WO2011044132A1 - Génération de plantes haploïdes et sélection de plantes améliorée - Google Patents

Génération de plantes haploïdes et sélection de plantes améliorée Download PDF

Info

Publication number
WO2011044132A1
WO2011044132A1 PCT/US2010/051483 US2010051483W WO2011044132A1 WO 2011044132 A1 WO2011044132 A1 WO 2011044132A1 US 2010051483 W US2010051483 W US 2010051483W WO 2011044132 A1 WO2011044132 A1 WO 2011044132A1
Authority
WO
WIPO (PCT)
Prior art keywords
cenh3
plant
protein
histone
domain
Prior art date
Application number
PCT/US2010/051483
Other languages
English (en)
Inventor
Simon Chan
Ravi Maruthachalam
Original Assignee
The Regents Of The University Of California
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by The Regents Of The University Of California filed Critical The Regents Of The University Of California
Priority to EP19177524.6A priority Critical patent/EP3560951B1/fr
Priority to ES10822533T priority patent/ES2774722T3/es
Priority to MX2016007969A priority patent/MX349747B/es
Priority to CA2774941A priority patent/CA2774941C/fr
Priority to RU2012118381/10A priority patent/RU2571927C2/ru
Priority to AU2010303635A priority patent/AU2010303635B2/en
Priority to MX2012003981A priority patent/MX2012003981A/es
Priority to EP10822533.5A priority patent/EP2486135B1/fr
Priority to BR112012007692-2A priority patent/BR112012007692B1/pt
Publication of WO2011044132A1 publication Critical patent/WO2011044132A1/fr
Priority to AU2015200432A priority patent/AU2015200432B2/en

Links

Classifications

    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09—Recombinant DNA-technology
    • C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/82—Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
    • C12N15/8241—Phenotypically and genetically modified plants via recombinant DNA technology
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/415—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from plants
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09—Recombinant DNA-technology
    • C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/82—Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
    • C12N15/8241—Phenotypically and genetically modified plants via recombinant DNA technology
    • C12N15/8261—Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09—Recombinant DNA-technology
    • C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/82—Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
    • C12N15/8241—Phenotypically and genetically modified plants via recombinant DNA technology
    • C12N15/8261—Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield
    • C12N15/8287—Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield for fertility modification, e.g. apomixis
    • Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
    • Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
    • Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
    • Y02A40/00—Adaptation technologies in agriculture, forestry, livestock or agroalimentary production
    • Y02A40/10—Adaptation technologies in agriculture, forestry, livestock or agroalimentary production in agriculture
    • Y02A40/146—Genetically Modified [GMO] plants, e.g. transgenic plants

