2360180A3 (en) * | 2004-12-13 | 2012-02-08 | Amylin Pharmaceuticals Inc. | Pancreatic polypeptide family motifs, polypeptides and methods comprising the same |
| WO2007022123A2 (en) * | 2005-08-11 | 2007-02-22 | Amylin Pharmaceuticals, Inc. | Hybrid polypeptides with selectable properties |
| GB0504857D0 (en) | 2005-03-09 | 2005-04-13 | Imp College Innovations Ltd | Novel compounds and their effects on feeding behaviour |
| JP4629488B2 (ja) | 2005-04-28 | 2011-02-09 | 本田技研工業株式会社 | プラントを制御する制御装置 |
| WO2007008778A2 (en) | 2005-07-11 | 2007-01-18 | Nastech Pharmaceutical Company Inc. | Formulations for enhanced mucosal delivery of pyy |
| MX2008002028A (es) * | 2005-08-11 | 2008-03-27 | Amylin Pharmaceuticals Inc | Polipeptidos hibridos con propiedades de seleccion. |
| GB0613196D0 (en) | 2006-07-03 | 2006-08-09 | Imp Innovations Ltd | Novel compounds and their effects on feeding behaviour |
| WO2009007714A2 (en) | 2007-07-09 | 2009-01-15 | Imperial Innovations Limited | Human pancreatic polypeptide (hpp) analogues and their effects on feeding behaviour |
| US8598314B2 (en) * | 2007-09-27 | 2013-12-03 | Amylin Pharmaceuticals, Llc | Peptide-peptidase-inhibitor conjugates and methods of making and using same |
| WO2009138511A1 (en) * | 2008-05-16 | 2009-11-19 | Novo Nordisk A/S | Long-acting y2 and/or y4 receptor agonists |
-
2010
- 2010-01-27 GB GBGB1001333.2A patent/GB201001333D0/en not_active Ceased
-
2011
- 2011-01-27 SG SG2012052973A patent/SG182578A1/en unknown
- 2011-01-27 KR KR1020127021836A patent/KR20120127610A/ko not_active Withdrawn
- 2011-01-27 US US13/575,133 patent/US9018160B2/en active Active
- 2011-01-27 RU RU2012136530/10A patent/RU2012136530A/ru not_active Application Discontinuation
- 2011-01-27 MX MX2012008792A patent/MX2012008792A/es not_active Application Discontinuation
- 2011-01-27 BR BR112012018703A patent/BR112012018703A2/pt not_active IP Right Cessation
- 2011-01-27 CA CA2788013A patent/CA2788013A1/en not_active Abandoned
- 2011-01-27 EP EP11701543.8A patent/EP2528942B1/en active Active
- 2011-01-27 AU AU2011210165A patent/AU2011210165B2/en not_active Ceased
- 2011-01-27 WO PCT/GB2011/000110 patent/WO2011092473A1/en not_active Ceased
- 2011-01-27 JP JP2012550512A patent/JP2013518090A/ja active Pending
- 2011-01-27 CN CN2011800075873A patent/CN102741278A/zh active Pending
Patent Citations (16)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4179337A (en) | 1973-07-20 | 1979-12-18 | Davis Frank F | Non-immunogenic polypeptides |
| US5939380A (en) | 1986-05-20 | 1999-08-17 | Wang; Paul Yao-Cheung | Implant preparations containing bioactive macromolecule for sustained delivery |
| US5700486A (en) | 1990-11-22 | 1997-12-23 | Vectorpharma International S.P.A. | Pharmaceutical compositions in the form of particles suitable for the controlled release of pharmacologically active substances and process for preparing the same compositions |
| WO1993009227A1 (en) | 1991-11-06 | 1993-05-13 | Garvan Institute Of Medical Research | Human neuropeptide y-y1 receptor |
| US6225445B1 (en) | 1995-01-25 | 2001-05-01 | The University Of Southern California | Methods and compositions for lipidization of hydrophilic molecules |
| US5936092A (en) | 1995-01-25 | 1999-08-10 | The University Of Southern California | Methods and compositions for lipidization of hydrophilic molecules |
| US6410707B2 (en) | 1996-02-06 | 2002-06-25 | Bionebraska, Inc. | Recombinant preparation of calcitonin fragments and use thereof in the preparation of calcitonin and related analogs |
| US6355478B1 (en) | 1996-06-17 | 2002-03-12 | Eli Lilly And Company | Rhesus monkey neuropeptide Y Y2 receptor |
| US6093692A (en) | 1997-09-25 | 2000-07-25 | The University Of Southern California | Method and compositions for lipidization of hydrophilic molecules |
