WO2011042501A2 - The intestine and muscle recovery - Google Patents
The intestine and muscle recovery Download PDFInfo
- Publication number
- WO2011042501A2 WO2011042501A2 PCT/EP2010/065021 EP2010065021W WO2011042501A2 WO 2011042501 A2 WO2011042501 A2 WO 2011042501A2 EP 2010065021 W EP2010065021 W EP 2010065021W WO 2011042501 A2 WO2011042501 A2 WO 2011042501A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- composition
- accordance
- glp
- rats
- recovery
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/22—Hormones
- A61K38/26—Glucagons
-
- A—HUMAN NECESSITIES
- A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
- A23L—FOODS, FOODSTUFFS OR NON-ALCOHOLIC BEVERAGES, NOT OTHERWISE PROVIDED FOR; PREPARATION OR TREATMENT THEREOF
- A23L33/00—Modifying nutritive qualities of foods; Dietetic products; Preparation or treatment thereof
- A23L33/10—Modifying nutritive qualities of foods; Dietetic products; Preparation or treatment thereof using additives
- A23L33/17—Amino acids, peptides or proteins
- A23L33/18—Peptides; Protein hydrolysates
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/04—Drugs for disorders of the alimentary tract or the digestive system for ulcers, gastritis or reflux esophagitis, e.g. antacids, inhibitors of acid secretion, mucosal protectants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P21/00—Drugs for disorders of the muscular or neuromuscular system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P21/00—Drugs for disorders of the muscular or neuromuscular system
- A61P21/02—Muscle relaxants, e.g. for tetanus or cramps
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/02—Nutrients, e.g. vitamins, minerals
-
- A—HUMAN NECESSITIES
- A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
- A23V—INDEXING SCHEME RELATING TO FOODS, FOODSTUFFS OR NON-ALCOHOLIC BEVERAGES AND LACTIC OR PROPIONIC ACID BACTERIA USED IN FOODSTUFFS OR FOOD PREPARATION
- A23V2002/00—Food compositions, function of food ingredients or processes for food or foodstuffs
Definitions
- the present invention generally relates to the field of nutrition and health.
- the present invention provides a composition that allows it to treat, limit or prevent muscle atrophy.
- Embodiments of the present invention are directed at GLP-2 containing compositions and to compositions that stimulate the secretion of GLP-2 in a body to treat or prevent muscle atrophy.
- Muscle wasting in catabolic states is an indirect cause of morbidity and mortality because the ability of the organism to recover from such catabolic events is strongly impaired. Therefore, a major challenge in clinical nutrition is to improve whole-body protein balance, and hence protein balance in skeletal muscle, which is the major reservoir of body proteins.
- anabolic molecules such as insulin, branched-chain amino acids, or glutamine have minor if any positive effects on muscles in cachectic patients.
- Muscle atrophy is characterized by a partial loss of muscle mass. This muscle atrophy is related either to decrease protein synthesis or to increase protein degradation or to both of them. The consequence of muscle atrophy is usually an impaired quality of life. Daily tasks are becoming more and more difficult to perform and sudden weaknesses may cause accidents. Subjects suffering from muscle atrophy are often elderly subjects and/or subjects suffering from disorders that have shrinking muscle mass as a consequence. Functional electrical stimulation or simply exercise is typical measures to work against muscle atrophy. However, depending on the general condition of the subject to be treated, these methods may not always be applicable.
- the present inventors achieved this object by providing the subject matter of the independent claims.
- the dependent claims further develop the present invention.
- the inventors have performed an in vivo experiment to study the effect of GLP-2 administration on protein metabolism in young rats in a starvation/refeeding model.
- GLP-2 administration did accelerate the recovery of both small intestine and skeletal muscle masses when fasted rats were refed for 6h or 24h.
- the present work also shows that there is a prioritization in the anabolic effect of nutrition: the recovery of the intestine always precedes the recovery of muscle mass.
- the present invention relates to a composition that supports the recovery of the intestine for treating or preventing muscle atrophy.
- composition that supports the recovery of the intestine for the preparation of a composition to treat or prevent muscle atrophy.
- compositions that support the recovery of the intestine are known to the skilled artesian.
- a composition that supports the recovery of the intestinal mass may be a composition comprising intestinal trophic factors.
- Intestinal trophic factors are known to those skilled in the art and comprise growth hormones (GH) , and/or vasoactive intestinal peptide (VIP), for example.
- a composition that supports the recovery of the intestinal mass may be a composition comprising glucagon-like peptide 2 (GLP-2) and/or a composition that stimulates the secretion of GLP-2 in a body. Consequently, the present invention relates to a composition comprising glucagon-1 i ke peptide 2 (GLP-2) for treating or preventing muscle atrophy.
- the present invention also relates to the use of glucagon-like peptide 2 (GLP-2) for the preparation of a composition to treat or prevent muscle atrophy.
- Glucagon-like peptide 2 (GLP-2) is a 33-amino acid peptide derived from the tissue-specific, post-translational processing of the proglucagon gene expressed in the intestinal enteroendocrine L-cells.