Definitions

  • the present invention provides for new ways for producing haploid organisms.
  • the invention provides a transgenic plant comprising a heterologous transgene expression cassette, the expression cassette comprising a promoter operably linked to a polynucleotide encoding a recombinantly altered CENH3, CENPC, MIS 12, NDC80 or NUF2 polypeptide, wherein in the event the recombinantly altered polypeptide is expressed in a first plant having a corresponding inactivated endogenous CENH3, CENPC, MIS 12, NDC80 or NUF2 gene and the first plant is crossed to a wildtype plant, at least 0.1% of resulting progeny are haploid.
  • one or two alleles of the endogenous CENH3, CENPC, MIS 12, NDC80 or NUF2 genomic coding sequence of the plant is inactivated or knocked out.
  • all alleles of the endogenous CENH3, CENPC, MIS 12, NDC80 or NUF2 genomic coding sequence of the plant is inactivated or knocked out.
  • the plant when crossed with a wildtype plant, generates at least 0.1% (or, e.g., 0.5, 1, 2, 5, 10, 20% or more) haploid progeny.
  • the polypeptide is a recombinantly altered CENH3 polypeptide.
  • the polypeptide comprises a heterologous amino acid sequence of at least 5 amino acids linked to a protein comprising a CENH3 histone-fold domain, wherein the amino acid sequence is heterologous to the CENH3 histone-fold domain.
  • the heterologous amino acid sequence is linked directly to the CENH3 histone-fold domain and the polypeptide lacks a CENH3 tail domain.
  • the heterologous amino acid sequence is linked to the CENH3 histone-fold domain via an intervening protein sequence.
  • the intervening protein sequence comprises a non-CENH3 histone H3 tail domain.
  • the non- CENH3 histone H3 tail domain comprises an amino acid sequence at least 70% identical to SEQ ID NO:95, or a fragment thereof at least 20 amino acids long.
  • the intervening protein sequence comprises a CENH3 tail domain.
  • the intervening protein sequence comprises a histone H3 tail domain and a heterologous histone CENH3 tail domain.
  • the CENH3 tail domain is heterologous to the CENH3 histone-fold domain.
  • the heterologous amino acid sequence is at least 10 amino acids long.
  • the intervening protein sequence comprises a histone H3 tail domain and a heterologous histone CENH3 tail domain
  • the heterologous amino acid sequence comprises green fluorescent protein.
  • the heterologous amino acid sequence disrupts centromeres.
  • the CENH3 histone-fold domain is selected from the group consisting of SEQ ID NOs: 49-94.
  • the polypeptide comprises a non-CENH3 tail domain linked to a CENH3 histone-fold domain.
  • the polypeptide comprises a CENH3 histone-fold domain and a truncated CENH3 tail domain, wherein the amino terminus of the tail domain is truncated relative to the plant's endogenous tail domain.
  • the truncated CENH3 tail domain lacks three or more amino terminal amino acids of the endogenous tail domain.
  • a heterologous amino acid sequence is linked to the amino terminus of the truncated tail domain. In some embodiments, the heterologous amino acid sequence is at least 10 amino acids long.
  • the heterologous amino acid sequence comprises green fluorescent protein. In some embodiments, the heterologous amino acid sequence disrupts centromeres. In some embodiments, the CENH3 histone-fold domain is selected from the group consisting of SEQ ID NOs: 49-94. [0013] In some embodiments, the polypeptide is a recombinantly altered CENPC, MIS 12, NDC80 and NUF2 polypeptide.
  • the present invention also provides for an isolated nucleic acid comprising a polynucleotide encoding a polypeptide, wherein the polypeptide comprises: a non-CENH3 tail domain linked to a CENH3 histone-fold domain; or a truncated CENH3 tail domain linked to a CENH3 histone-fold domain, wherein the amino terminus of the tail domain is truncated.
  • the present invention also provides for a plant comprising a silenced CENH3 or one or two copies of an allele of a knocked out, inactivated, or mutated endogenous CENH3 gene.
  • the present invention also provides for method of generating a haploid plant, the method comprising, crossing a plant expressing an endogenous CENH3 protein to a transgenic plant comprising a heterologous transgene expression cassette, the expression cassette comprising a promoter operably linked to a polynucleotide encoding a recombinantly altered CENH3, CENPC, MIS 12, NDC80 or NUF2 polypeptide, wherein in the event the recombinantly altered polypeptide is expressed in a first plant having a corresponding inactivated endogenous CENH3, CENPC, MIS 12, NDC80 or NUF2 gene and the first plant is crossed to a wildtype plant, at least 0.1% of resulting progeny are haploid; and selecting Fl haploid progeny generated from the crossing step.
  • the plant expressing an endogenous CENH3 protein is the pollen parent of the cross.
  • the plant expressing an endogenous CENH3 protein is the ovule parent of the cross.
  • the method further comprises converting at least one selected haploid plant into a doubled haploid plant.
  • a method of making a transgenic plant comprising a heterologous transgene expression cassette, the expression cassette comprising a promoter operably linked to a polynucleotide encoding a recombinantly altered CENH3, CENPC, MIS 12, NDC80 or NUF2 polypeptide, wherein in the event the recombinantly altered polypeptide is expressed in a first plant having a corresponding inactivated endogenous CENH3, CENPC, MIS 12, NDC80 or NUF2 gene and the first plant is crossed to a wildtype plant, at least 0.1% of resulting progeny are haploid, the method comprising, transforming plant cells with a nucleic acid comprising the expression cassette; and selecting transformants comprising the nucleic acid, thereby making the plant.
  • the present invention provides an isolated polynucleotide encoding a polypeptide, wherein the polypeptide comprises: an amino acid sequence of at least 5 amino acids linked to a protein comprising a CENH3 histone-fold domain, wherein the amino acid sequence is heterologous to the CENH3 histone-fold domain; or a protein comprising a CENH3 histone-fold domain and a truncated CENH3 tail domain, wherein the amino terminus of the tail domain is truncated.
  • the heterologous amino acid sequence is linked directly to the CENH3 histone-fold domain.
  • the polypeptide lacks a CENH3 tail domain.
  • the heterologous amino acid sequence is linked to the CENH3 histone-fold domain via an intervening protein sequence.
  • the intervening protein sequence comprises a non-CENH3 histone H3 tail domain.
  • the intervening protein sequence comprises a CENH3 tail domain.
  • the CENH3 tail domain is heterologous to the CENH3 histone-fold domain.
  • the non-CENH3 histone H3 tail domain comprises an amino acid sequence at least 70% identical to SEQ ID NO: 95, or a fragment thereof at least 20 amino acids long.
  • the intervening protein sequence comprises a histone H3 tail domain and a heterologous histone CENH3 tail domain.
  • the heterologous amino acid sequence is at least 3, 5, 10, 15, 20, 30, or 50 amino acids long, optionally lacking a fixed secondary structure. [0025] In some embodiments, the heterologous amino acid sequence comprises green fluorescent protein.
  • the heterologous amino acid sequence disrupts centromeres.
  • the CENH3 histone-fold domain is selected from the group consisting of SEQ ID NOs: 49-94.
  • the polypeptide comprises a protein comprising a CENH3 histone-fold domain and a truncated CENH3 tail domain, wherein the amino terminus of the tail domain is truncated.
  • the truncated CENH3 tail domain lacks at least 1, 2, 3,4,5, 6, 10, 15, or 20 amino terminal amino acids of the endogenous tail domain.
  • a heterologous amino acid sequence is linked to the amino terminus of the truncated tail domain.
  • the heterologous amino acid sequence is at least at least 3, 5, 10, 15, 20, 30, or 50 amino acids long.
  • the heterologous amino acid sequence comprises green fluorescent protein.
  • the heterologous amino acid sequence disrupts centromeres.
  • the CENH3 histone-fold domain is selected from the group consisting of SEQ ID NOs: 49-94.
  • the present invention also provides an expression cassette comprising any of the above-listed the polynucleotides, wherein the expression cassette comprises a promoter operably linked to the polynucleotide encoding a polypeptide.
  • the invention provides for a vector comprising the expression cassette.
  • the invention provides for a plant comprising the expression cassette.
  • the heterologous histone tail domain comprises a histone H3 tail domain or a heterologous histone CENH3 tail domain.
  • the polypeptide comprises a histone H3 tail domain and a histone CENH3 tail domain.
  • the plant comprises a silenced CENH3 or one or two copies of an allele of a knocked out or mutated endogenous CENH3 gene.
  • the expression cassette is integrated into the chromosome of the plant.
  • the present invention also provides for a plant comprising a silenced CENH3 or one or two copies of an allele of a knocked out or mutated endogenous CENH3 gene.
  • the present invention also provides for a method of generating a haploid plant.
  • the method comprises, crossing a plant expressing an endogenous CENH3 protein to the plant as described herein (e.g., expressing a tailswap protein); and selecting Fl haploid progeny generated from the crossing step.
  • the plant expressing an endogenous CENH3 protein is the pollen parent of the cross.
  • the plant expressing an endogenous CENH3 protein is the ovule parent of the cross.
  • the method further comprises converting at least one selected haploid plant into a doubled haploid plant.
  • An "endogenous" gene or protein sequence refers to a non-recombinant sequence of an organism as the sequence occurs in the organism before human-induced mutation of the sequence.
  • a “mutated” sequence refers to a human-altered sequence. Examples of human- induced mutation include exposure of an organism to a high dose of chemical, radiological, or insertional mutagen for the purposes of selecting mutants, as well as recombinant alteration of a sequence. Examples of human-induced recombinant alterations can include, e.g., fusions, insertions, deletions, and/or changes to the sequence.
  • promoter refers to regions or sequence located upstream and/or downstream from the start of transcription and which are involved in recognition and binding of RNA polymerase and other proteins to initiate transcription.
  • a "plant promoter” is a promoter capable of initiating transcription in plant cells.
  • a plant promoter can be, but does not have to be, a nucleic acid sequence originally isolated from a plant.
  • operably linked refers to a functional linkage between a nucleic acid expression control sequence (such as a promoter, or array of transcription factor binding sites) and a second nucleic acid sequence, wherein the expression control sequence directs transcription of the nucleic acid corresponding to the second sequence.
  • a nucleic acid expression control sequence such as a promoter, or array of transcription factor binding sites
  • plant includes whole plants, shoot vegetative organs/structures
  • the class of plants that can be used in the method of the invention is generally as broad as the class of higher and lower plants amenable to transformation techniques, including
  • angiosperms (monocotyledonous and dicotyledonous plants), gymnosperms, ferns, and multicellular algae. It includes plants of a variety of ploidy levels, including aneuploid, polyploid, diploid, haploid and hemizygous.
  • a polynucleotide or polypeptide sequence is "heterologous to" an organism or a second sequence if it originates from a foreign species, or, if from the same species, is modified from its original form.
  • a promoter operably linked to a heterologous coding sequence refers to a coding sequence from a species different from that from which the promoter was derived, or, if from the same species, a coding sequence which is not naturally associated with the promoter (e.g. a genetically engineered coding sequence or an allele from a different ecotype or variety).
  • a CENH3 tail domain from a first species is heterologous to a CENH3 histone-fold domain from a second species.
  • Recombinant refers to a human manipulated polynucleotide or a copy or complement of a human manipulated polynucleotide.
  • a recombinant expression cassette comprising a promoter operably linked to a second polynucleotide may include a promoter that is heterologous to the second polynucleotide as the result of human manipulation (e.g., by methods described in Sambrook et al, Molecular Cloning - A
  • a recombinant expression cassette may comprise
  • polynucleotides combined in such a way that the polynucleotides are extremely unlikely to be found in nature.
  • human manipulated restriction sites or plasmid vector sequences may flank or separate the promoter from the second polynucleotide.
  • polynucleotides can be manipulated in many ways and are not limited to the examples above.
  • transgenic plant is a plant comprising a transgene, i.e., is a genetically-modified plant.
  • the transgenic plant can be the initial plant into which the transgene was introduced as well as progeny thereof whose genome contain the transgene.
  • corresponding as used herein is used to mean “respective.” For example, where it is said that a plant contains a recombinantly altered copy of a protein selected from A, B, and C, and the plant also contains a "corresponding" mutated endogenous copy of the gene selected from a gene encoding A, B, or C, if the plant contains a
  • the corresponding mutated endogenous copy would also be A.
  • the plant contains a recombinantly altered protein B, the corresponding mutated endogenous copy would also be B, etc.
  • nucleic acid or “polynucleotide sequence” refers to a single or double- stranded polymer of deoxyribonucleotide or ribonucleotide bases read from the 5' to the 3' end. Nucleic acids may also include modified nucleotides that permit correct read through by a polymerase, and/or formation of double-stranded duplexes, and do not significantly alter expression of a polypeptide encoded by that nucleic acid.
  • nucleic acid sequence encoding refers to a nucleic acid which directs the expression of a specific protein or peptide.
  • the nucleic acid sequences include both the DNA strand sequence that is transcribed into RNA and the RNA sequence that is translated into protein.
  • the nucleic acid sequences include both the full length nucleic acid sequences as well as non-full length sequences derived from the full length sequences. It should be further understood that the sequence includes the degenerate codons of the native sequence or sequences which may be introduced to provide codon preference in a specific host cell.
  • host cell refers to a cell from any organism.
  • Exemplary host cells are derived from plants, bacteria, yeast, fungi, insects or other animals. Methods for introducing polynucleotide sequences into various types of host cells are well known in the art.
  • An "expression cassette” refers to a nucleic acid construct, which when introduced into a host cell (e.g., a plant cell), results in transcription and/or translation of a RNA or polypeptide, respectively.
  • An expression cassette can result in transcription without translation, for example, when an siRNA or other non-protein encoding RNA is transcribed.
  • Two nucleic acid sequences or polypeptides are said to be “identical” if the sequence of nucleotides or amino acid residues, respectively, in the two sequences is the same when aligned for maximum correspondence as described below. The term
  • “complementary to” is used herein to mean that the sequence is complementary to all or a portion of a reference polynucleotide sequence.
  • Examples of algorithms that are suitable for determining percent sequence identity and sequence similarity are the BLAST and BLAST 2.0 algorithms, which are described in Altschul et ai, Nuc. Acids Res. 25:3389-3402 (1977), and Altschul et ai, J. Mol. Biol.
  • HSPs high scoring sequence pairs
  • Cumulative scores are calculated using, for nucleotide sequences, the parameters M (reward score for a pair of matching residues; always > 0) and N (penalty score for mismatching residues; always ⁇ 0).
  • M forward score for a pair of matching residues; always > 0
  • N penalty score for mismatching residues; always ⁇ 0.
  • a scoring matrix is used to calculate the cumulative score. Extension of the word hits in each direction are halted when: the cumulative alignment score falls off by the quantity X from its maximum achieved value; the cumulative score goes to zero or below, due to the accumulation of one or more negative- scoring residue alignments; or the end of either sequence is reached.
  • the BLAST algorithm parameters W, T, and X determine the sensitivity and speed of the alignment.
  • W wordlength
  • E expectation
  • BLASTP program uses as defaults a wordlength of 3, and expectation (E) of 10, and the BLOSUM62 scoring matrix (see Henikoff and Henikoff, Proc. Natl. Acad. Sci. USA
  • the BLAST algorithm also performs a statistical analysis of the similarity between two sequences (see, e.g., Karlin and Altschul, Proc. Natl. Acad. Sci. USA 90:5873-5787, (1993)).
  • One measure of similarity provided by the BLAST algorithm is the smallest sum probability (P(N)), which provides an indication of the probability by which a match between two nucleotide or amino acid sequences would occur by chance.
  • P(N) the smallest sum probability
  • a nucleic acid is considered similar to a reference sequence if the smallest sum probability in a comparison of the test nucleic acid to the reference nucleic acid is less than about 0.2, more preferably less than about 0.01, and most preferably less than about 0.001.
  • Percentage of sequence identity is determined by comparing two optimally aligned sequences over a comparison window, wherein the portion of the polynucleotide sequence in the comparison window may comprise additions or deletions (i.e., gaps) as compared to the reference sequence (which does not comprise additions or deletions) for optimal alignment of the two sequences. The percentage is calculated by determining the number of positions at which the identical nucleic acid base or amino acid residue occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the window of comparison and multiplying the result by 100 to yield the percentage of sequence identity.
  • substantially identical of polynucleotide sequences means that a polynucleotide comprises a sequence that has at least 25% sequence identity to a designated reference sequence.
  • percent identity can be any integer from 25% to 100%, for example, at least: 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% compared to a reference sequence using the programs described herein; preferably BLAST using standard parameters, as described below.
  • percent identity values above can be appropriately adjusted to determine corresponding identity of proteins encoded by two nucleotide sequences by taking into account codon degeneracy, amino acid similarity, reading frame positioning and the like.
  • Substantial identity of amino acid sequences for these purposes normally means sequence identity of at least 40%.
  • Percent identity of polypeptides can be any integer from 40% to 100%, for example, at least 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99%.
  • polypeptides that are "substantially similar" share sequences as noted above except that residue positions that are not identical may differ by conservative amino acid changes. Conservative amino acid substitutions refer to the interchangeability of residues having similar side chains.