| US6447743B1 (en) | 1998-02-10 | 2002-09-10 | Atofina | Method for preparing an aqueous hydrogen peroxide solution directly from hydrogen and oxygen |
| US5993414A (en) | 1998-04-23 | 1999-11-30 | Medtronic, Inc. | Implantable device |
| US6436091B1 (en) | 1999-11-16 | 2002-08-20 | Microsolutions, Inc. | Methods and implantable devices and systems for long term delivery of a pharmaceutical agent |
| US6420352B1 (en) | 2000-07-19 | 2002-07-16 | W. Roy Knowles | Hair loss prevention |
| WO2003026591A2 (en) | 2001-09-24 | 2003-04-03 | Imperial College Innovations Ltd. | Modification of feeding behavior |
| WO2005077094A2 (en) * | 2004-02-11 | 2005-08-25 | Amylin Pharmaceuticals, Inc. | Pancreatic polypeptide family motifs and polypeptides comprising the same |
| WO2005089789A2 (en) * | 2004-03-17 | 2005-09-29 | 7Tm Pharma A/S | Y2 selective receptor agonists for therapeutic interventions |
Non-Patent Citations (19)
| Title |
|---|
| "National Institutes of Health, National Heart, Lung, and Blood Institute (NHLBI)", OBES. RES., vol. 6, no. 2, 1998, pages 51S - 209S |
| BARLOW; DIETZ, PEDIATRICS, vol. 102, 1998, pages E29 |
| BOWIE ET AL., SCIENCE, vol. 247, 1990, pages 1306 - 1310 |
| BUCHWALD ET AL., SURGERY, vol. 88, 1980, pages 507 |
| DRUCE MR; MINNION JS; FIELD BC; PATEL SR; SHILLITO JC; TILBY M; BEALE KE; MURPHY KG; GHATEI MA; BLOOM SR: "Investigation of structure-activity relationships of oxyntomodulin (oxm) using oxm analogues", ENDOCRINOLOGY, vol. 150, no. 4, 2009, pages 712 - 22, XP009116621, DOI: doi:10.1210/en.2008-0828 |
| DUMONT ET AL., SOCIETY FOR NEUROSCIENCE ABSTRACTS, vol. 19, 1993, pages 726 |
| E. W. MARTIN, REMINGTON'S PHARMACEUTICAL SCIENCES |
| JEQUIER, AM. J CLIN. NUTR., vol. 45, 1987, pages 1035 - 47 |
| KENCHAIAH ET AL., N ENGL. J. MED., vol. 347, 2002, pages 305 |
| KOPELMAN, NATURE, vol. 404, 2000, pages 635 - 43 |
| KOPELMAN, NATURE, vol. 404, pages 635 - 43 |
| LANGER, SCIENCE, vol. 249, 1990, pages 1527 - 1533 |
| LYZNICKI ET AL., AM. FAM. PHYS., vol. 63, 2001, pages 2185 |
| MASSIE, N. ENGL. J. MED., vol. 347, 2002, pages 358 |
| MORGAN DG; LAMBERT PD; SMITH DM; WILDING JPH; BLOOM SR: "J. Reduced NPY induced feeding in diabetic but not steroid treated rats: lack of evidence for changes in receptor number or affinity", NEUROENDOCRINOL, vol. 8, 1996, pages 283 - 290 |
| RISSANEN ET AL., BRITISH MED..L., vol. 301, 1990, pages 835 |
| SAUDEK ET AL., N ENGL. J MED., vol. 321, 1989, pages 574 |
| SEFTON, CRC CRIT. REF BIOMED. ENG., vol. 14, 1987, pages 201 |
| WANG, Y. J.; HANSON, M. A.: "Journal of Parenteral Science and Technology", TECHNICAL REPORT NO. 10, vol. 42, 1988, pages 2S |
Cited By (16)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US8901073B2 (en) | 2011-01-27 | 2014-12-02 | Imperial Innovations Limited | Compounds and their effects on feeding behaviour |
| JP2016519130A (ja) * | 2013-05-02 | 2016-06-30 | グラクソスミスクライン、インテレクチュアル、プロパティー、ディベロップメント、リミテッドGlaxosmithkline Intellectual Property Development Limited | 治療ペプチド |
| WO2015177573A1 (en) * | 2014-05-23 | 2015-11-26 | Imperial Innovations Limited | Peptide yy (pyy) analogues |
| WO2015177572A1 (en) | 2014-05-23 | 2015-11-26 | Imperial Innovations Limited | Peptide yy (pyy) analogues |
| US11259554B2 (en) | 2015-12-16 | 2022-03-01 | Diet4Life Aps | Dietary peptides |
| US12295397B2 (en) | 2015-12-16 | 2025-05-13 | Diet4Life Aps | Dietary peptides |
| WO2019110982A1 (en) * | 2017-12-04 | 2019-06-13 | Imperial Innovations Limited | Analogues of pyy |
| US11421012B2 (en) | 2017-12-04 | 2022-08-23 | Ip2Ipo Innovations Limited | Analogues of PYY |
| AU2018379704B2 (en) * | 2017-12-04 | 2024-02-29 | Ip2Ipo Innovations Limited | Analogues of PYY |