- the GLP-2 of the present invention includes human GLP-2 and proteins with at least 87% sequence homology to human GLP-2, preferably at least 90 % sequence homology to human GLP-2, for example at least 95 % sequence homology to human GLP-2.
- Human GLP-2 has the following sequence: HADGSFSDEMNTILDNLAARDFINWLIQTKITD (SEQ-ID No. 1)
- the A at position 2 may be replaced by a G to prevent degradation of GLP-2 by dipeptidyl peptidase IV (DP IV) and thus to increase its half-life.
- DP IV dipeptidyl peptidase IV
- HGDGSFSDEMNTILDNLAARDFINWLIQTKITD (SEQ-ID No. 2)
- GLP-2 proteins that may be used for example in accordance with the present invention are the following: HADGSFSDEMNTILDNLATRDFINWLIQTKITD (SEQ-ID No. 3), or HGDGSFSDEMNTILDNLATRDFINWLIQTKITD (SEQ-ID No. 4) .
- An embodiment of the present invention relates also to a composition comprising glucagon-like peptide 2 (GLP-2) and/or a formulation stimulating the secretion of GLP-2 in a body having a caloric density in the range of 0.8-2.0 kcal/ml with at least 10% of the calories resulting from fat and/or at least 25% of the calories resulting from carbohydrates for use in the treatment, limitation and/or prevention of muscle atrophy .
- GLP-2 glucagon-like peptide 2
- GLP-2 may be ingested to achieve the object of the present invention
- the present invention also relates to compositions that when ingested stimulate GLP-secretion for treating or preventing muscle atrophy.
- One embodiment of the present invention is hence a composition that stimulates the secretion of GLP-2 in a body for treating or preventing muscle atrophy.
- the primary stimulus for GLP-2 secretion is nutrient intake.
- Xiao, Q., et al . report in Gastroenterology 117: 99-105 (1999) that N-IR-GLP-2 levels were found to increase after mixed meals and in - in particular - in response to carbohydrate and fat .
- a composition that stimulates the secretion of GLP-2 in a body may hence be a composition rich in carbohydrates and/or fat.
- Such a composition may have a caloric density in the range of 0.8-2. Okcal/ml with at least 10% of the calories resulting from fat and/or at least 25% of the calories resulting from carbohydrates.
- the composition may or may not comprise a protein source. The protein source - if present - will provide at most 10% of the calories of the composition.
- composition of the present invention may contain at least one protein source, at least one carbohydrate source and/or at least one lipid source.
- the kind of carbohydrate to be used is not particularly limited. Any suitable carbohydrate may be used, for example sucrose, lactose, glucose, fructose, corn syrup solids, maltodextrins , starch and mixtures thereof. Combinations of different carbohydrate sources may be used.
- the carbohydrate source may be present in the composition in an amount of 7.0-19.0 g/lOOkcal of the composition.
- the kind of lipid to be used is not particularly limited. Long chain n-3 and/or n-6 polyunsaturated fatty acids, such as DHA, ARA and/or EPA may be added.
- a suitable fat profile may be obtained using a blend of canola oil, corn oil, high-oleic acid sunflower oil and medium chain triglyceride oil.
- the lipid source may be present in the composition in an amount of 1.5-5.0 g/lOOkcal of the composition.
- the protein source may contain any dietary protein, for example animal proteins (such as milk proteins, meat proteins and egg proteins) ; vegetable proteins (such as soy proteins, wheat proteins, rice proteins, and pea proteins) ; peptides; mixtures of free amino acids; or combinations thereof .
- animal proteins such as milk proteins, meat proteins and egg proteins
- vegetable proteins such as soy proteins, wheat proteins, rice proteins, and pea proteins
- peptides such as soy proteins, wheat proteins, rice proteins, and pea proteins
- mixtures of free amino acids or combinations thereof .
- Milk proteins such as casein and whey, and soy proteins may be preferred.
- the protein source may be based on acid whey or sweet whey or mixtures thereof and may include alpha- lactalbumin and beta- lactoglobulin in whatever proportions are desired.
- the protein source may also include bovine serum albumin, acid casein, caseinates, a-casein, ⁇ -casein, ⁇ -casein.
- the protein source may be present in the composition in an amount of 2.0 -8.5 g/lOOkcal of the composition.
- the proteins may be intact or hydrolysed or free amino acids.
- a mixture of intact and/or hydrolysed proteins and/or free amino acids may be used. It may be desirable to supply partially hydrolysed proteins (degree of hydrolysis (DH) between 2 and 20%) to facilitate absorption.
- DH degree of hydrolysis
- the hydrolysis process may be carried out as desired and as is known in the art.
- a whey protein hydrolysate may be prepared by enzymatically hydrolysing the whey fraction in one or more steps .