  • a group of amino acids having aliphatic side chains is glycine, alanine, valine, leucine, and isoleucine; a group of amino acids having aliphatic-hydroxyl side chains is serine and threonine; a group of amino acids having amide-containing side chains is asparagine and glutamine; a group of amino acids having aromatic side chains is phenylalanine, tyrosine, and tryptophan; a group of amino acids having basic side chains is lysine, arginine, and histidine; and a group of amino acids having sulfur-containing side chains is cysteine and methionine.
  • Exemplary conservative amino acids substitution groups are: valine-leucine-isoleucine, phenylalanine- tyrosine, lysine-arginine, alanine-valine, aspartic acid-glutamic acid, and asparagine- glutamine.
  • the present invention is based, in part, on the surprising discovery that elimination of an endogenous CENH3 in combination with expression of a heterologous protein comprising an altered CENH3 results in a plant that has useful properties for breeding. For example, when a plant that lacks an endogenous CENH3 protein, and expresses a protein comprising (listed from amino terminus to carboxyl terminus) a GFP tag, a non-CENH3 tail domain and a CENH3 histone fold domain, is crossed to a plant having an endogenous
  • CENH3 protein a portion of the resulting progeny lack all chromosomes derived from the parent plant that expresses an altered version of CENH3.
  • the invention allows for the production of haploid progeny. Haploid plants are useful, for example, for improving and speeding breeding.
  • CENH3 is a member of the kinetochore complex, the protein structure on chromosomes where spindle fibers attach during cell division. Without intending to limit the scope of the invention, it is believed that the observed results are due in part to generation of a kinetochore protein that acts more weakly than wildtype, thereby resulting in functional kinetochore complexes (for example, in mitosis), but which result in relatively poorly segregating chromosomes during meiosis relative to chromosomes also containing wildtype kinetochore complexes from the other parent.
  • kinetochore complexes when the altered protein is the only isoform in the cell, but relatively poorly segregating chromosomes during mitosis when the parent with altered kinetochores is crossed to a parent with wildtype kinetochore complexes.
  • other kinetochore proteins include, e.g., CENPC, MCM21, MIS 12, NDC80, and NUF2.
  • the present invention provides for plants, fungi, or animals (or cells thereof) that express a recombinant mutated kinetochore protein (including but not limited to CENH3, CENPC, MCM21, MIS 12, NDC80, and NUF2) that disrupts the centromere, and/or plants, fungi, or animals (or cells thereof) in which at least one or both copies of an allele of the endogenous CENH3 gene has been knocked out, mutated to reduce or eliminate its function, or silenced.
  • a recombinant mutated kinetochore protein including but not limited to CENH3, CENPC, MCM21, MIS 12, NDC80, and NUF2
  • the mutated kinetochore protein can be mutated in many different ways, including but not limited to, as a "tailswap" protein, comprising a CENH3 histone-fold domain and a heterologous amino terminal sequence.
  • the present invention also provides for methods of generating a haploid plant by crossing a plant expressing a mutated kinetochore protein (including but not limited to a tailswap CENH3 protein), and not expressing an endogenous CENH3 protein, to a plant that expresses an endogenous CENH3 protein.
  • CENH3 proteins are a well characterized class of proteins that are variants of H3 histone proteins and that are specialized proteins associated with the centromere.
  • CENH3 proteins are characterized by a variable tail domain, which does not form a rigid secondary structure, and a conserved histone fold domain made up of three oc-helical regions connected by loop sections. Additional structural and functional features of CENH3 proteins can be found in, e.g., Cooper et al, Mol Biol Evol. 21(9): 1712-8 (2004); Malik et al, Nat Struct Biol. 10(11):882-91 (2003); Black et al, Curr Opin Cell Biol. 20(1):91-100 (2008).
  • CENH3 proteins are one of the proteins that form the kinetochore complex.
  • a wide variety of CENH3 proteins have been identified. See, e.g., SEQ ID NOs: l- 48. It will be appreciated that the above list is not intended to be exhaustive and that additional CENH3 sequences are available from genomic studies or can be identified from genomic databases or by well-known laboratory techniques. For example, where a particular plant or other organism species CENH3 is not readily available from a database, one can identify and clone the organism's CENH3 gene sequence using primers, which are optionally degenerate, based on conserved regions of other known CENH3 proteins.
  • CENH3 histone fold domain is conserved between CENH3 proteins from different species.
  • the CENH3 histone fold domain can be distinguished by three oc-helical regions connected by loop sections. While it will be appreciated that the exact location of the histone fold domain will vary in CENH3 proteins from other species, it will be found at the carboxyl terminus of an endogenous (wildtype) CENH3 protein.
  • a CENH3 protein can be identified in an endogenous protein as having a carboxyl terminal domain substantially similar (e.g., at least 30%, 40%, 50%, 60%, 70%, 85%, 90%, 95% or more identity) to any of SEQ ID NO:s 49-94.
  • FIG. 1 An alignment of a selection of CENH3 proteins is provided in Figure 1 and illustrates areas of conservation in the histone fold domain.
  • the border between the tail domain and the histone fold domain of CENH3 proteins is at, within, or near (i.e., within 5, 10, 15, 20, or 25 amino acids from the "P" of) the conserved PGTVAL (SEQ ID NO: 114) sequence.
  • the PGTVAL (SEQ ID NO: 114) sequence is approximately 81 amino acids from the N terminus of the Arabidopsis CENH3 protein, though the distance from the N terminus of different endogenous CENH3 proteins varies. See, for example, the sequence listing.
  • the histone fold region of CENH3 employed in the tailswap proteins includes all of the C-terminal amino acids of an endogenous CENH3 protein (or a protein substantially similar to the endogenous sequence) up to and including the PGTVAL (SEQ ID NO: 114). SEQ ID NOS:49-94 reflect this option.
  • the tailswap proteins of the invention can comprise more or less of the CENH3 sequence.
  • the tailswap will comprise the C-terminal sequence of a CENH3 protein, but only up to an amino acid 5, 10, 15, 20, or 25 amino acids in the C-terminal direction from the "P" of the conserved PGTVAL (SEQ ID NO: l 14) sequence.
  • the tailswap will comprise the C- terminal sequence of a CENH3 protein, but only up to an amino acid 5, 10, 15, 20, or 25 amino acids in the N-terminal direction from the "P" of the conserved PGTVAL (SEQ ID NO: 114) sequence.
  • CENH3 histone-fold domain of CENH3 evolves more rapidly than that of conventional H3, CENH3 and H3 histone-fold domains can still be aligned.
  • N- terminal tail domains of CENH3 are highly variable even between closely related species.
  • Histone tail domains are flexible and unstructured, as shown by their lack of strong electron density in the structure of the nucleosome determined by X- ray crystallography (Luger et al, Nature 389(6648):251-60 (1997)).
  • any number of mutations of CENH3 can be introduced into a CENH3 protein to generate a mutated (including but not limited to a recombinantly altered) CENH3 protein capable of generating haploid plants when expressed in a plant lacking, or having suppressed expression of, an endogenous CENH3 protein, and where the resulting transgenic plant is crossed to a plant expressing a wildtype CENH3 protein.
  • Active mutated CENH3 proteins can be identified, for example, by random mutagenesis, by single or multiple amino acid targeted mutagenesis, by generation of complete or partial protein domain deletions, by fusion with heterologous amino acid sequences, or by combinations thereof.
  • Active mutant CENH3 proteins refer to proteins, which when expressed in a plant in which CENH3 is knocked out or inactivated, results in viable plants, which viable plants when crossed to a wildtype plant, produce haploid progeny at a more than normal frequency (e.g., at least 0.1, 0.5, 1, 5, 10, 20% or more). Mutated CENH3 proteins can be readily tested by recombinant expression of the mutated CENH3 protein in a plant lacking endogenous CENH3 protein, crossing the transgenic plant (as a male or female, depending on fertility) to a plant expression wildtype CENH3 protein, and then screening for the production of haploid progeny.
  • the mutated CENH3 protein is identical to an endogenous CENH3 protein but for 1, 2, 3, 4, 5, 6, 7, 8, or more (e.g., 1-2, 1-4, 1-7) amino acids.
  • the endogenous wildtype protein from the plant is identical or substantially identical to any of SEQ ID NOs: 1-48 and the mutated CENH3 protein differs from the endogenous CENH3 protein by 1, 2, 3, 4, 5, 6, 7, 8, or more (e.g., 1-2, 1-4, 1-7) amino acids.
  • the mutated CENH3 protein contains a CENH3 histone-fold domain identical to the CENH3 histone-fold domain of an endogenous CENH3 protein but for 1, 2, 3, 4 , 5, 6, 7, 8, or more (e.g., 1-2, 1-4, 1-7) amino acids.
  • the endogenous wildtype CENH3 histone-fold domain from the plant is identical or substantially identical to any of SEQ ID NOs: 49-94 and the mutated CENH3 protein contains a CENH3 histone-fold domain that differs from the endogenous CENH3 protein histone-fold domain by 1, 2, 3, 4, 5, 6, 7, 8, or more (e.g., 1-2, 1-4, 1-7) amino acids.
  • active CENH3 mutants include, for example, proteins comprising: a heterologous amino acid sequence (including but not limited to GFP) linked to a CENH3 truncated or complete tail domain or non-CENH3 tail domain, either of which is linked to a CENH3 histone fold domain; or
  • CENH3 truncated tail domain a CENH3 truncated tail domain, a heterologous CENH3 tail domain, or non- CENH3 tail domain, either of which is linked to a CENH3 histone fold domain.
  • the mutated CENH3 protein comprises a fusion of an amino- terminal heterologous amino acid sequence to the histone-fold domain of a CENH3 protein.
  • the histone fold domain will be identical or at least substantially identical to the CENH3 protein endogenous to the organism in which the mutated CENH3 protein will be expressed.
  • the mutated CENH3 protein will include a histone tail domain, which can be, for example, a non-CENH3 tail domain, or a CENH3 tail domain.
  • the heterologous sequence is linked directly to the CENH3 histone-fold domain.
  • the heterologous sequence is linked is an intervening amino acid sequence to the CENH3 histone-fold domain.
  • the intervening amino acid sequence is an intact or truncated CENH3 tail domain.
  • the heterologous amino acid sequence in combination with the histone-fold domain, will be sufficient to prevent the lethality associated with loss of endogenous CENH3, but will sufficiently disrupt centromeres to allow for production of haploid progeny, as discussed herein.
  • the heterologous amino acid sequence will comprise a portion that is, or mimics the function of, a histone tail domain and optionally can also comprise a bulky amino acid sequence that disrupts centromere function.
  • CENH3 protein comprises any amino acid sequence of at least 10, 20, 30, 40, 50, e.g., 10-30, 10-50, 20-50, 30-60 amino acids, optionally lacking a stable secondary structure (e.g., lacking coils, helices, or beta-sheets).
  • the tail domain has less than 90, 80, or 70% identity with the tail domain (e.g., the N-terminal 135 amino acids) of the CENH3 protein endogenous to the organism in which the mutated CENH3 protein will be expressed.
  • the tail domain of the mutated CENH3 protein comprises the tail domain of a non-CENH3 histone protein, including but not limited to an H3 histone protein.
  • the tail domain of the mutated CENH3 protein comprises the tail domain of a non-CENH3 histone protein endogenous to the organism in which the mutated CENH3 protein will be expressed.
  • the tail domain of the mutated CENH3 protein comprises the tail domain of a homologous or orthologous (from a different plant species) CENH3 tail. For example, it has been found that GFP fused to a maize CENH3 tail domain linked to an Arabidopsis CENH3 histone-fold domain is active.
  • the tail domain of an H3 histone (not to be confused with a CENH3 histone) is used as the tail domain portion of the mutated CENH3 protein (these embodiments are sometimes referred to as "tailswap" proteins).
  • Plant H3 tail domains are well conserved in various organisms.
  • a common H3 tail domain from plants is SEQ ID NO:95.
  • the heterologous tail portion of the tailswap protein will comprise an amino acid sequence substantially identical (e.g., at least 70, 80, 90, 95, or 100% identical) to SEQ ID NO:95, or a fragment thereof at least 15, 20, 25, 30, 35, or 40 amino acids long.
  • the mutated CENH3 proteins of the invention will lack at least a portion (e.g., at least 5, 10, 15, 20, 25, 30, or more amino acids) of the endogenous CENH3 N-terminal region, and thus, in some embodiments, will have a truncated CENH3 tail domain compared to a wildtype endogenous CENH3 protein.
  • Mutated CENH3 proteins may, or may not, be linked to a heterologous sequence.
  • the heterologous amino acid sequence can comprise, or further comprise, one or more amino acid sequences at the amino and/or carboxyl terminus and/or linking the tail and histone fold domains.
  • the mutated CENH3 protein e.g., a tailswap or other CENH3 mutated protein
  • the heterologous sequence is linked to the amino terminus of an otherwise wildtype CENH3 protein, wherein the heterologous sequence interferes with centromere function.
  • the heterologous sequence can be any sequence that disrupts the CENH3 protein's ability to maintain centromere function.
  • the heterologous sequence comprises a an amino acid sequence of at least 5, 10, 15, 20, 25, 30, 50, or more kD.
  • the mutated CENH3 protein will comprise a protein domain that acts as a detectable or selectable marker.
  • an exemplary selectable marker protein is fluorescent or an antibiotic or herbicide resistance gene product. Selectable or detectable protein domains are useful for monitoring the presence or absence of the mutated CENH3 protein in an organism.
  • NON-CENH3 KINETOCHORE PROTEINS [0079] It is believed that other proteins that make up the kinetochore complex can also be mutated and expressed in a plant that otherwise does not express the corresponding endogenous kinetochore complex protein to result in a viable plant which, when crossed to a wildtype plant having a wildtype kinetochore complex, generates haploid progeny at a certain frequency (e.g., at least 0.1, 0.5, 1, 5, 10, 20,%, or more) .
  • exemplary non-CENH3 members of the kinetochore complex include, e.g., CENPC, MCM21, MIS 12, NDC80, and NUF2.
  • Active mutated non-CENH3 kinetochore complex proteins e.g., CENPC, MCM21, MIS 12, NDC80, or NUF2
  • CENPC CENPC
  • MCM21, MIS 12, NDC80, or NUF2 can be identified, for example, by random mutagenesis, single or multiple amino acid targeted mutagenesis, by generation or complete or partial protein domain deletions, by fusion with heterologous amino acid sequences, or combinations thereof.
  • Active mutant non-CENH3 kinetochore complex proteins refer to proteins, which when expressed in a plant in which the corresponding non-CENH3 kinetochore complex protein is knocked out or inactivated, results in viable plants, which when crossed to a wildtype plant, produce haploid progeny at a more than normal frequency (e.g., at least 1, 5, 10, 20% or more).
  • active mutated CENPC, MCM21, MIS 12, NDC80, or NUF2 polypeptides are substantially identical to SEQ ID NOs: 96, 97, 98, 99, or 100, respectively.
  • Mutated non-CENH3 kinetochore complex proteins can be readily tested by recombinant expression of the mutated non-CENH3 kinetochore complex protein in a plant lacking endogenous non-CENH3 kinetochore complex protein, crossing the transgenic plant (as a male or female, depending on fertility) to a plant expressing a wildtype non-CENH3 kinetochore complex protein, and then screening for the production of haploid progeny.
  • the mutated non-CENH3 kinetochore complex protein is identical to an endogenous non-CENH3 kinetochore complex protein but for 1, 2, 3, 4, 5, 6, 7, 8, or more (e.g., 1-2, 1-4, 1-7) amino acids.
  • the endogenous wildtype protein from the plant is identical or substantially identical to any of SEQ ID NOs: 96, 97, 98, 99, or 100 and the mutated non-CENH3 kinetochore complex protein differs from the endogenous non-CENH3 kinetochore complex protein by 1, 2, 3, 4, 5, 6, 7, 8, or more (e.g., 1-2, 1-4, 1-7) amino acids.
  • the heterologous amino acid sequence can comprise one or more amino acid sequences at the amino and/or carboxyl terminus and/or linking the tail and histone fold domains.
  • the mutated non-CENH3 kinetochore complex protein comprises a heterologous amino acid sequence linked to an amino end of the non- CENH3 kinetochore complex protein.
  • the heterologous sequence can be any sequence.
  • the heterologous sequence is linked to the amino terminus of an otherwise wildtype non-CENH3 kinetochore complex protein, wherein the heterologous sequence interferes with centromere function.
  • the heterologous sequence comprises a an amino acid sequence of at least 5, 10, 15, 20, 25, 30, 50, or more kD.
  • the mutated non-CENH3 kinetochore complex protein will comprise a protein domain that acts as a detectable or selectable marker.
  • an exemplary selectable marker protein is fluorescent or an antibiotic or herbicide resistance gene product. Selectable or detectable protein domains are useful for monitoring the presence or absence of the mutated non-CENH3 kinetochore complex protein in an organism.
  • the present invention provides for organisms that do not express, or express at reduced levels (e.g., less than 90, 80, 70, 60, 50, 40, 30, 20, or 10% of wildtype levels), an endogenous CENH3 protein or non-CENH3 kinetochore complex protein and optionally that express a corresponding mutated CENH3 protein or non-CENH3 kinetochore complex protein.
  • reduced levels e.g., less than 90, 80, 70, 60, 50, 40, 30, 20, or 10% of wildtype levels
  • an endogenous CENH3 protein or non-CENH3 kinetochore complex protein e.g., less than 90, 80, 70, 60, 50, 40, 30, 20, or 10% of wildtype levels
  • an endogenous CENH3 protein or non-CENH3 kinetochore complex protein e.g., less than 90, 80, 70, 60, 50, 40, 30, 20, or 10% of wildtype levels
  • a kinetochore complex protein e.g., CENH3, CENPC, MCM21 , MIS 12, NDC80, or NUF2
  • Progeny from the heterozygote can then be selected that are homozygous for the mutation or knockout but that comprise the recombinantly expressed heterologous mutated kinetochore complex protein.
  • the invention provides plants, plant cells or other organisms in which one or both CENH3 alleles are knocked out or mutated to significantly or essentially completely lack CENH3 activity, i.e., sufficient to induce embryo lethality without a complementary expression of a mutated kinetochore complex protein as described herein (e.g., a tailswap protein).
  • the invention also provides plants, plant cells or other organisms in which one or both alleles of a non-CENH3 kinetochore complex gene are knocked out or mutated to significantly or essentially completely lack the corresponding non-CENH3 kinetochore complex protein activity, i.e., sufficient to induce embryo lethality without a complementary expression of a mutated kinetochore complex protein as described herein.
  • plants having more than a diploid set of chromosomes e.g. tetraploids