| US12060402B2 (en) | 2017-12-04 | 2024-08-13 | Ip2Ipo Innovations Limited | Analogues of PYY |
| US12617830B2 (en) | 2017-12-04 | 2026-05-05 | Ip2Ipo Innovations Limited | Analogues of PYY |
| GB2573145A (en) * | 2018-04-26 | 2019-10-30 | Univ Ulster | Peptides for metabolic disease |
| WO2020249967A1 (en) | 2019-06-12 | 2020-12-17 | Ip2Ipo Innovations Limited | Appetite suppressing compounds |
| WO2021212023A1 (en) * | 2020-04-17 | 2021-10-21 | Intarcia Therapeutics, Inc. | Long acting peptide tyrosine tyrosine (pyy) analogs and methods of use |
| US11739134B2 (en) | 2020-04-17 | 2023-08-29 | Intarcia Therapeutics, Inc. | Long acting peptide tyrosine tyrosine (PYY) analogs and methods of use |
| US12122816B2 (en) | 2020-04-17 | 2024-10-22 | I2O Therapeutics, Inc. | Long acting peptide tyrosine tyrosine (PYY) analogs and methods of use |
Also Published As
| Publication number | Publication date |
|---|---|
| CN102741278A (zh) | 2012-10-17 |
| US20130023464A1 (en) | 2013-01-24 |
| MX2012008792A (es) | 2012-11-29 |
| KR20120127610A (ko) | 2012-11-22 |
| GB201001333D0 (en) | 2010-03-17 |
| AU2011210165B2 (en) | 2014-06-05 |
| US9018160B2 (en) | 2015-04-28 |
| BR112012018703A2 (pt) | 2017-01-10 |
| AU2011210165A1 (en) | 2012-08-23 |
| WO2011092473A8 (en) | 2012-08-02 |
| EP2528942A1 (en) | 2012-12-05 |
| JP2013518090A (ja) | 2013-05-20 |
| SG182578A1 (en) | 2012-08-30 |
| RU2012136530A (ru) | 2014-03-10 |
| CA2788013A1 (en) | 2011-08-04 |
| EP2528942B1 (en) | 2020-06-17 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US8202836B2 (en) | Modified PYY (3-36) peptides and their effects on feeding behavior | |
| US8263736B2 (en) | Compounds and their effects on feeding behaviour | |
| US8901073B2 (en) | Compounds and their effects on feeding behaviour | |
| EP2528942B1 (en) | Novel compounds and their effects on feeding behaviour | |
| US20100279930A1 (en) | Human pancreatic polypeptide (hpp) analogues and their effects on feeding behaviour | |
| EP2895506A1 (en) | Peptide analogues of glucagon and glp1 | |
| US20170137486A1 (en) | Peptide yy (pyy) analogues | |
| US12060402B2 (en) | Analogues of PYY | |
| US12617830B2 (en) | Analogues of PYY | |
| WO2015177573A1 (en) | Peptide yy (pyy) analogues |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| WWE | Wipo information: entry into national phase |
Ref document number: 201180007587.3 Country of ref document: CN |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 11701543 Country of ref document: EP Kind code of ref document: A1 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 220824 Country of ref document: IL |
|
| ENP | Entry into the national phase |
Ref document number: 2788013 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2012550512 Country of ref document: JP |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: MX/A/2012/008792 Country of ref document: MX |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2011210165 Country of ref document: AU |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2011701543 Country of ref document: EP |
|
| ENP | Entry into the national phase |
Ref document number: 20127021836 Country of ref document: KR Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2011210165 Country of ref document: AU Date of ref document: 20110127 Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2012136530 Country of ref document: RU |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 13575133 Country of ref document: US |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112012018703 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 112012018703 Country of ref document: BR Kind code of ref document: A2 Effective date: 20120726 |