- Dietary fibre may be added as well. They may be soluble or insoluble and in general a blend of the two types is preferred Suitable sources of dietary fibre include soy, pea, oat, pectin, guar gum, arabic gum, fructooligosaccharides, galacto- oligosaccharides, sialyl-lactose and oligosaccharides derived from animal milks.
- a preferred fibre blend is a mixture of inulin with shorter chain fructo-oligosaccharides .
- a composition of the present invention may be prepared by any manner known in the art.
- the composition is a nutritional formula, such as clinical nutrition formula or an infant feeding formula it may be prepared by blending together a protein source, a carbohydrate source, and a fat source in appropriate proportions.
- emulsifiers may be included in the blend. Vitamins and minerals may be added at this point but are usually added later to avoid thermal degradation. Any lipophilic vitamins, emulsifiers and the like may be dissolved into the fat source prior to blending. Water, preferably water which has been subjected to reverse osmosis, may then be mixed in to form a liquid mixture.
- the liquid mixture may then be thermally treated to reduce bacterial loads.
- the liquid mixture may be rapidly heated to a temperature in the range of about 120 °C to about 140°C for about 5 seconds to about 30 seconds. This may be carried out by steam injection or by heat exchanger; for example a plate heat exchanger.
- the liquid mixture may then be cooled to about 60°C to about 85°C; for example by flash cooling.
- the liquid mixture may then be homogenised; for example in two stages at about 7 MPa to about 40 MPa in the first stage and about 2 MPa to about 14 MPa in the second stage.
- the homogenised mixture may then be further cooled to add any heat sensitive components; such as vitamins and minerals.
- the pH and solids content of the homogenised mixture is conveniently standardised at this point.
- the homogenised mixture is transferred to a suitable drying apparatus such as a spray drier or freeze drier and converted to powder.
- the powder should have a moisture content of less than about 5% by weight .
- GLP-2 may also be co-administered with a composition that stimulates the secretion of GLP-2 in a body.
- the composition of the present invention may be to be administered to humans or animals, in particular pet animals. It may further be to be administered to patients with an intact colon.
- the composition of the present invention may be any kind of composition.
- the composition may be to be administered orally, enterally, parenterally (intravenously or subcutaneous ly or intramuscularly), for example.
- it may be a pharmaceutical composition, a nutraceutical , a food additive, a pet food, a food product, or a drink.
- Food products according to the present invention include dairy products, such as fermented milk products, e.g., yoghurts, buttermilk, etc; ice creams; concentrated milk; milk; dairy creams; flavoured milk drinks; whey based drinks; toppings; coffee creamers; chocolate; cheese based products; soups; sauces; purees; dressings; puddings; custards; baby foods; nutritional formulas, such as those for complete nutrition, for example for infants, children, teenagers, adults, the elderly or the critically ill; cereals and cereal bars, for example .
- dairy products such as fermented milk products, e.g., yoghurts, buttermilk, etc; ice creams; concentrated milk; milk; dairy creams; flavoured milk drinks; whey based drinks; toppings; coffee creamers; chocolate; cheese based products; soups; sauces; purees; dressings; puddings; custards; baby foods; nutritional formulas, such as those for complete nutrition, for example for infants,
- Drinks include for example milk- or yoghurt based drinks, fermented milk, protein drinks, coffee, tea, energy drinks, soy drinks, fruit and/or vegetable drinks, fruit and/or vegetable juices.
- a food additive or a medicament may be in the form of tablets; capsules; pastilles; sachets; gels; or liquids, e.g., nutritional solutions; for example.
- compositions may further contain protective hydrocolloids (such as gums, proteins, modified starches), binders, film forming agents, encapsulating agents/materials, wall/shell materials, matrix compounds, coatings, emulsifiers, surface active agents, solubilizing agents (oils, fats, waxes, lecithins etc.), adsorbents, carriers, fillers, co-compounds, dispersing agents, wetting agents, processing aids (solvents) , flowing agents, taste masking agents, weighting agents, jellifying agents, gel forming agents, antioxidants and antimicrobials.
- protective hydrocolloids such as gums, proteins, modified starches
- binders film forming agents, encapsulating agents/materials, wall/shell materials, matrix compounds, coatings, emulsifiers, surface active agents, solubilizing agents (oils, fats, waxes, lecithins etc.), adsorbents, carriers, fillers, co-compounds, dis
- They may also contain conventional pharmaceutical additives and adjuvants, excipients and diluents, including, but not limited to, water, gelatine of any origin, vegetable gums, ligninsulfonate, talc, sugars, starch, gum arabic, vegetable oils, polyalkylene glycols, flavouring agents, preservatives, stabilizers, emulsifying agents, buffers, lubricants, colorants, wetting agents, fillers, and the like.
- conventional pharmaceutical additives and adjuvants, excipients and diluents including, but not limited to, water, gelatine of any origin, vegetable gums, ligninsulfonate, talc, sugars, starch, gum arabic, vegetable oils, polyalkylene glycols, flavouring agents, preservatives, stabilizers, emulsifying agents, buffers, lubricants, colorants, wetting agents, fillers, and the like.