  • all alleles can be inactivated, mutated, or knocked out.
  • a mutated kinetochore complex protein e.g., including but not limited to, a tailswap protein
  • an intact set of kinetochore complex protein e.g., CENH3, CENPC, MCM21, MIS 12, NDC80, or NUF2
  • endogenous kinetochore complex protein e.g., CENH3, CENPC, MCM21, MIS 12, NDC80, or NUF2
  • an siRNA or microRNA can be introduced or expressed in the organism that reduces or eliminates expression of the endogenous kinetochore complex protein (e.g., CENH3, CENPC, MCM21, MIS 12, NDC80, or NUF2) protein.
  • endogenous kinetochore complex protein e.g., CENH3, CENPC, MCM21, MIS 12, NDC80, or NUF2
  • the silencing siRNA or other silencing agent is selected to silence the endogenous kinetochore complex protein (e.g., CENH3, CENPC, MCM21, MIS 12, NDC80, or NUF2) gene but does not substantially interfere with expression of the mutated endogenous kinetochore complex protein (e.g., CENH3, CENPC, MCM21, MIS 12, NDC80, or NUF2) gene but does not substantially interfere with expression of the mutated endogenous kinetochore complex protein (e.g., CENH3, CENPC, MCM21, MIS 12, NDC80, or NUF2) gene but does not substantially interfere with expression of the mutated endogenous kinetochore complex protein (e.g., CENH3, CENPC, MCM21, MIS 12, NDC80, or NUF2) gene but does not substantially interfere with expression of the mutated endogenous kinetochore complex protein (e.g., CENH3, CENPC, MCM21,
  • kinetochore complex protein e.g., a tailswap protein
  • endogenous CENH3 is to be inactivated, this can be achieved, for example, by targeting the siRNA to the N-terminal tail coding section, or untranslated portions, or the CENH3 mRNA, depending on the structure of the mutated kinetochore complex protein.
  • the mutated kinetochore complex protein transgene can be designed with novel codon usage, such that it lacks sequence homology with the endogenous kinetochore complex protein gene and with the silencing siRNA. IV. REDUCTION OR ELIMINATION OF ENDOGENOUS KINETOCHORE
  • a number of methods can be used to inhibit, mutate, or inactivate expression of a kinetochore complex protein (e.g., CENH3, CENPC, MCM21, MIS 12, NDC80, or NUF2) in plants.
  • a kinetochore complex protein e.g., CENH3, CENPC, MCM21, MIS 12, NDC80, or NUF2
  • antisense technology can be conveniently used to inactivate gene expression.
  • a nucleic acid segment from the desired gene is cloned and operably linked to a promoter such that the antisense strand of RNA will be transcribed.
  • the expression cassette is then transformed into plants and the antisense strand of RNA is produced.
  • antisense RNA inhibits gene expression by preventing the accumulation of mRNA which encodes the polypeptide of interest, see, e.g., Sheehy et al, Proc. Nat. Acad. Sci. USA, 85:8805-8809 (1988); Pnueli et al, The Plant Cell 6: 175-186 (1994); and Hiatt et al, U.S. Patent No. 4,801,340.
  • the antisense nucleic acid sequence transformed into plants will be substantially identical to at least a portion of the endogenous gene or genes to be repressed. The sequence, however, does not have to be perfectly identical to inhibit expression.
  • a kinetochore complex protein e.g., CENH3, CENPC, MCM21, MIS 12, NDC80, or NUF2
  • mRNA including but not limited to untranslated portions of the
  • the vectors of the present invention are optionally designed such that the inhibitory effect applies only to a kinetochore complex protein (e.g., CENH3, CENPC, MCM21, MIS 12, NDC80, or NUF2) and does not affect expression of other genes.
  • a kinetochore complex protein e.g., CENH3, CENPC, MCM21, MIS 12, NDC80, or NUF2
  • one method for achieving this goal is to target the antisense sequence to CENH3 sequences (e.g., tail or untranslated mRNA sequences) not found in other proteins within a family of genes exhibiting homology or substantial homology to the CENH3 gene.
  • the introduced sequence also need not be full length relative to either the primary transcription product or fully processed mRNA. Generally, higher homology can be used to compensate for the use of a shorter sequence. Furthermore, the introduced sequence need not have the same intron or exon pattern, and homology of non- coding segments may be equally effective. For example, a sequence of between about 30 or 40 nucleotides can be used, and in some embodiments, about full length nucleotides should be used, though a sequence of at least about 20, 50, 100, 200, or 500 nucleotides can be used.
  • Catalytic RNA molecules or ribozymes can also be used to inhibit expression of a kinetochore complex protein (e.g., CENH3, CENPC, MCM21, MIS 12, NDC80, or NUF2) genes. It is possible to design ribozymes that specifically pair with virtually any target RNA and cleave the phosphodiester backbone at a specific location, thereby functionally inactivating the target RNA. In carrying out this cleavage, the ribozyme is not itself altered, and is thus capable of recycling and cleaving other molecules, making it a true enzyme. The inclusion of ribozyme sequences within antisense RNAs confers RNA-cleaving activity upon them, thereby increasing the activity of the constructs.
  • a kinetochore complex protein e.g., CENH3, CENPC, MCM21, MIS 12, NDC80, or NUF2
  • RNAs A number of classes of ribozymes have been identified.
  • One class of ribozymes is derived from a number of small circular RNAs that are capable of self-cleavage and replication in plants.
  • the RNAs replicate either alone (viroid RNAs) or with a helper virus (satellite RNAs). Examples include RNAs from avocado sunblotch viroid and the satellite RNAs from tobacco ringspot virus, lucerne transient streak virus, velvet tobacco mottle virus, solanum nodiflorum mottle virus and subterranean clover mottle virus.
  • the design and use of target RNA-specific ribozymes is described in Haseloff et al. Nature, 334:585-591 (1988).
  • sense suppression also known as co- suppression
  • Introduction of expression cassettes in which a nucleic acid is configured in the sense orientation with respect to the promoter has been shown to be an effective means by which to block the transcription of target genes.
  • this method to modulate expression of endogenous genes see, Napoli et al., The Plant Cell 2:279-289
  • the introduced sequence generally will be substantially identical to the endogenous sequence intended to be repressed. This minimal identity will typically be greater than about 65% to the target a kinetochore complex protein (e.g., CENH3, CENPC, MCM21, MIS 12, NDC80, or NUF2) sequence, but a higher identity can exert a more effective repression of expression of the endogenous sequences.
  • a kinetochore complex protein e.g., CENH3, CENPC, MCM21, MIS 12, NDC80, or NUF2
  • sequences with substantially greater identity are used, e.g., at least about 80, at least about 95%, or 100% identity are used.
  • antisense regulation the effect can be designed and tested so as to not significantly affect expression of other proteins within a similar family of genes exhibiting homology or substantial homology.
  • the introduced sequence in the expression cassette needing less than absolute identity, also need not be full length, relative to either the primary transcription product or fully processed mRNA. This may be preferred to avoid concurrent production of some plants that are overexpressers. A higher identity in a shorter than full length sequence compensates for a longer, less identical sequence. Furthermore, the introduced sequence need not have the same intron or exon pattern, and identity of non- coding segments will be equally effective. In some embodiments, a sequence of the size ranges noted above for antisense regulation is used, i.e., 30-40, or at least about 20, 50, 100, 200, 500 or more nucleotides.
  • RNAi RNA interference
  • co-suppression can be considered a type of RNAi, which uses a double- stranded RNA having a sequence identical or similar to the sequence of the target gene.
  • RNAi is the phenomenon in which when a double- stranded RNA having a sequence identical or similar to that of the target gene is introduced into a cell, the expressions of both the inserted exogenous gene and target endogenous gene are suppressed.
  • the double-stranded RNA may be formed from two separate complementary RNAs or may be a single RNA with internally complementary sequences that form a double-stranded RNA.
  • complete details of the mechanism of RNAi are still unknown, it is considered that the introduced double-stranded RNA is initially cleaved into small fragments, which then serve as indexes of the target gene in some manner, thereby degrading the target gene.
  • RNAi is known to be also effective in plants (see, e.g., Chuang, C. F. & Meyerowitz, E. M., Proc. Natl. Acad. Sci. USA 97: 4985 (2000); Waterhouse et al, Proc. Natl. Acad. Sci. USA 95: 13959-13964 (1998); Tabara et al. Science 282:430-431 (1998); Matthew, Comp Funct. Genom. 5: 240-244
  • a double-stranded RNA having the sequence of an mRNA encoding the kinetochore complex protein e.g., CENH3, CENPC, MCM21 , MIS 12, NDC80, or NUF2
  • a substantially similar sequence thereof including those engineered not to translate the protein or fragment thereof, is introduced into a plant or other organism of interest.
  • RNAi RNAi RNAi RNAi RNAi RNAi .
  • the genes used for RNAi need not be completely identical to the target gene, they may be at least 70%, 80%, 90%, 95% or more identical to the target (e.g., CENH3 sequences as described herein) gene sequence. See, e.g., U.S., Patent Publication No. 2004/0029283 for an example of a non-identical siRNA sequence used to suppress gene expression.
  • RNA molecules with a stem-loop structure that is unrelated to the target gene and that is positioned distally to a sequence specific for the gene of interest may also be used to inhibit target gene expression. See, e.g., U.S. Patent Publication No. 2003/0221211.
  • the RNAi polynucleotides can encompass the full-length target RNA or may correspond to a fragment of the target RNA. In some cases, the fragment will have fewer than 100, 200, 300, 400, 500 600, 700, 800, 900 or 1,000 nucleotides corresponding to the target sequence. In addition, in some embodiments, these fragments are at least, e.g., 10, 15, 20, 50, 100, 150, 200, or more nucleotides in length.
  • fragments for use in RNAi will be at least substantially similar to regions of a target protein that do not occur in other proteins in the organism or may be selected to have as little similarity to other organism transcripts as possible, e.g., selected by comparison to sequences in analyzing publicly- available sequence databases.
  • Expression vectors that continually express siRNA in transiently- and stably- transfected have been engineered to express small hairpin RNAs, which get processed in vivo into siRNAs molecules capable of carrying out gene-specific silencing (Brummelkamp et al, Science 296:550-553 (2002), and Paddison, et al, Genes & Dev. 16:948-958 (2002)).
  • Post- transcriptional gene silencing by double-stranded RNA is discussed in further detail by Hammond et al. Nature Rev Gen 2: 110-119 (2001), Fire et al. Nature 391 : 806-811 (1998) and Timmons and Fire Nature 395: 854 (1998).
  • sense including but not limited to siRNA
  • antisense transcript should be targeted to sequences with the most variance between family members where the goal is to target only one (e.g., CENH3, CENPC, MCM21, MIS 12, NDC80, or NUF2) histone family member.
  • microRNA that suppresses a target (e.g., a CENH3, CENPC, MCM21, MIS 12, NDC80, or NUF2 gene).
  • a target e.g., a CENH3, CENPC, MCM21, MIS 12, NDC80, or NUF2 gene.
  • Artificial microRNAs are single-stranded RNAs (e.g., between 18-25 mers, generally 21 mers), that are not normally found in plants and that are processed from endogenous miRNA precursors.
  • Methods for introducing genetic mutations into plant genes and selecting plants with desired traits are well known and can be used to introduce mutations or to knock out a kinetochore complex protein (e.g., CENH3, CENPC, MCM21, MIS 12, NDC80, or NUF2).
  • a kinetochore complex protein e.g., CENH3, CENPC, MCM21, MIS 12, NDC80, or NUF2.
  • seeds or other plant material can be treated with a mutagenic insertional polynucleotide (e.g., transposon, T-DNA, etc.) or chemical substance, according to standard techniques.
  • a mutagenic insertional polynucleotide e.g., transposon, T-DNA, etc.
  • chemical substances include, but are not limited to, the following: diethyl sulfate, ethylene imine, ethyl methanesulfonate and N-nitroso-N-ethylure
  • ionizing radiation from sources such as, X-rays or gamma rays can be used.
  • Plants having mutated a kinetochore complex protein e.g., CENH3, CENPC, MCM21, MIS 12, NDC80, or NUF2 can then be identified , for example, by phenotype or by molecular techniques.
  • Modified protein chains can also be readily designed utilizing various recombinant DNA techniques well known to those skilled in the art and described for instance, in
  • Hydroxylamine can also be used to introduce single base mutations into the coding region of the gene (Sikorski et al., Meth. Enzymol., 194:302-318 (1991)).
  • the chains can vary from the naturally occurring sequence at the primary structure level by amino acid substitutions, additions, deletions, and the like. These modifications can be used in a number of combinations to produce the final modified protein chain.
  • homologous recombination can be used to induce targeted gene modifications or knockouts by specifically targeting the a kinetochore complex protein gene (e.g., CENH3, CENPC, MCM21, MIS12, NDC80, or NUF2) gene in vivo (see, generally, Grewal and Klar, Genetics, 146: 1221-1238 (1997) and Xu et al., Genes Dev., 10:241 1-2422 (1996)). Homologous recombination has been demonstrated in plants (Puchta et al.,
  • kinetochore complex protein gene sequences including 5' upstream, 3' downstream, and intragenic regions
  • mutations in selected portions of an kinetochore complex protein gene sequences are made in vitro and then introduced into the desired plant using standard techniques. Since the efficiency of homologous recombination is known to be dependent on the vectors used, use of dicistronic gene targeting vectors as described by Mountford et al, Proc. Natl. Acad. Sci. USA, 91 :4303-4307 (1994); and Vaulont et al, Transgenic Res., 4:247-255 (1995) are conveniently used to increase the efficiency of selecting for altered CENH3 gene expression in transgenic plants. The mutated gene will interact with the target wild-type gene in such a way that homologous recombination and targeted replacement of the wild-type gene will occur in transgenic plant cells, resulting in suppression of kinetochore complex protein activity.
  • DNA vectors suitable for transformation of plant cells are prepared. Techniques for transforming a wide variety of higher plant species are well known and described in the technical and scientific literature, e.g., Weising et al., Ann. Rev. Genet. 22:421-477 (1988).
  • a DNA sequence coding for the desired polypeptide for example the tailswap protein fusions as described herein and/or siRNA, antisense, or other silencing constructs, will be combined with transcriptional and translational initiation regulatory sequences which will direct the transcription of the sequence from the gene in the intended tissues of the transformed plant.
  • a plant promoter fragment may be employed which will direct expression of the gene in all tissues of a regenerated plant.
  • the plant promoter may direct expression of the polynucleotide of the invention in a specific tissue (tissue- specific promoters), organ (organ-specific promoters) or may be otherwise under more precise environmental control (inducible promoters).
  • tissue-specific promoters under developmental control include promoters that initiate transcription only in certain tissues, such as fruit, seeds, flowers, pistils, or anthers.
  • Suitable promoters include those from genes encoding storage proteins or the lipid body membrane protein, oleosin.
  • polyadenylation region at the 3'-end of the coding region should be included.
  • the polyadenylation region can be derived from the natural gene, from a variety of other plant genes, or from T-DNA.
  • the vector comprising the sequences (e.g., promoters or coding regions) from genes of the invention can also comprise, for example, a marker gene that confers a selectable phenotype on plant cells.
  • the marker may encode biocide resistance, particularly antibiotic resistance, such as resistance to kanamycin, G418, bleomycin, hygromycin, or herbicide resistance, such as resistance to chlorosulfuron or Basta.
  • a promoter, or an active fragment thereof can be employed which will direct expression of a nucleic acid encoding a fusion protein of the invention, in all transformed cells or tissues, e.g. as those of a regenerated plant.
  • Such promoters are referred to herein as "constitutive" promoters and are active under most environmental conditions and states of development or cell differentiation.
  • constitutive promoters include those from viruses which infect plants, such as the cauliflower mosaic virus (CaMV) 35S transcription initiation region (see, e.g., Dagless, Arch. Virol. 142: 183-191 (1997)); the ⁇ - or 2'- promoter derived from T-DNA of Agrobacterium tumefaciens (see, e.g., Mengiste supra (1997);
  • an inducible promoter to control (1) expression of an artificial micro RNA, siRNA, or other silencing polynucleotide, (2) and simultaneously turn on expression of the transgenic mutated (e.g., tailswap) protein, or (3) both (1) and (2).
  • An alternative is to down-regulate the endogenous protein (e.g. by gene silencing) in a specific tissue (e.g., at least in the mature gametophytes (either pollen or embryo sac)) and to replace it only in this tissue with a specific promoter that drives expression of a tailswap protein.
  • a specific tissue e.g., at least in the mature gametophytes (either pollen or embryo sac)
  • a specific promoter that drives expression of a tailswap protein.
  • the same tissue-specific promoter is used to drive an artificial micro RNA, siRNA, or other silencing polynucleotide and the rescuing tailswap- encoding transgene.
  • DNA constructs of the invention may be introduced into the genome of the desired plant host by a variety of conventional techniques.
  • the DNA construct may be introduced directly into the genomic DNA of the plant cell using techniques such as electroporation and microinjection of plant cell protoplasts, or the DNA constructs can be introduced directly to plant tissue using biolistic methods, such as DNA particle
  • the DNA constructs may be combined with suitable T-DNA flanking regions and introduced into a conventional Agrobacterium tumefaciens host vector.
  • the virulence functions of the Agrobacterium tumefaciens host will direct the insertion of the construct and adjacent marker into the plant cell DNA when the cell is infected by the bacteria.
  • Microinjection techniques are known in the art and well described in the scientific and patent literature. The introduction of DNA constructs using polyethylene glycol precipitation is described in Paszkowski et al., Embo J. 3:2717-2722 (1984). Electroporation techniques are described in Fromm et al., Proc. Natl. Acad. Set USA 82:5824 (1985).
  • Transformed plant cells which are derived by any of the above transformation techniques can be cultured to regenerate a whole plant which possesses the transformed genotype and thus the desired phenotype such as increased disease resistance compared to a control plant that was not transformed or transformed with an empty vector.
  • Such regeneration techniques rely on manipulation of certain phytohormones in a tissue culture growth medium, typically relying on a biocide and/or herbicide marker which has been introduced together with the desired nucleotide sequences. Plant regeneration from cultured protoplasts is described in Evans et ah, Protoplasts Isolation and Culture, Handbook of Plant Cell Culture, pp. 124-176, MacMillilan Publishing Company, New York, 1983; and Binding, Regeneration of Plants, Plant Protoplasts, pp. 21-73, CRC Press, Boca Raton, 1985.
  • Regeneration can also be obtained from plant callus, explants, organs, or parts thereof. Such regeneration techniques are described generally in Klee et al., Ann. Rev. of Plant Phys.
  • nucleic acids and encoded polypeptides of the invention can be used to confer the characteristics described herein, including the ability to generate haploid progeny, as described herein, on essentially any plant.
  • the invention has use over a broad range of plants, including dicots or monocots, including e.g., species from the genera Asparagus, Atropa, Avena, Brassica, Citrus, Citrullus, Capsicum, Cucumis, Cucurbita, Daucus,
  • Crossing plants that lack an endogenous kinetochore complex protein and express an active mutated kinetochore complex protein as described herein e.g., a tailswap or other mutated CENH3 or non-CENH3 kinetochore complex protein
  • an endogenous kinetochore complex protein e.g., CENH3, CENPC, MCM21, MIS 12, NDC80, or NUF2 protein
  • progeny e.g., at least 0.1%, 0.5%, 1%, 5%, 10%, 20% or more
  • the present invention allows for the generation of haploid plants having all of its chromosomes from a plant of interest by crossing the plant of interest with a plant transgenically expressing the mutated kinetochore complex protein and collecting the resulting haploid seed.
  • the plant expressing an endogenous wildtype CENH3 protein can be crossed as either the male or female parent.
  • One unique aspect of the present invention is that it allows for generation of a plant (or other organism) having only a male parent's nuclear chromosomes and a female parent's cytoplasm with associated mitochondria and plastids, when the tailswap parent is the male parent.
  • CENH3 protein made up of GFP-histone H3 tail-CENH3 histone-fold domain have limited male fertility, it has been found that plants lacking an endogenous CENH3 gene and expressing both a mutated CENH3 protein made up of GFP-histone H3 tail-CENH3 histone- fold domain and GFP-wildtype CENH3 results in plants with higher male fertility making them convenient for use as a male, as well as female, parent in crossing.
  • the invention provides for expression of two or more different mutated kinetochore complex proteins in a plant (e.g., a plant lacking expression of the corresponding endogenous kinetochore complex protein(s).
  • haploid plants can be used for a variety of useful endeavors, including but not limited to the generation of doubled haploid plants, which comprise an exact duplicate copy of chromosomes. Such doubled haploid plants are of particular use to speed plant breeding, for example. A wide variety of methods are known for generating doubled haploid organisms from haploid organisms.
  • Somatic haploid cells, haploid embryos, haploid seeds, or haploid plants produced from haploid seeds can be treated with a chromosome doubling agent.
  • Homozygous double haploid plants can be regenerated from haploid cells by contacting the haploid cells, including but not limited to haploid callus, with chromosome doubling agents, such as colchicine, anti-microtubule herbicides, or nitrous oxide to create homozygous doubled haploid cells.
  • Methods can involve, for example, contacting the haploid cell with nitrous oxide, anti-microtubule herbicides, or colchicine.
  • the haploids can be transformed with a heterologous gene of interest, if desired.
  • Double haploid plants can be further crossed to other plants to generate Fl, F2, or subsequent generations of plants with desired traits. VIII. Non-plant organisms
  • the invention is also functional in non-plant organisms that do not have unmatched sex chromosomes.
  • Those of skill in the art can thus generate a mutated kinetochore complex protein (including but not limited to a tailswap protein) based on a particular organism's kinetochore complex protein (e.g., CENH3, CENPC, MCM21, MIS 12, NDC80, or NUF2) protein sequence and knockout the corresponding endogenous
  • kinetochore complex protein gene as appropriate for that organisms.
  • exemplary non-plant organisms for which the invention is believed to be applicable include, but is not limited to, yeast and other fungi, as well as to animals that lack unmatched (e.g., XY) sex or other chromosomes for whom haploids are not viable.
  • haploid plants that inherit chromosomes from only one parent can greatly accelerate plant breeding (Dunwell, J. M., Plant Biotechnol J in press; Forster, B. P. et al., Trends Plant Sci 12:368-75 (2007); Forster, B. P. & Thomas, W. T. B. in Plant Breeding Reviews (ed. Janick, J.) 57-88 (John Wiley & Sons, Inc., 2005)).
  • Haploids generated from a heterozygous individual and converted to diploid create instant homozygous lines, bypassing generations of inbreeding.
  • haploids Two methods are generally used to produce haploids: First, cultured gametophyte cells may be regenerated into haploid plants (Guha, S. & Maheshwari, S. C, Nature 204:497 (1964)), but many species and genotypes are recalcitrant to this process (Forster, B. P. et al., Trends Plant Sci 12:368-75 (2007); Wedzony, M. et al. in Advances in Haploid Production in Higher Plants (eds. Touraev, A., Forster, B. P. & Jain, S. M.) 1-33 (Springer, 2009)).
  • haploids can be induced from rare interspecific crosses, in which one parental genome is eliminated after fertilization (Bains, G. S. & Howard, H. W., Nature 166:795 (1950); Barclay, I. R., Nature 256:410-411 (1975); Burk, L. G. et al, Science 206:585 (1979); Clausen, R. E. & Mann, M. C, Proc Natl Acad Sci U S A 10: 121-124 (1924); Hougas, H. W. & Peloquin, S. J., Nature 180: 1209-1210 (1957); Kasha, K. J. & Kao, K. N., Nature 225:874-6 (1970)).
  • centromeres from the two parent species interact unequally with the mitotic spindle, causing selective chromosome loss (Bennett, M. D. et al., Chromosoma 54: 175-200 (1976); Finch, R. A., Chromosoma 88:386- 393 (1983); Why, D. A. & Bennett, M. D., Genome 32:953-961 (1989)).
  • haploid Arabidopsis thaliana can be easily generated through seeds by manipulating a single centromere protein, the centromere-specific histone CENH3/CENP-A.
  • Centromeres are the chromosomal loci that attach to spindle microtubules to mediate faithful inheritance of the genome during cell division. They are epigenetically specified by incorporation of CENH3 (CENP-A in humans, HTR12 in A. thaliana (T albert, P. B. et al., Plant Cell 14: 1053-66 (2002))), a histone H3 variant that replaces conventional H3 in centromeric nucleosomes (Henikoff, S.
  • Cenh3-1 an embryo-lethal null mutant in A. thaliana that allows us to completely replace native CENH3 with modified variants, was isolated.
  • cenh3-l plants complemented by transgenic green fluorescent protein-tagged CENH3 (GFP-CENH3) have a wild-type phenotype.
  • cenh3-l can also be rescued by "GFP-tailswap" , a transgene in which the hypervariable N-terminal tail domain of CENH3 was replaced with the tail of conventional H3, using the H3.3 variant (encoded by Atlgl3370).
  • GFP-tailswap was tagged at its N- terminus with GF and contained the N-terminal tail of H3 fused to the histone fold domain of CENH3 as follows:
  • H3 tail MARTKQSARKSHGGKAPTKQLATKAARKSAPTTGGVKKPHRFR (SEQ ID NO:95) joined to the CENH3 histone fold domain:
  • GFP-ta ⁇ l wap plants (cenh3-l rescued by a GFP-tailswap transgene) showed accurate mitosis, as aneuploidy in somatic cells was not detected.
  • GFP-tailswap plants were sterile upon flowering, indicating that they may have a specific defect in meiosis.
  • GFP- tailswap was mostly male sterile, although it could be used as a pollen donor if many anthers were pooled. When crossed as the female to a wild type male, GFP-tailswap plants were 60- 70% as fertile as wild type.
  • Table 1 1 Haploid plants contain only the nuclear genome of their wild type parent.
  • GFP-CENH3 diploids triploids aneuploids
  • haploid plants missegregated and lost, creating haploid plants with chromosomes only from their wild type parent.
  • GFP-tailswap plants in the Col-0 accession
  • haploid plants were crossed to several polymorphic accessions and genotyped Fl haploids for markers on all five A. thaliana chromosomes (Table 1).
  • haploid plants invariably contained only wild-type chromosomes (paternal haploids), indicating that the GFP-tailswap genome was eliminated (a total of 42 haploids were genotyped).
  • our results show that the process of inducing haploids by centromere-mediated genome elimination is independent of the genotype of the wild-type parent.
  • Genome elimination induced by CENH3 alterations is not specific to the GFP- tailswap transgene.
  • Crossing cenh3-l mutants complemented by GFP-CENH3 to wild type also yielded haploid plants, but at a lower frequency than GFP-tailswap (Table 1).
  • Haploid progeny from self-fertilized GFP-tailswap or GFP-CENH3 plants were not observed (Table 1).
  • Our results suggest that general perturbations in centromere structure are sufficient to impede chromosome segregation during zygotic mitosis, creating a haploid embryo when chromosomes containing mutant CENH3 compete with wild type on the same spindle.
  • Haploids are efficiently generated from a GFP-tailswap x wild type cross, comprising 25-45% of viable offspring (Table 1). Remaining progeny were either diploid hybrids, or aneuploid hybrids showing the developmental phenotypes typical of A. thaliana plants with more than 10 chromosomes (Henry, I. M. et al., Genetics 170: 1979-88 (2005)) (Table 1). Aneuploidy might also account for the high level of seed abortion in a GFP- tailswap x wild type cross, as some embryos with unbalanced karyotypes may be inviable.
  • Uniparental haploids may contain the genome of either their female or male parent. Haploids were also obtained by crossing a wild-type female to GFP-tailswap as the pollen donor (Table 1). In this case, haploid progeny are purely maternal in origin. Genotyping of the plastid genome showed that both maternal and paternal haploids contained the cytoplasm of their maternal parent. Either maternal or paternal haploids were made by using GFP- tailswap plants as the male or female parent respectively in a cross to wild type. The proportion of haploids and aneuploids was much lower if a wild-type female was crossed to a GFF '-tailswap male (Table 1).
  • CENH3 is expressed earlier in development from the maternal (wild type) genome, wild-type CENH3 could be incorporated into paternal chromosomes derived from GFP-tailswap, preventing genome elimination in a wild type x GFP-tailswap cross.
  • Hapioid A. thaliana plants are morphologically similar to diploids, but are comparatively smaller in size. Early in vegetative development, haploids have narrower rosette leaves. After bolting, haploids produce more leaves from secondary meristems. Hapioid flowers are smaller than diploid flowers, following the general trend that flower size increases with ploidy in A. thaliana. Haploids are generally sterile. They contain a single copy of each chromosome and cannot undergo homologue pairing in meiosis, resulting in gametes that do not contain a full complement of chromosomes. Maternal and paternal hapioid plants had similar adult morphology. This is consistent with the fact that all documented imprinting in A. thaliana occurs in the short-lived endosperm, a structure confined to the seed.
  • haploids To exploit the potential of haploids in crop improvement, their genome should be doubled to generate fertile diploids (doubled haploids) (Forster, B. P., et al. Trends Plant Sci 12:368-75 (2007)). A close inspection of A. thaliana haploids revealed that random siliques had one or two seeds. Each hapioid plant yielded a total of 50-2500 seeds depending on the wild-type parental accession (Table S I).
  • thaliana plants was observed; a side branch from the main inflorescence (2 out of 78 plants) or a random silique (6 out of 78 plants) showed a complete seed set.
  • the microtubule polymerization inhibitor colchicine also induces somatic chromosome doubling in haploid A. thaliana, and diploid shoots that regenerate after treatment show complete seed set.
  • A. thaliana haploids have been produced through anther culture (Avetisov, V. A., Genetika, 12: 17-25 (1976)), spontaneous diploids recovered in these experiments were reportedly sterile (Scholl, R. & Amos, J. A., Z convincedphysiol 96:407-414 (1980)), and the method has not been widely adopted.
  • the ease of generating haploids through seed by altering CENH3, and of converting haploids into diploids allows large scale generation of doubled haploids in A. thaliana.
  • Haploid inducing lines have been described in the grasses (Coe, E. H., American Naturalist 93:381-382 (1959); Hagberg, A. & Hagberg, G., Hereditas 93:341-343 (1980); Kermicle, J. L., Science 166: 1422-1424 (1969)), but their genetic basis is not known, except for maize indeterminate gametophyte (ig) (Evans, M. M., Plant Cell 19:46-62 (2007)). The effect of ig may be limited to maize, because mutations in the A. thaliana ig orthologue AS2 do not phenocopy its effect (Ori, N. et al., Development 127:5523-32 (2000)).
  • GFP-CENH3 and GFP-tailswap transgenes contained an N-terminal GFP, and used the endogenous CENH3 promoter and terminator. The location of the GFP-tailswap transgene was determined by TAIL-PCR, allowing us to determine whether the transgene was homozygous or hemizygous.
  • the C24/Ler male sterile line was a gift from Dr Luca Comai (University of California, Davis). Male sterility was conferred by the A9-barnase transgene. Plants were grown under 16 hrs of light / 8 hours of dark at 20 degrees C.
  • Genomic DNA preparation and PCR genotyping were performed using standard methods.
  • cenh3-l was predicted to disrupt normal splicing of CENH3, because it mutates a conserved splice acceptor site at the beginning of the second coding exon. Translation of an mRNA containing the first coding exon spliced to an incorrect location within CENH3 is predicted to yield only 18 correct amino acids. As the histone-fold domain of CENH3 begins at amino acid residue 82, it is believed that cenh3-l is a null allele (this is supported by its embryo-lethal phenotype).
  • the percentage of normal seeds was determined by visual inspection using a dissecting microscope.
  • the quartet mutant used was qrtl-2 (Francis, K. E. et al., Plant Physiol 142: 1004- 13 (2006)).
  • Mitotic and meiotic chromosome spreads from anthers were prepared according to published protocols (Ross, K. J. et al., Chromosome Res 4:507-16 (1996)).
  • Colchicine treatment of developing haploid plants used a previously published protocol with minor modifications (Josefsson, C. et al., Curr Biol 16: 1322-8 (2006)).
  • a solution of 0.25% colchicine, 0.2% Silwet was prepared, and a 20 ⁇ drop was placed on the meristem prior to bolting. Plants became transiently sick after colchicine treatment. Upon recovery, fertile inflorescences appeared from secondary meristems indicating successful chromosome doubling. Haploid plants can also be treated after bolting, although the rate of success is considerably lower.
  • GFP -maizetailsw p creates Fl haploids in a cross to wild type
  • a chimera was created in which the A. thaliana CENH3 tail from CENH3 is replaced with the CENH3 tail domain (SEQ ID NO: 102) from maize (Zea mays), thereby generating a fusion of the maize CENH3 tail and A. thaliana CENH3 histone-fold domain, and transformed the fusion into cenh3-l heterozygotes.
  • this GFP- maizetailswap protein was targeted to kinetochores and rescued the embryo-lethal phenotype of cenh3-l.
  • Complemented plants were more sterile than GFP-tailswap complemented plants, but had limited fertility when used as the female.
  • cenh3-l GFP -maizetailswap females were crossed to wild-type males, 2 haploids, 3 diploids and 5 aneuploids were found among a total of 10 Fl progeny.
  • mCherry-tailswap creates Fl haploids in a cross to wild type
  • a transgene was created in which the GFP tag in GFP-tailswap was replaced with an N-terminal mCherry tag (mCherry (SEQ IDNO: 105) is a monomeric version of the red fluorescent protein DsRed). From N-terminus to C-terminus, this protein contains mCherry, the tail domain of Arabidopsis thaliana H3.3, and the histone fold domain of Arabidopsis thaliana CENH3. mCherry -tailswap transgenes were transformed into cenh3-l heterozygotes. When complemented cenh3-l mCherry -tailswap plants were crossed as female to wild-type male, 1 haploid, 6 aneuploids and 4 diploids were observed from 11 Fl progeny.
  • the mCherry-tailswap construct was made as a CP 169 vector pCAMBIA 1300 with an HTR promoter.
  • the insert included a Mlu I site followed by the N terminal mcherry Sal I Xbal followed by HTR 12 terminator.
  • the H3 Tailswap fragment was synthesized by overlapping PCR and digested with Sail +Xba I and cloned into CP 169 to make the mcherrytailswap construct.
  • a tailswap transgene with no GFP tag complements a cenh3-l mutation.
  • Complemented plants create Fl haploids in a cross to wild type
  • a transgene was created in which the GFP tag in GFP-tailswap was removed. From N-terminus to C-terminus, this protein contains the tail domain of Arabidopsis thaliana H3.3, and the histone fold domain of Arabidopsis thaliana CENH3. tailswap transgenes were transformed into cenh3-l heterozygotes. When complemented cenh3-l tailswap plants were crossed as female to wild-type male, 4 haploids, 27 aneuploids and 67 diploids were observed from 95 Fl progeny.
  • Co-expression of different CENH3 variants creates desirable properties in a genome elimination strain.
  • GFP-tailswap plant cenh3-l mutant plants rescued by a GFP-tailswap transgene
  • GFP-CENH3 cenh3-l mutant plants rescued by a GFP-CENH3 transgene
  • GFP-CENH3 and GFP-tailswap in cenh3-l plants would produce more viable pollen than GFP-tailswap, yet still induce genome elimination when these plants were crossed to wild-type diploid or tetraploids.
  • GEM plants are a major improvement over GFP-tailswap or GFP-CENH3 when the wild-type parent is a tetraploid that has diploid gametes.
  • chromosomes from the GEM parent were eliminated in a subset of Fl progeny (Table 3).
  • GEM is fertile as either male or female, and shows efficient genome elimination when crossed to a tetraploid parent with diploid gametes.
  • Maize tailswap CENH3 transgene was constructed by fusing in frame the Maize CENH3 N- terminal tail (corresponding to l-61aa ) and Arabidopsis CENH3 histone fold domain (corresponding to 82-179 aa) by overlapping PCR.
  • the maize N terminal tail domain (206 bp) was amplified from maize cDNA using the primer combinations CP 384 (5'- NNNNgtcgacATGGCTCGAACCAAGCACCA-3' (SEQ ID NO: l 10), Sail site is italiziced) and CP 572 (5 ' -C AACGGTTCCTGGCCTCC AGCGGTGGC-3 ' (SEQ ID NO: 111)).
  • Arabidopsis HFD (950 bp) was amplified from genomic DNA using primer combinations CP 571 (5 ' -GCC ACCGCTGG AGGCC AGGA ACCGTTG-3 ' (SEQ ID NO: 112)) and CP 375 (5 ' -NNNNtci gaTC ACC ATGGTCTGCCTTTTCCTCC-3 ' (SEQ ID NO: l 13), Xbal site is italiziced).
  • the resultant fragments were gel purified and used as a template to fuse them in an overlapping PCR using primer combinations CP 384 and CP 375.
  • the resultant 1.15kb fragment is cloned as a Sall-Xbal fragment in a binary vector CP 93 (derived from pCAMBIA 1300).
  • the vector CP 93 contains GFP coding sequence upstream in frame with Sall-Xbal site and its expression is controlled by the 5' and 3' regulatory sequences of Arabidopsis CENH3 gene.