- compositions may contain an organic or inorganic carrier material suitable for oral or enteral administration as well as vitamins, minerals trace elements and other micronutrients in accordance with the recommendations of Government bodies such as the USDA.
- a stabilizing agent may be added to stabilize the composition and its constituents.
- flavouring agent and/or a colouring agent may be added to adjust flavours and to give the composition a colour that is easy to identify and/or that is perceived as pleasant.
- compositions of the present invention may be used to improve skeletal muscle recovery. This may be needed in particular in the field of clinical nutrition.
- the compositions of the present invention may also be used to improve small intestine and muscle mass recovery. Importantly, the recovery of the small intestine and of muscle mass, e.g. , skeletal muscle mass may be improved simultaneously by using the compositions described in the present invention.
- the compositions of the present invention may also be for use in increasing liver protein mass regain.
- this combined effect may be achieved by administering only one composition namely a composition comprising glucagon-like peptide 2 (GLP-2), a composition that stimulates the secretion of GLP-2 in a body, or a combination of both.
- GLP-2 glucagon-like peptide 2
- compositions of the present invention may be to be administered during or after a period of malnutrition.
- a period of malnutrition may - for example - be caused by several clinical conditions such as various acute or chronic disorders, e.g., infection, cancer, AIDS, burn injury, trauma, and other. Malnutrition may of course also follow from insufficient food intake or from the consumption of a diet that does not supply all nutrients in sufficient amounts.
- FIG. 3 Chymotrypsin- and trypsin-like activities of the proteasome in the jejunum (A) and the ileum (B) from saline- or GLP-2- injected fed and starved rats. Data represent the slopes of best fit of arbitrary fluorescence units released from the fluorescent substrates (see Examples section) vs. time. Values are expressed in % of saline-injected fed rats and are means ⁇ SEM (vertical bars) for 5 animals per group. Saline injected-fed rats (open bars), GLP-2 injected-fed rats (hatched bars), saline inj ected-starved rats (closed bars) and GLP-2 inj ected-s tarved rats (dot bars) . Bars with different letters are significantly different (P ⁇ 0.05) .
- FIG. 4 Cathepsin (B, B+S, B+L+S and D) activities in the jejunum (A) and the ileum (B) from saline- or GLP-2- injected fed and starved rats.
- Data represent the slopes of best fit of arbitrary fluorescence units released from the fluorescent substrates (see Material and methods section) vs. time. Values are expressed in % of saline-injected fed rats and are means ⁇ SEM (vertical bars) for 5 animals per group. Saline injected- fed rats (open bars), GLP-2 injected-fed rats (hatched bars), saline inj ected-starved rats (closed bars) and GLP-2 injected- starved rats (dot bars) . Bars with different letters are significantly different (P ⁇ 0.05).
- FIG. 1 Small intestinal mass in saline- or GLP-2-inj ected rats following 48h of starvation and 6 or 24h of refeeding. Data are means ⁇ SEM for 5 animals per group. Fed rats (open bars), starved rats (closed bars), 6h re fed-starved rats (hatched bars) and 24h refed-starved rats (grey bars) . Bars with different letters are significantly different (P ⁇ 0.05) .
- FIG. Tibialis anterior, gastrocnemius and EDL muscle masses in saline- or GLP-2-inj ected rats following 48h of starvation and 6 or 24h of refeeding. Data are means ⁇ SEM for 5 animals per group. Fed rats (open bars), starved rats (closed bars) , 6h refed-starved rats (hatched bars) and 24h refed-starved rats (grey bars) . Bars with different letters are significantly different (P ⁇ 0.05) .
- Rat recombinant GLP-2 was purchased from Washington Biotechnology Inc. (Columbia, MD, USA) . [Ala] in position 2 was substituted by [Gly] to make the peptide resistant to DPP IV degradation.
- the GLP-2 peptide sequence used in this study is as follows: HGDGSFSDEMNTILDNLATRDFINWLIQTKITD . Animals, Housing and Experimental Design
- Young male Wistar rats (50-60 g) were obtained from Charles River (L'Arbresle, France) and maintained in a temperature controlled room (22 ⁇ 1°C) with a 12 h light/12 h dark cycle. They were given free access to a standard rodent diet (A03; UAR, Epernay sur Orge, France) and to water during a 5 days acclimatization period. Three experiments were conducted. (1) In the first experiment, rats were fed ad libitum or fasted for 1 or 2 days. At the end of the fasting period, rats were anesthetized with intraperitoneal injection of urethane (1.7 g/kg body weight, Sigma Aldrich, Lyon, France) and sacrificed.
- urethane 1.7 g/kg body weight, Sigma Aldrich, Lyon, France
- the entire small intestine was rapidly excised, rinsed three times with ice-cold PBS, blotted and weighed. Ten cm caudal to the pyloric sphincter and ten cm cranial to the ileo-caecal junction were taken and discarded. Jejunum and ileum were excised, weighed, and divided in small pieces of 5 cm. The first piece was immediately processed for cathepsin activities. The remaining pieces were frozen in liquid nitrogen, and stored at -80°C until further analyses. In experiment 3, skeletal muscles (EDL, gastrocnemius and tibialis anterior) were also carefully dissected and weight.