Landscapes

  • Health & Medical Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Organic Chemistry (AREA)
  • Molecular Biology (AREA)
  • Biomedical Technology (AREA)
  • Wood Science & Technology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • General Engineering & Computer Science (AREA)
  • Biotechnology (AREA)
  • Zoology (AREA)
  • General Health & Medical Sciences (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Physics & Mathematics (AREA)
  • Cell Biology (AREA)
  • Plant Pathology (AREA)
  • Microbiology (AREA)
  • Botany (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Medicinal Chemistry (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Breeding Of Plants And Reproduction By Means Of Culturing (AREA)
  • Peptides Or Proteins (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Developmental Biology & Embryology (AREA)
  • Environmental Sciences (AREA)

Abstract

L'invention concerne des procédés et des compositions pour générer des organismes haploïdes.
PCT/US2010/051483 2009-10-06 2010-10-05 Génération de plantes haploïdes et sélection de plantes améliorée WO2011044132A1 (fr)

Priority Applications (10)

Application Number Priority Date Filing Date Title
EP19177524.6A EP3560951B1 (fr) 2009-10-06 2010-10-05 Génération de plantes haploïdes et sélection de plantes améliorée
ES10822533T ES2774722T3 (es) 2009-10-06 2010-10-05 Generación de plantas haploides y fitomejoramiento mejorado
MX2016007969A MX349747B (es) 2009-10-06 2010-10-05 Generacion de plantas haploides y cruza de plantas mejorada.
CA2774941A CA2774941C (fr) 2009-10-06 2010-10-05 Generation de plantes haploides et selection de plantes amelioree
RU2012118381/10A RU2571927C2 (ru) 2009-10-06 2010-10-05 Создание гаплоидных растений и усовершенствование селекции растений
AU2010303635A AU2010303635B2 (en) 2009-10-06 2010-10-05 Generation of haploid plants and improved plant breeding
MX2012003981A MX2012003981A (es) 2009-10-06 2010-10-05 Generacion de plantas haploides y cruza de plantas mejorada.
EP10822533.5A EP2486135B1 (fr) 2009-10-06 2010-10-05 Génération de plantes haploïdes et sélection de plantes améliorée
BR112012007692-2A BR112012007692B1 (pt) 2009-10-06 2010-10-05 Polipeptídeo, e, método para gerar uma planta da progênie f1 tendo metade da ploidia de uma planta precursora
AU2015200432A AU2015200432B2 (en) 2009-10-06 2015-01-29 Generation of haploid plants and improved plant breeding

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US24899609P 2009-10-06 2009-10-06
US61/248,996 2009-10-06

Publications (1)

Publication Number Publication Date
WO2011044132A1 true WO2011044132A1 (fr) 2011-04-14

Family

ID=43824181

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2010/051483 WO2011044132A1 (fr) 2009-10-06 2010-10-05 Génération de plantes haploïdes et sélection de plantes améliorée

Country Status (9)

Country Link
US (4) US8618354B2 (fr)
EP (2) EP3560951B1 (fr)
AU (1) AU2010303635B2 (fr)
CA (2) CA2774941C (fr)
CL (1) CL2012000877A1 (fr)
ES (2) ES2974294T3 (fr)
MX (3) MX2012003981A (fr)
RU (1) RU2571927C2 (fr)
WO (1) WO2011044132A1 (fr)

Cited By (18)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2012142311A1 (fr) * 2011-04-15 2012-10-18 Pioneer Hi-Bred International, Inc. Plantes hybrides autoreproductrices
EP2554045A1 (fr) 2011-08-04 2013-02-06 Rijk Zwaan Zaadteelt en Zaadhandel B.V. Procédé pour influencer systématiquement des processus dans le méiocyte mâle
EP2574234A1 (fr) 2011-09-29 2013-04-03 Rijk Zwaan Zaadteelt en Zaadhandel B.V. Reproduction de quadruplets
EP2679089A1 (fr) 2012-06-29 2014-01-01 Rijk Zwaan Zaadteelt en Zaadhandel B.V. Ensemble de conteneur roulant modulaire
US9006515B2 (en) 2012-01-06 2015-04-14 Pioneer Hi Bred International Inc Pollen preferred promoters and methods of use
WO2015066011A3 (fr) * 2013-10-29 2015-07-16 Pioneer Hi-Bred International, Inc. Plantes hybrides autoreproductrices
WO2016005467A1 (fr) 2014-07-08 2016-01-14 Rijk Zwaan Zaadteelt En Zaadhandel B.V. Procédé de fabrication de bibliothèques de substitution de chromosomes
EP2989889A1 (fr) * 2014-08-28 2016-03-02 Kws Saat Se Génération de plantes haploïdes
WO2016030019A1 (fr) * 2014-08-28 2016-03-03 Kws Saat Se Production de plantes haploïdes
WO2016075255A1 (fr) * 2014-11-12 2016-05-19 Kws Saat Se Inducteurs haploïdes
EP3037540A1 (fr) * 2014-12-23 2016-06-29 Kws Saat Se Inducteur d'haploïdes
WO2017058022A1 (fr) 2015-10-02 2017-04-06 Keygene N.V. Procédé de production d'haploïdes et de dihaploïdes subséquents
WO2017058023A1 (fr) 2015-10-02 2017-04-06 Keygene N.V. Procédé de production de plantes haploïdes et de plantes haploïdes doublées consécutives
WO2017081009A1 (fr) * 2015-11-09 2017-05-18 Rijk Zwaan Zaadteelt En Zaadhandel B.V. Lignes inductrices d'haploïdes non transgéniques dans les cucurbitacées
WO2017081011A1 (fr) 2015-11-09 2017-05-18 Rijk Zwaan Zaadteelt En Zaadhandel B.V. Lignées inductrices d'haploïdes non transgéniques chez les cucurbitacées
WO2017200386A1 (fr) 2016-05-20 2017-11-23 Keygene N.V. Procédé pour la production de plantes haploïdes et double haploïdes successives
EP3512329A4 (fr) * 2016-09-14 2020-03-04 Monsanto Technology LLC Méthodes et compositions d'édition génomique par induction d'haploïde
RU2788349C2 (ru) * 2016-12-02 2023-01-17 Зингента Партисипейшнс Аг Одновременное редактирование генов и индукция гаплоидов

Families Citing this family (19)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
MX2012003981A (es) 2009-10-06 2012-06-12 Univ California Generacion de plantas haploides y cruza de plantas mejorada.
CN104769115A (zh) * 2012-06-07 2015-07-08 富优基尼以色列股份有限公司 用于增强植物光合活性的组合物和方法
WO2014110274A2 (fr) * 2013-01-09 2014-07-17 Regents Of The University Of California A California Corporation Génération de plantes haploïdes
CN104342450B (zh) * 2013-07-24 2017-08-25 中国农业大学 培育玉米单倍体诱导率高于玉米单倍体诱导系cau5的玉米单倍体诱导系的方法
CN104335889B (zh) * 2013-07-24 2016-03-02 中国农业大学 诱导玉米单倍体的方法
US20160192608A1 (en) * 2014-01-23 2016-07-07 The Board Of Regents Of The University Of Nebraska Epigenetically Enhanced Double Haploids
WO2015168158A1 (fr) * 2014-04-28 2015-11-05 Fredy Altpeter Édition d'un génome ciblé pour modifier la biosynthèse de la lignine et la composition de la paroi cellulaire
WO2016138021A1 (fr) * 2015-02-24 2016-09-01 CHAN, Bee Yong Induction d'haploïdes
EP3159413A1 (fr) 2015-10-22 2017-04-26 Leibniz-Institut für Pflanzengenetik und Kulturpflanzenforschung (IPK); OT Gatersleben Génération de plantes haploïdes basées sur knl2
AU2017234920B2 (en) 2016-03-18 2023-08-17 E. I. Du Pont De Nemours And Company Methods and compositions for producing clonal, non-reduced, non-recombined gametes
US11447787B2 (en) 2017-04-10 2022-09-20 The Regents Of The University Of California Generation of haploid plants
US11155825B2 (en) 2017-10-05 2021-10-26 Iowa State University Research Foundation, Inc. Methods and compositions for generating doubled haploid plants and use of same in breeding
WO2019136417A2 (fr) * 2018-01-08 2019-07-11 The Regents Of The University Of California Mutants de délétion cenh3
CN109943585B (zh) * 2018-04-12 2020-05-15 中国水稻研究所 一种利用植物杂种优势的方法
CR20210496A (es) 2019-04-01 2021-10-25 Syngenta Crop Protection Ag Aumento de la transformabilidad de las plantas por transferencia de citotipo
CA3138663A1 (fr) 2019-06-25 2020-12-30 Inari Agriculture Technology, Inc. Edition amelioree du genome de reparation dependant de l'homologie
CN116782762A (zh) * 2020-05-29 2023-09-19 科沃施种子欧洲股份两合公司 植物单倍体诱导
AU2021286555A1 (en) * 2020-06-09 2023-02-02 Cold Spring Harbor Laboratory Heterozygous CENH3 monocots and methods of use thereof for haploid induction and simultaneous genome editing
WO2023222908A1 (fr) 2022-05-19 2023-11-23 Leibniz-Institut für Pflanzengenetik Und Kulturpflanzenforschung (IPK) Génération de plantes haploïdes sur la base de la nouvelle protéine knl2

Citations (11)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4801340A (en) 1986-06-12 1989-01-31 Namiki Precision Jewel Co., Ltd. Method for manufacturing permanent magnets
US5034323A (en) 1989-03-30 1991-07-23 Dna Plant Technology Corporation Genetic engineering of novel plant phenotypes
US5231020A (en) 1989-03-30 1993-07-27 Dna Plant Technology Corporation Genetic engineering of novel plant phenotypes
US5770788A (en) 1990-04-23 1998-06-23 Jia; Xu Inducing chromosome doubling in anther culture in maize
US20030221211A1 (en) 2002-01-30 2003-11-27 Arborgen, Llc Methods of suppressing gene expression
US20040029283A1 (en) 2002-06-21 2004-02-12 Fillatti Joanne J. Intron double stranded RNA constructs and uses thereof
US20040210959A1 (en) 2003-03-19 2004-10-21 Monsanto Technology Llc A Novel Method for Production of Transformed Dihaploid Corn Plants
US20050289673A1 (en) 2004-06-25 2005-12-29 Monsanto Technology Llc A Novel Method for Agrobacterium Transformation for Dihaploid Corn Plants
US7135615B2 (en) 2001-06-05 2006-11-14 The Curators Of The University Of Missouri Chromosome doubling method
US20080313773A1 (en) 2007-05-14 2008-12-18 The Rockefeller University Production of artificial micrornas using synthetic microrna precursors
US20090144849A1 (en) * 2002-02-11 2009-06-04 Lutfiyya Linda L Nucleic acid molecules and other molecules associated with transcription in plants

Family Cites Families (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
GB9313975D0 (en) * 1993-07-06 1993-08-18 Sandoz Ltd Improvements in or relating to organic compounds
US5749169A (en) 1995-06-07 1998-05-12 Pioneer Hi-Bred International, Inc. Use of the indeterminate gametophyte gene for maize improvement
US8030556B2 (en) 2008-07-17 2011-10-04 Pioneer Hi-Bred International, Inc. Highly transformable elite doubled haploid line PH17AW
EP2208790A1 (fr) 2009-01-07 2010-07-21 Institut National De La Recherche Agronomique (I.N.R.A.) Plantes produisant des gamètes 2N ou issus d'une apoméiose
MX2012003981A (es) 2009-10-06 2012-06-12 Univ California Generacion de plantas haploides y cruza de plantas mejorada.
CA2819491C (fr) 2010-12-01 2020-04-21 Institut National De La Recherche Agronomique Reproduction clonale par voie synthetique par le biais de graines

Patent Citations (12)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4801340A (en) 1986-06-12 1989-01-31 Namiki Precision Jewel Co., Ltd. Method for manufacturing permanent magnets
US5034323A (en) 1989-03-30 1991-07-23 Dna Plant Technology Corporation Genetic engineering of novel plant phenotypes
US5231020A (en) 1989-03-30 1993-07-27 Dna Plant Technology Corporation Genetic engineering of novel plant phenotypes
US5283184A (en) 1989-03-30 1994-02-01 Dna Plant Technology Corporation Genetic engineering of novel plant phenotypes
US5770788A (en) 1990-04-23 1998-06-23 Jia; Xu Inducing chromosome doubling in anther culture in maize
US7135615B2 (en) 2001-06-05 2006-11-14 The Curators Of The University Of Missouri Chromosome doubling method
US20030221211A1 (en) 2002-01-30 2003-11-27 Arborgen, Llc Methods of suppressing gene expression
US20090144849A1 (en) * 2002-02-11 2009-06-04 Lutfiyya Linda L Nucleic acid molecules and other molecules associated with transcription in plants
US20040029283A1 (en) 2002-06-21 2004-02-12 Fillatti Joanne J. Intron double stranded RNA constructs and uses thereof
US20040210959A1 (en) 2003-03-19 2004-10-21 Monsanto Technology Llc A Novel Method for Production of Transformed Dihaploid Corn Plants
US20050289673A1 (en) 2004-06-25 2005-12-29 Monsanto Technology Llc A Novel Method for Agrobacterium Transformation for Dihaploid Corn Plants
US20080313773A1 (en) 2007-05-14 2008-12-18 The Rockefeller University Production of artificial micrornas using synthetic microrna precursors

Non-Patent Citations (110)

* Cited by examiner, † Cited by third party
Title
"Current Protocols in Molecular Biology", vol. 1-3, 1994, JOHN WILEY & SONS, INC
"Generating of rice OsCENH3-GFP transgenic plants and their genetic applications", CHINESE SCIENCE BULL, vol. 53, no. 19, 2008, pages 2981 - 2988, XP008155582 *
"Handbook of Experimental Immunology", vol. I-IV, 1986, BLACKWELL SCIENTIFIC PUBLICATIONS
"Methods In Enzymology", ACADEMIC PRESS, INC.
"Molecular Biology Techniques: An Intensive Laboratory Course", 1998, ACADEMIC PRESS
"Molecular Cloning: A Laboratory Manual", vol. I-III, 1989, COLD SPRING HARBOR LABORATORY PRESS
"PCR (Introduction to Biotechniques Series", 1997, SPRINGER VERLAG
"Remington's Pharmaceutical Sciences", 1990, MACK PUBLISHING CO.
"Short Protocols in Molecular Biology", 1999, JOHN WILEY & SONS
"The Pharmacological Basis of Therapeutics", 2001, MCGRAW-HILL
"Uniprot reference: A4PIF4_LEPVR", 15 May 2007 (2007-05-15), XP008154697, Retrieved from the Internet <URL:http://www.genome.jp/dbget-bin/www_bget?uniprot:A4PIF4 LEPVR> [retrieved on 20101123] *
ALTSCHUL ET AL., J. MOL. BIOL., vol. 215, 1990, pages 403 - 410
ALTSCHUL ET AL., NUC. ACIDS RES., vol. 25, 1977, pages 3389 - 3402
ANTOINE-MICHARD, S. ET AL.: "Plant Cell, Tissue Organ Cult.", vol. 48, 1997, NETHERLANDS, KLUWER ACADEMIC PUBLISHERS, pages: 203 - 207
AVETISOV, V. A., GENETIKA, vol. 12, 1976, pages 17 - 25
BAINS, G. S.; HOWARD, H. W., NATURE, vol. 166, 1950, pages 795
BARCLAY, 1. R., NATURE, vol. 256, 1975, pages 410 - 411
BENNETT, M. D. ET AL., CHROMOSOMA, vol. 54, 1976, pages 175 - 200
BINDING: "Regeneration of Plants, Plant Protoplasts", 1985, CRC PRESS, pages: 21 - 73
BLACK ET AL., CURR OPIN CELL BIOL., vol. 20, no. 1, 2008, pages 91 - 100
BRUMMELKAMP ET AL., SCIENCE, vol. 296, 2002, pages 550 - 553
BURK, L. G. ET AL., SCIENCE, vol. 206, 1979, pages 585
BUSHELL, C. ET AL., PLANT CELL, vol. 15, 2003, pages 1430 - 42
CHASE, S. S., BOTANICAL REVIEW, vol. 35, 1969, pages 117 - 167
CHUANG, C. F.; MEYEROWITZ, E. M., PROC. NATL. ACAD. SCI. USA, vol. 97, 2000, pages 4985
CLAUSEN, R. E.; MANN, M. C., PROC NATL ACAD SCI USA, vol. 10, 1924, pages 121 - 124
COE, E. H., AMERICAN NATURALIST, vol. 93, 1959, pages 381 - 382
COMAI, L.; HENIKOFF, S., PLANT J, vol. 45, 2006, pages 684 - 94
COOPER ET AL., MOL BIOL EVOL., vol. 21, no. 9, 2004, pages 1712 - 8
DAGLESS, ARCH. VIROL., vol. 142, 1997, pages 183 - 191
DUNWELL, J. M., PLANT BIOTECHNOL J
EVANS ET AL.: "Protoplasts Isolation and Culture, Handbook of Plant Cell Culture", 1983, MACMILLILAN PUBLISHING COMPANY, pages: 124 - 176
EVANS, M. M., PLANT CELL, vol. 19, 2007, pages 46 - 62
FINCH, R. A., CHROMOSOMA, vol. 88, 1983, pages 386 - 393
FIRE ET AL., NATURE, vol. 391, 1998, pages 806 - 811
FLAVELL, PROC. NATL. ACAD. SCI., USA, vol. 91, 1994, pages 3490 - 3496
FORSTER, B. P. ET AL., TRENDS PLANT SCI, vol. 12, 2007, pages 368 - 75
FORSTER, B. P.; THOMAS, W. T. B.: "Plant Breeding Reviews", 2005, JOHN WILEY & SONS, INC., pages: 57 - 88
FRALEY ET AL., PROC. NATL. ACAD. SCI. USA, vol. 80, 1983, pages 4803
FRANCIS, K. E. ET AL., PLANT PHYSIOL, vol. 142, 2006, pages 1004 - 13
FROMM ET AL., PROC. NATL. ACAD. SCI. USA, vol. 82, 1985, pages 5824
GREWAL; KLAR, GENETICS, vol. 146, 1997, pages 1221 - 1238
GUHA, S.; MAHESHWARI, S. C., NATURE, vol. 204, 1964, pages 497
HAGBERG, A.; HAGBERG, G., HEREDITAS, vol. 93, 1980, pages 341 - 343
HAMMOND ET AL., NATURE REV GEN, vol. 2, 2001, pages 110 - 119
HASELOFF ET AL., NATURE, vol. 334, 1988, pages 585 - 591
HENIKOFF, S. ET AL., SCIENCE, vol. 293, 2001, pages 1098 - 102
HENIKOFF, S.; DALAL, Y., CURR OPIN GENET DEV, vol. 15, 2005, pages 177 - 84
HENIKOFF; HENIKOFF, PROC. NATL. ACAD. SCI. USA, vol. 89, 1989, pages 10915
HENRY, I. M. ET AL., GENETICS, vol. 170, 2005, pages 1979 - 88
HEPPICH, S. ET AL., THEOR APPL GENET, vol. 61, 1982, pages 101 - 104
HOLTORF: "Comparison of different constitutive and inducible promoters for the overexpression of transgenes in Arabidopsis thaliana", PLANT MOL. BIOL., vol. 29, 1995, pages 637 - 646, XP002036874, DOI: doi:10.1007/BF00041155
HORSCH ET AL., SCIENCE, vol. 233, 1984, pages 496 - 498
HOUGAS, H. W.; PELOQUIN, S. J., NATURE, vol. 180, 1957, pages 1209 - 1210
HUANG ET AL., PLANT MOL. BIOL., vol. 33, 1996, pages 125 - 139
HUANG, PLANT MOL. BIOL., vol. 33, 1997, pages 125 - 139
JAUHAR, P. P. ET AL., CROP SCIENCE, vol. 40, 2000, pages 1742 - 1749
JIN, W. ET AL., PLANT CELL, vol. 16, 2004, pages 571 - 81
JOSEFSSON, C. ET AL., CURR BIOL, vol. 16, 2006, pages 1322 - 8
KARLIN; ALTSCHUL, PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 5873 - 5787
KASHA, K. J.; KAO, K. N., NATURE, vol. 225, 1970, pages 874 - 6
KATO, A., MAIZE GENETICS COOPERATION NEWSLETTER, 1997, pages 36 - 37
KEMPIN ET AL., NATURE, vol. 389, 1997, pages 802 - 803
KERMICLE, J. L., SCIENCE, vol. 166, 1969, pages 1422 - 1424
KLEE ET AL., ANN. REV. OF PLANT PHYS., vol. 38, 1987, pages 467 - 486
KLEIN ET AL., NATURE, vol. 327, 1987, pages 70 - 73
KOOTER; MOL, CURRENT OPIN. BIOL., vol. 4, 1993, pages 166 - 171
LAURIE, D. A.; BENNETT, M. D., GENOME, vol. 32, 1989, pages 953 - 961
LERMONTOVA ET AL.: "Loading of Arabidopsis Centromeric Histone CENH3 Occurs Mainly during G2 and Requires the Presence of the Histone Fold Domain", PLANT CELL, vol. 18, no. 10, 2006, pages 2443 - 2451, XP008154698 *
LI ET AL.: "Fused sister kinetochores initiate the reductional division in meiosis I", NATURE CELL BIOL, vol. 11, no. 9, 16 August 2009 (2009-08-16), pages 1103 - 1108, PG 1104, XP008154684 *
LU ET AL., NUCLEIC ACIDS RESEARCH, vol. 32, no. 21, 2004, pages E171
LUGER ET AL., NATURE, vol. 389, no. 6648, 1997, pages 251 - 60
MAITI, TRANSGENIC RES., vol. 6, 1997, pages 143 - 156
MALIK ET AL., NAT STRUCT BIOL., vol. 10, no. 11, 2003, pages 882 - 91
MANJUNATH ET AL., PLANT MOL. BIOL., vol. 33, 1997, pages 97 - 112
MARTINEZ ET AL., J. MOL. BIOL., vol. 208, 1989, pages 551 - 565
MATTHEW, COMP FUNCT. GENOM., vol. 5, 2004, pages 240 - 244
MILLAR, PLANT MOL. BIOL., vol. 31, 1996, pages 897 - 904
MOUNTFORD ET AL., PROC. NATL. ACAD. SCI. USA, vol. 91, 1994, pages 4303 - 4307
NAGAKI ET AL.: "Sequencing of a rice centromere uncovers active genes", NAT GENET, vol. 36, 2004, pages PG 138 - 145. PG 138, XP008154690 *
NAPOLI ET AL., THE PLANT CELL, vol. 2, 1990, pages 279 - 289
NORRIS ET AL., PLANT MOL. BIOL., vol. 21, 1993, pages 895
OFFRINGA ET AL., PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 7346 - 7350
O'GRADY, PLANT MOL. BIOL., vol. 29, 1995, pages 99 - 108
ORI, N. ET AL., DEVELOPMENT, vol. 127, 2000, pages 5523 - 32
PADDISON ET AL., GENES & DEV., vol. 16, 2002, pages 948 - 958
PASZKOWSKI ET AL., EMBO J., vol. 3, 1984, pages 2717 - 2722
PAUL, W. ET AL., PLANT MOL BIOL, vol. 19, 1992, pages 611 - 22
PNUELI ET AL., THE PLANT CELL, vol. 6, 1994, pages 175 - 186
PUCHTA ET AL., EXPERIENTIA, vol. 50, 1994, pages 277 - 284
ROSS, K. J. ET AL., CHROMOSOME RES, vol. 4, 1996, pages 507 - 16
SAMBROOK ET AL.: "Molecular Cloning - A Laboratory Manual", 1989, COLD SPRING HARBOR LABORATORY
SCHOLL, R.; AMOS, J. A., ZPFLANZENPHYSIOL, vol. 96, 1980, pages 407 - 414
SCHWAB ET AL., THE PLANT CELL, vol. 18, 2006, pages 1121 - 1133
SHEEHY ET AL., PROC. NAT. ACAD. SCI. USA, vol. 85, 1988, pages 8805 - 8809
SIKORSKI ET AL., METH. ENZYMOL., vol. 194, 1991, pages 302 - 318
SOLOCOMBE ET AL., PLANT PHYSIOL., vol. 104, 1994, pages 1167 - 1176
SWOBODA ET AL., EMBO J., vol. 13, 1994, pages 484 - 489
TABARA ET AL., SCIENCE, vol. 282, 1998, pages 430 - 431
TALBERT, P. B. ET AL., PLANT CELL, vol. 14, 2002, pages 1053 - 66
TIMMONS; FIRE, NATURE, vol. 395, 1998, pages 854
UDALL, J. A.; WENDEL, J. F., CROP SCI, vol. 46, 2006, pages S3 - S14
VAULONT ET AL., TRANSGENIC RES., vol. 4, 1995, pages 247 - 255
WAN, Y. ET AL., TRENDS GENETICS, vol. 77, 1989, pages 889 - 892
WAN, Y. ET AL., TRENDS GENETICS, vol. 81, 1991, pages 205 - 211
WATERHOUSE ET AL., PROC. NATL. ACAD. SCI. USA, vol. 95, 1998, pages 13959 - 13964
WEDZONY, M. ET AL.: "Advances in Haploid Production in Higher Plants", 2009, SPRINGER, pages: 1 - 33
WEISING ET AL., ANN. REV. GENET., vol. 22, 1988, pages 421 - 477
XU ET AL., GENES DEV., vol. 10, 1996, pages 2411 - 2422
ZHONG ET AL., MOL. GEN. GENET., vol. 251, 1996, pages 196 - 203