- the pellet was resuspended in 20 mmol/L sodium acetate buffer (pH 5.5) containing 0.2 mmol/L EDTA and stored at -20°C until further analysis.
- Cathepsin B and cathepsin B+L+S activities were determined using the fluorogenic substrates Z-arginine- arginine-AMC (ZAA-AMC, 50 ymol/L, Sigma), Z-phenylalanine- arginine-AMC (ZPA-AMC, 30 ymol/L, Sigma), respectively.
- the bulk of the cathepsin B+L+S activity measured with ZPA-AMC at pH 7.0 reflects the cathepsin B+S activity.
- the cathepsin D activity was determined using the fluorogenic substrate MOCAc-Gly-Lys- Pro-Ile-Leu-Phe-Arg-Leu-Lys (Dnp) -D-Arg-NH2 (MOCA, 20 ymol/L, Peptide Institute Inc, Osaka, Japan) .
- the peptidase activities were determined by measuring the accumulation of the fluorogenic cleavage product (methylcoumaryl-amide, AMC) at 37 °C during 45 minutes using a luminescence spectrometer FLX800 (Biotek) . Fluorescence was measured continuously at 380 nm excitation and 440 nm emission wavelengths. The time course for the accumulation of AMC after hydrolysis of the substrate was analyzed by linear regression to calculate peptidase activities, e.g. the slopes of best fit of accumulated AMC. The final data were corrected by the amount of protein in the reaction .
- Proteins from pieces of jejunum and/or ileum were homogenized using a polytron homogenizer, in ice-cold buffer (pH 7.5) containing 50 mmol/L Tris/HCl, 5 mmol/L MgCl 2 , 250 mmol/L sucrose, 10 mmol/L ATP, 1 mmol/L DTT, 10 ⁇ g/mL aprotinin, 10 ⁇ g/mL leupeptin, 10 ⁇ g/mL antipain, 10 ⁇ g/mL pepstatin A, and 0.2 mmol/L phenylmethylsulphonylfluoride (PMSF) . Proteasomes were isolated as described.
- proteasome pellets were resuspended in buffer containing 50 mmol/L Tris/HCl, 5 mmol/L MgCl 2 , and 20% glycerol.
- the isolated proteasomes were stored at -80°C until analysis.
- the protein content of the proteasome preparation was determined using the Biorad protein assay following the manufacturer instructions.
- the chymotrypsin- the tryps in-like activities were determined using the fluorogenic substrates succinyl-leu-leu-val-tyr-AMC (Suc-LLVY- AMC, 300 ymol/L, Sigma) and boc-leu-arg-arg-AMC (Boc-LRR-AMC, 800 ymol/L, Biomol International LP, Morris, UK) respectively, in the presence and in the absence of the proteasome inhibitor MG132 (40 ymol/L, Sigma) .
- the accumulation of AMC at 37°C during 45 minutes was measured continuously as described for cathepsin activities measurements.
- Tissue samples from jejunum and ileum were fixed in 10% formaldehyde buffered with a 2 C03 (10 g/L) and processed for villus height and crypt depth measurements. Treatment designation of slides was blinded at the time of measurement.
- Table 1 shows that fasting induced a strong and progressive loss of body weight following 1 and 2 days of food deprivation (-16% and -28%, respectively) .
- the mass of the small intestine and the EDL muscle decreased progressively until 2 days of starvation to reach 27% of atrophy (Table 1) .
- Lysosomal proteolytic activities were measured in both the jejunum and the ileum.
- Cathepsin B+L+S and D activities were increased following starvation in the jejunum by 25% (P ⁇ 0.01) and 90% (P ⁇ 0.05) , respectively (Fig. 4A) .
- cathepsin B and B+S activities tended to increase respectively by 50% (P ⁇ 0.10) and 31% (P>0.1) in the jejunum of starved rats.
- cathepsin B and B+L+S did not increase at all in the ileum of starved rats compared with fed controls (Fig. 4B) .
- the small intestinal atrophy was reduced to 15% (P ⁇ 0.001) after 6h and totally absent after 24h of refeeding when rats received the GLP-2, while it still prevailed both at 6h (-32%, P ⁇ 0.0001) and 24h (-26%, P ⁇ 0.0001) in saline injected rats.
- skeletal muscle mass recovery paralleled the small intestine recovery and was improved by the treatment.
- the tibialis anterior (Fig. 6A) , the gastrocnemius (Fig. 6B) and the EDL (Fig. 6C) muscles were still atrophied respectively by 10%, 16.5% and 18% (P ⁇ 0.0001) after 24h of refeeding in saline injected rats.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Engineering & Computer Science (AREA)
- Chemical & Material Sciences (AREA)
- Pharmacology & Pharmacy (AREA)
- Veterinary Medicine (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Public Health (AREA)
- General Health & Medical Sciences (AREA)
- Animal Behavior & Ethology (AREA)
- Medicinal Chemistry (AREA)
- General Chemical & Material Sciences (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Organic Chemistry (AREA)
- Epidemiology (AREA)
- Immunology (AREA)
- Nutrition Science (AREA)
- Endocrinology (AREA)
- Zoology (AREA)
- Gastroenterology & Hepatology (AREA)
- Physical Education & Sports Medicine (AREA)
- Mycology (AREA)
- Polymers & Plastics (AREA)
- Neurology (AREA)
- Orthopedic Medicine & Surgery (AREA)
- Food Science & Technology (AREA)
- Molecular Biology (AREA)
- Hematology (AREA)
- Diabetes (AREA)
- Obesity (AREA)
- Pain & Pain Management (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Peptides Or Proteins (AREA)
- Coloring Foods And Improving Nutritive Qualities (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Acyclic And Carbocyclic Compounds In Medicinal Compositions (AREA)
Priority Applications (11)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| JP2012532595A JP5801814B2 (ja) | 2009-10-07 | 2010-10-07 | 腸及び筋肉の回復 |
| HK13100959.4A HK1173949B (en) | 2009-10-07 | 2010-10-07 | Glp-2 for use in the treatment of muscle atrophy |
| US13/500,784 US20120270786A1 (en) | 2009-10-07 | 2010-10-07 | Intestine and muscle recovery |
| BR112012009380-0A BR112012009380A2 (pt) | 2009-10-07 | 2010-10-07 | intestino e a recuperação muscular |
| ES10762684.8T ES2539917T3 (es) | 2009-10-07 | 2010-10-07 | GLP-2 para su uso en el tratamiento de la atrofia muscular |
| EP10762684.8A EP2485756B1 (en) | 2009-10-07 | 2010-10-07 | GLP-2 for use in the treatment of muscle atrophy |
| IN3187DEN2012 IN2012DN03187A (cg-RX-API-DMAC7.html) | 2009-10-07 | 2010-10-07 | |
| CA2776964A CA2776964C (en) | 2009-10-07 | 2010-10-07 | The intestine and muscle recovery |
| CN201080055259.6A CN102711803B (zh) | 2009-10-07 | 2010-10-07 | 用于肠和肌肉恢复的glp‑2 |
| AU2010305420A AU2010305420B2 (en) | 2009-10-07 | 2010-10-07 | GLP-2 for use in intestine and muscle recovery |
| DK10762684.8T DK2485756T3 (en) | 2009-10-07 | 2010-10-07 | GLP-2 for use in the treatment of muscle atrophy |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP09172398A EP2311486A1 (en) | 2009-10-07 | 2009-10-07 | GLP-2 for use in intestine and muscle recovery |
| EP09172398.1 | 2009-10-07 |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2011042501A2 true WO2011042501A2 (en) | 2011-04-14 |
| WO2011042501A3 WO2011042501A3 (en) | 2011-06-03 |
Family
ID=41611235
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/EP2010/065021 Ceased WO2011042501A2 (en) | 2009-10-07 | 2010-10-07 | The intestine and muscle recovery |
Country Status (11)
| Country | Link |
|---|---|
| US (1) | US20120270786A1 (cg-RX-API-DMAC7.html) |
| EP (2) | EP2311486A1 (cg-RX-API-DMAC7.html) |
| JP (1) | JP5801814B2 (cg-RX-API-DMAC7.html) |
| CN (1) | CN102711803B (cg-RX-API-DMAC7.html) |
| AU (1) | AU2010305420B2 (cg-RX-API-DMAC7.html) |
| BR (1) | BR112012009380A2 (cg-RX-API-DMAC7.html) |
| CA (1) | CA2776964C (cg-RX-API-DMAC7.html) |
| DK (1) | DK2485756T3 (cg-RX-API-DMAC7.html) |
| ES (1) | ES2539917T3 (cg-RX-API-DMAC7.html) |
| IN (1) | IN2012DN03187A (cg-RX-API-DMAC7.html) |
| WO (1) | WO2011042501A2 (cg-RX-API-DMAC7.html) |
Families Citing this family (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| ES2617714T5 (es) * | 2013-04-15 | 2021-02-11 | Nestle Sa | Empleo de la proteína de suero en combinación con la estimulación eléctrica muscular |
| JP6325215B2 (ja) * | 2013-08-29 | 2018-05-16 | テルモ株式会社 | 栄養補給用冷菓 |
| BR112017005762B1 (pt) * | 2014-10-14 | 2021-10-05 | Société des Produits Nestlé S.A. | Composição compreendendo uma fonte de proteína, e um antioxidante e seu uso |