Cited By (54)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN103597080A (zh) * 2011-04-15 2014-02-19 先锋国际良种公司 自繁殖的杂交植物
CN103597080B (zh) * 2011-04-15 2017-07-21 先锋国际良种公司 自繁殖的杂交植物
WO2012142311A1 (fr) * 2011-04-15 2012-10-18 Pioneer Hi-Bred International, Inc. Plantes hybrides autoreproductrices
EP2554045A1 (fr) 2011-08-04 2013-02-06 Rijk Zwaan Zaadteelt en Zaadhandel B.V. Procédé pour influencer systématiquement des processus dans le méiocyte mâle
WO2013017683A1 (fr) 2011-08-04 2013-02-07 Rijk Zwaan Zaadteelt En Zaadhandel B.V Procédé pour influencer de façon systémique des processus dans le meiocyte mâle
US9750205B2 (en) 2011-09-29 2017-09-05 Rijk Zwaan Zaadteelt En Zaadhandel B.V. Quartet breeding
EP2574234A1 (fr) 2011-09-29 2013-04-03 Rijk Zwaan Zaadteelt en Zaadhandel B.V. Reproduction de quadruplets
WO2013045616A1 (fr) 2011-09-29 2013-04-04 Rijk Zwaan Zaadteelt En Zaadhandel B.V. Culture de quartet
CN103957698A (zh) * 2011-09-29 2014-07-30 瑞克斯旺种苗集团公司 四重育种
US9006515B2 (en) 2012-01-06 2015-04-14 Pioneer Hi Bred International Inc Pollen preferred promoters and methods of use
US10785929B2 (en) 2012-06-29 2020-09-29 Rijk Zwaan Zaadteelt En Zaadhandel B.V. Line design
WO2014001467A1 (fr) 2012-06-29 2014-01-03 Rijk Zwaan Zaadteelt En Zaadhandel B.V. Conception de lignée
EP2679089A1 (fr) 2012-06-29 2014-01-01 Rijk Zwaan Zaadteelt en Zaadhandel B.V. Ensemble de conteneur roulant modulaire
CN104411158A (zh) * 2012-06-29 2015-03-11 瑞克斯旺种苗集团公司 品系设计
WO2015066011A3 (fr) * 2013-10-29 2015-07-16 Pioneer Hi-Bred International, Inc. Plantes hybrides autoreproductrices
WO2016005467A1 (fr) 2014-07-08 2016-01-14 Rijk Zwaan Zaadteelt En Zaadhandel B.V. Procédé de fabrication de bibliothèques de substitution de chromosomes
EP2989889A1 (fr) * 2014-08-28 2016-03-02 Kws Saat Se Génération de plantes haploïdes
WO2016030019A1 (fr) * 2014-08-28 2016-03-03 Kws Saat Se Production de plantes haploïdes
CN106998665A (zh) * 2014-08-28 2017-08-01 Kws种子欧洲股份公司 单倍体植物的产生
US11895960B2 (en) 2014-08-28 2024-02-13 KWS SAAT SE & Co. KGaA Generation of haploid plants
EA037899B1 (ru) * 2014-08-28 2021-06-03 Квс Заат Се Создание гаплоидных растений
US10993391B2 (en) 2014-08-28 2021-05-04 KWS SAAT SE & Co. KGaA Generation of haploid plants
CN106998665B (zh) * 2014-08-28 2024-02-27 Kws种子欧洲股份公司 单倍体植物的产生
WO2016075255A1 (fr) * 2014-11-12 2016-05-19 Kws Saat Se Inducteurs haploïdes
US10631482B2 (en) 2014-11-12 2020-04-28 KWS SAAT SE & Co. KGaA Haploid inducers
AU2021225142B2 (en) * 2014-12-23 2023-06-29 KWS SAAT SE & Co. KGaA Generation of haploid plants
US10844401B2 (en) 2014-12-23 2020-11-24 KWS SAAT SE & Co. KGaA Generation of haploid plants
EP4141123A1 (fr) * 2014-12-23 2023-03-01 KWS SAAT SE & Co. KGaA Génération de plantes haploïdes
US20180139917A1 (en) * 2014-12-23 2018-05-24 Kws Saat Se Generation of haploid plants
EP4144853A1 (fr) * 2014-12-23 2023-03-08 KWS SAAT SE & Co. KGaA Génération de plantes haploïdes
EP4144850A1 (fr) * 2014-12-23 2023-03-08 KWS SAAT SE & Co. KGaA Génération de plantes haploïdes
EP4144852A1 (fr) * 2014-12-23 2023-03-08 KWS SAAT SE & Co. KGaA Génération de plantes haploïdes
EP4144854A1 (fr) * 2014-12-23 2023-03-08 KWS SAAT SE & Co. KGaA Génération de plantes haploïdes
EP4144855A1 (fr) * 2014-12-23 2023-03-08 KWS SAAT SE & Co. KGaA Génération de plantes haploïdes
CN107205354A (zh) * 2014-12-23 2017-09-26 Kws种子欧洲股份公司 单倍体诱导物
EP4144851A1 (fr) * 2014-12-23 2023-03-08 KWS SAAT SE & Co. KGaA Génération de plantes haploïdes
WO2016102665A3 (fr) * 2014-12-23 2017-03-16 Kws Saat Se Inducteur haploïde
EP3037540A1 (fr) * 2014-12-23 2016-06-29 Kws Saat Se Inducteur d'haploïdes
AU2015370904B2 (en) * 2014-12-23 2021-07-22 KWS SAAT SE & Co. KGaA Generation of haploid plants
EA039590B1 (ru) * 2014-12-23 2022-02-14 Квс Заат Се Гаплоидный индуктор
US11279947B2 (en) 2015-10-02 2022-03-22 Keygene N.V. Method for the production of haploid and subsequent doubled haploid plants
US10849289B2 (en) 2015-10-02 2020-12-01 Keygene N.V. Method for the production of haploid and subsequent doubled haploid plants
WO2017058022A1 (fr) 2015-10-02 2017-04-06 Keygene N.V. Procédé de production d'haploïdes et de dihaploïdes subséquents
US11576318B2 (en) 2015-10-02 2023-02-14 Keygene N.V. Method for the production of haploid and subsequent doubled haploid plants
WO2017058023A1 (fr) 2015-10-02 2017-04-06 Keygene N.V. Procédé de production de plantes haploïdes et de plantes haploïdes doublées consécutives
NL2015752B1 (en) * 2015-11-09 2017-05-26 Rijk Zwaan Zaadteelt En Zaadhandel Bv Non-transgenic haploid inducer lines in cucurbits.
CN108347893A (zh) * 2015-11-09 2018-07-31 瑞克斯旺种苗集团公司 葫芦科中的非转基因单倍体诱导系
CN108347892A (zh) * 2015-11-09 2018-07-31 瑞克斯旺种苗集团公司 葫芦科中的非转基因单倍体诱导系
WO2017081011A1 (fr) 2015-11-09 2017-05-18 Rijk Zwaan Zaadteelt En Zaadhandel B.V. Lignées inductrices d'haploïdes non transgéniques chez les cucurbitacées
WO2017081009A1 (fr) * 2015-11-09 2017-05-18 Rijk Zwaan Zaadteelt En Zaadhandel B.V. Lignes inductrices d'haploïdes non transgéniques dans les cucurbitacées
WO2017200386A1 (fr) 2016-05-20 2017-11-23 Keygene N.V. Procédé pour la production de plantes haploïdes et double haploïdes successives
US11401524B2 (en) 2016-09-14 2022-08-02 Monsanto Technology, Llc Methods and compositions for genome editing via haploid induction
EP3512329A4 (fr) * 2016-09-14 2020-03-04 Monsanto Technology LLC Méthodes et compositions d'édition génomique par induction d'haploïde
RU2788349C2 (ru) * 2016-12-02 2023-01-17 Зингента Партисипейшнс Аг Одновременное редактирование генов и индукция гаплоидов

Also Published As

Publication number Publication date
ES2974294T3 (es) 2024-06-26
ES2774722T3 (es) 2020-07-22
US20190343060A1 (en) 2019-11-14
US9215849B2 (en) 2015-12-22
BR112012007692A2 (pt) 2017-05-09
EP2486135A4 (fr) 2013-09-18
US20140090099A1 (en) 2014-03-27
CL2012000877A1 (es) 2014-05-09
EP2486135A1 (fr) 2012-08-15
US20160057953A1 (en) 2016-03-03
EP3560951B1 (fr) 2024-02-14
AU2010303635B2 (en) 2014-10-30
RU2571927C2 (ru) 2015-12-27
MX349747B (es) 2017-08-09
US10306848B2 (en) 2019-06-04
RU2012118381A (ru) 2013-11-20
EP2486135B1 (fr) 2020-01-08
CA2774941C (fr) 2022-10-04
MX339939B (es) 2016-06-17
CA2774941A1 (fr) 2011-04-14
US8618354B2 (en) 2013-12-31
US20110083202A1 (en) 2011-04-07
CA3175800A1 (fr) 2011-04-14
AU2010303635A1 (en) 2012-04-19
EP3560951A1 (fr) 2019-10-30
US10912264B2 (en) 2021-02-09
MX2012003981A (es) 2012-06-12

Similar Documents

Publication Publication Date Title
US10912264B2 (en) Generation of haploid plants and improved plant breeding
WO2014110274A2 (fr) Génération de plantes haploïdes
US8878002B2 (en) Nucleic acids and methods for producing seeds with a full diploid complement of the maternal genome in the embryo
US11447787B2 (en) Generation of haploid plants
WO2016124918A1 (fr) Plantes avec graine de taille accrue
JP2003528601A (ja) Ｌｅａｆｙｃｏｔｙｌｅｄｏｎ２遺伝子およびその使用
Watts et al. Brassica juncea lines with substituted chimeric GFP-CENH3 give haploid and aneuploid progenies on crossing with other lines
AU2001241600B2 (en) Leafy cotyledon1 genes and their uses
AU2015200432B2 (en) Generation of haploid plants and improved plant breeding
US7049488B2 (en) Nucleic acids that control seed and fruit development in plants
BR112012007692B1 (pt) Polipeptídeo, e, método para gerar uma planta da progênie f1 tendo metade da ploidia de uma planta precursora
WO2013055867A1 (fr) Gènes impliqués dans la réponse au stress chez les plantes
MX2008007458A (en) Nucleic acids and methods for producing seeds having a full diploid complement of the maternal genome in the embryo

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 10822533

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 2774941

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 2010822533

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 2010303635

Country of ref document: AU

WWE Wipo information: entry into national phase

Ref document number: MX/A/2012/003981

Country of ref document: MX

WWE Wipo information: entry into national phase

Ref document number: 2012000877

Country of ref document: CL

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2010303635

Country of ref document: AU

Date of ref document: 20101005

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 3766/DELNP/2012

Country of ref document: IN

WWE Wipo information: entry into national phase

Ref document number: 2012118381

Country of ref document: RU

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112012007692

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 112012007692

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20120403