| US10993993B2 (en) | 2015-05-28 | 2021-05-04 | Immunoforge Co., Ltd. | Pharmaceutical composition for treating muscle atrophy or sarcopenia including glucagon-like peptide (GLP-1) or GLP-1 receptor agonist |
| KR101661332B1 (ko) * | 2015-05-28 | 2016-09-29 | (의료)길의료재단 | 글루카곤 유사 펩타이드-1 수용체 항진제를 포함하는 근감소증 치료용 약학 조성물 |
| KR102119188B1 (ko) * | 2018-11-13 | 2020-06-08 | 이뮤노포지 주식회사 | 글루카곤 유사 펩타이드-1(glp-1), glp-1 유래 펩타이드, 또는 glp-1 분해 억제제를 포함하는 근감소증 또는 근위축증 치료용 약학 조성물 |
Family Cites Families (17)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5661123A (en) * | 1995-01-17 | 1997-08-26 | Nestec, Ltd. | Enteral composition for malabsorbing patients |
| US5990077A (en) * | 1995-04-14 | 1999-11-23 | 1149336 Ontario Inc. | Glucagon-like peptide-2 and its therapeutic use |
| US5834428A (en) * | 1995-04-14 | 1998-11-10 | 1149336 Ontario Inc. | Glucagon-like peptide-2 and its therapeutic use |
| US6852690B1 (en) * | 1995-08-22 | 2005-02-08 | Amylin Pharmaceuticals, Inc. | Method and composition for enhanced parenteral nutrition |
| JP4148994B2 (ja) * | 1996-04-12 | 2008-09-10 | 1149336 オンタリオ インコーポレイテッド | グルカゴン様ペプチド―2アナログ |
| CA2223198A1 (en) * | 1997-01-14 | 1998-07-14 | Societe Des Produits Nestle S.A. | Composition and method for treatment of inflammatory conditions of the gastro-intestinal tract |
| CA2236519C (en) * | 1997-05-02 | 2011-09-13 | 1149336 Ontario Inc. | Methods of enhancing functioning of the large intestine |
| EP1090636A1 (en) * | 1999-09-13 | 2001-04-11 | Société des Produits Nestlé S.A. | High lipid diet |
| DK1326630T3 (da) * | 2000-09-18 | 2008-09-15 | Sanos Bioscience As | Anvendelse af GLP-2-peptider |
| US7186683B2 (en) * | 2000-09-18 | 2007-03-06 | Sanos Bioscience A/S | Use of GLP for the treatment, prevention, diagnosis, and prognosis of bone-related and nutrition-related disorders |
| WO2002066511A2 (en) * | 2001-02-16 | 2002-08-29 | Conjuchem Inc. | Long lasting glucagon-like peptide 2 (glp-2) for the treatment of gastrointestinal diseases and disorders |
| JP2006517389A (ja) * | 2002-10-14 | 2006-07-27 | ノボ ノルディスク アクティーゼルスカブ | Glp−2化合物、製剤、及びそれらの使用 |
| US20040115708A1 (en) * | 2002-10-28 | 2004-06-17 | Ardies C. Murray | Method of screening agents for the treatment and prevention of cancer and cachexia and the new use of specific agents for the treatment and prevention of cancer and cachexia |
| WO2004103390A2 (en) * | 2003-05-15 | 2004-12-02 | Trustees Of Tufts College | Stable analogs of peptide and polypeptide therapeutics |
| SG161234A1 (en) * | 2005-04-06 | 2010-05-27 | Novartis Ag | A method and composition for nutritionally improving glucose control and insulin action |
| EP1971230A2 (en) * | 2006-01-09 | 2008-09-24 | Nestec S.A. | Treatment of stressed patients |
| WO2008056155A1 (en) * | 2006-11-08 | 2008-05-15 | Zealand Pharma A/S | Selective glucagon-like-peptide-2 (glp-2) analogues |
-
2009
- 2009-10-07 EP EP09172398A patent/EP2311486A1/en not_active Withdrawn
-
2010
- 2010-10-07 ES ES10762684.8T patent/ES2539917T3/es active Active
- 2010-10-07 JP JP2012532595A patent/JP5801814B2/ja active Active
- 2010-10-07 BR BR112012009380-0A patent/BR112012009380A2/pt not_active Application Discontinuation
- 2010-10-07 IN IN3187DEN2012 patent/IN2012DN03187A/en unknown
- 2010-10-07 CA CA2776964A patent/CA2776964C/en active Active
- 2010-10-07 AU AU2010305420A patent/AU2010305420B2/en active Active
- 2010-10-07 US US13/500,784 patent/US20120270786A1/en not_active Abandoned
- 2010-10-07 CN CN201080055259.6A patent/CN102711803B/zh active Active
- 2010-10-07 WO PCT/EP2010/065021 patent/WO2011042501A2/en not_active Ceased
- 2010-10-07 EP EP10762684.8A patent/EP2485756B1/en active Active
- 2010-10-07 DK DK10762684.8T patent/DK2485756T3/en active
Non-Patent Citations (4)
| Title |
|---|
| BURRIN ET AL., JOURNAL OF NUTRITION, 2001, pages 709 - 712 |
| DRUCKER ET AL., GUT, vol. 50, 2002, pages 428 - 435 |
| KEE, A.J. ET AL., JOURNAL OF PHYSIOLOGY, vol. 546, 2003, pages 765 - 776 |
| XIAO, Q. ET AL., GASTROENTEROLOGY, vol. 117, 1999, pages 99 - 105 |
Also Published As
| Publication number | Publication date |
|---|---|
| EP2485756A2 (en) | 2012-08-15 |
| CN102711803B (zh) | 2017-02-22 |
| EP2485756B1 (en) | 2015-05-20 |
| AU2010305420A1 (en) | 2012-05-10 |
| CA2776964C (en) | 2019-03-05 |
| DK2485756T3 (en) | 2015-06-08 |
| ES2539917T3 (es) | 2015-07-07 |
| WO2011042501A3 (en) | 2011-06-03 |
| BR112012009380A2 (pt) | 2021-06-22 |
| CA2776964A1 (en) | 2011-04-14 |
| HK1173949A1 (en) | 2013-05-31 |
| US20120270786A1 (en) | 2012-10-25 |
| JP2013507341A (ja) | 2013-03-04 |
| JP5801814B2 (ja) | 2015-10-28 |
| AU2010305420B2 (en) | 2015-03-19 |
| EP2311486A1 (en) | 2011-04-20 |
| CN102711803A (zh) | 2012-10-03 |
| IN2012DN03187A (cg-RX-API-DMAC7.html) | 2015-09-25 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US8703725B2 (en) | Nutritional compositions | |
| JP5983601B2 (ja) | 栄養組成物 | |
| CN101212911B (zh) | 含水解的蛋白质的婴儿营养品 | |
| US20090075862A1 (en) | Method for providing glutamine | |
| Moore et al. | The biological value of protein | |
| JP5315996B2 (ja) | 総合経腸栄養組成物 | |
| JP2013136602A (ja) | 栄養組成物 | |
| EP2485756B1 (en) | GLP-2 for use in the treatment of muscle atrophy | |
| BR112013000446B1 (pt) | uso de vitamina d e l-leucina em sua forma livre para a fabricação de um medicamento para a prevenção e/ou o tratamento de uma doença ou condição envolvendo perda de massa muscular em um adulto mamífero | |
| EP3541206B1 (en) | Nutritional composition for use in therapy of patients with sarcopenia and/or frailty or pre-sarcopenic and/or pre-frail patients | |
| RU2385647C2 (ru) | Питание для пациентов, страдающих ожирением | |
| JP6160832B2 (ja) | システイン及び食物摂取 | |
| CN101242748A (zh) | 含有蛋白酶抑制剂的婴儿营养品 | |
| CN113924120A (zh) | 增强一种或多种合成代谢氨基酸的肌肉骨骼效应的组合物和方法 | |
| WO2015009225A1 (en) | Food composition product | |
| HK1173949B (en) | Glp-2 for use in the treatment of muscle atrophy | |
| TW202317083A (zh) | 經腸營養製劑 | |
| Hirsch et al. | Functional changes in the gastrointestinal system | |
| HK40012571B (en) | Nutritional composition for use in therapy of patients with sarcopenia and/or frailty or pre-sarcopenic and/or pre-frail patients | |
| HK40012571A (en) | Nutritional composition for use in therapy of patients with sarcopenia and/or frailty or pre-sarcopenic and/or pre-frail patients |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| WWE | Wipo information: entry into national phase |
Ref document number: 201080055259.6 Country of ref document: CN |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 10762684 Country of ref document: EP Kind code of ref document: A1 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2776964 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2012532595 Country of ref document: JP |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 3187/DELNP/2012 Country of ref document: IN |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2010305420 Country of ref document: AU |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2010762684 Country of ref document: EP |
|
| ENP | Entry into the national phase |
Ref document number: 2010305420 Country of ref document: AU Date of ref document: 20101007 Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 13500784 Country of ref document: US |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112012009380 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 112012009380 Country of ref document: BR Kind code of ref document: A2 Effective date: 20120409 |
|
| ENPZ | Former announcement of the withdrawal of the entry into the national phase was wrong |
Ref document number: 112012009380 Country of ref document: BR Kind code of ref document: A2 Free format text: ANULADA A PUBLICACAO CODIGO 1.3 NA RPI NO 2395 DE 29/11/2016 POR TER SIDO INDEVIDA. |
|
| ENPZ | Former announcement of the withdrawal of the entry into the national phase was wrong |
Ref document number: 112012009380 Country of ref document: BR Kind code of ref document: A2 Free format text: ANULADA A PUBLICACAO CODIGO 1.2.3 NA RPI NO 2466 DE 10/04/2018 POR TER SIDO INDEVIDA. |
|
| ENPC | Correction to former announcement of entry into national phase, pct application did not enter into the national phase |
Ref country code: BR |
|
| ENP | Entry into the national phase |
Ref document number: 112012009380 Country of ref document: BR Kind code of ref document: A2 Effective date: 20120409 |