WO2011020024A2 - Methods of modulating immune function - Google Patents

Methods of modulating immune function Download PDF

Info

Publication number
WO2011020024A2
WO2011020024A2 PCT/US2010/045479 US2010045479W WO2011020024A2 WO 2011020024 A2 WO2011020024 A2 WO 2011020024A2 US 2010045479 W US2010045479 W US 2010045479W WO 2011020024 A2 WO2011020024 A2 WO 2011020024A2
Authority
WO
WIPO (PCT)
Prior art keywords
h7cr
antibody
domain
derivative
native
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2010/045479
Other languages
English (en)
French (fr)
Other versions
WO2011020024A3 (en
Inventor
Lieping Chen
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Johns Hopkins University
Original Assignee
Johns Hopkins University
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to ES10744821.9T priority Critical patent/ES2666152T3/es
Priority to AU2010282340A priority patent/AU2010282340B2/en
Priority to EP18151970.3A priority patent/EP3381937A3/en
Priority to CA2769822A priority patent/CA2769822C/en
Priority to US13/390,054 priority patent/US8840889B2/en
Priority to EP10744821.9A priority patent/EP2464661B1/en
Priority to JP2012524903A priority patent/JP5883384B2/ja
Application filed by Johns Hopkins University filed Critical Johns Hopkins University
Publication of WO2011020024A2 publication Critical patent/WO2011020024A2/en
Publication of WO2011020024A3 publication Critical patent/WO2011020024A3/en
Anticipated expiration legal-status Critical
Priority to US14/456,457 priority patent/US9676856B2/en
Priority to US14/456,501 priority patent/US20160002336A1/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2827Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against B7 molecules, e.g. CD80, CD86
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/3955Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K45/00Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
    • A61K45/06Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61NELECTROTHERAPY; MAGNETOTHERAPY; RADIATION THERAPY; ULTRASOUND THERAPY
    • A61N5/00Radiation therapy
    • A61N5/10X-ray therapy; Gamma-ray therapy; Particle-irradiation therapy
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P29/00Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • A61P37/04Immunostimulants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • A61P37/06Immunosuppressants, e.g. drugs for graft rejection
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/08Antiallergic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • C07K14/70521CD28, CD152
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • C07K14/70532B7 molecules, e.g. CD80, CD86
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2818Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD28 or CD152
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/21Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/31Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/74Inducing cell proliferation
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/30Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto

Definitions

  • therapeutic agents that modulate one or more immune functions and uses of such therapeutic agents in the prevention, treatment and management of diseases.
  • the therapeutic agents modulate one or more signal transduction pathways induced by the binding of B7-H7 to B7-H7CR, or the binding of B7-H2 to either ICOS, CD28, or CTLA-4.
  • the therapeutic agents modulate the binding of B7-H7 to B7-H7CR, or the binding of B7-H2 to either ICOS, CD28, or CTLA-4.
  • the therapeutic agents can be used in the prevention, treatment and/or management of diseases in which it might be useful to modulate one or more immune functions (e.g., cancer, infectious disease, autoimmune disease, and transplantation rejection).
  • presented herein are methods for identifying receptor-ligand interactions.
  • T cell activation is required for specific immune responses against infectious agents. T cell activation also plays an important role in tumor immunity and in autoimmune and inflammatory disorders. T cell activation is initiated when T cell antigen receptors (TCR) of T cells recognize their specific antigen (Ag) in the context of major histocompatibility complex (MHC) molecules.
  • TCR T cell antigen receptors
  • Ag specific antigen
  • MHC major histocompatibility complex
  • B7-1 and B7-2 are two ligands for CD28.
  • B7-1 and B7-2 are typically expressed on professional antigen-presenting cells (APCs).
  • APCs professional antigen-presenting cells
  • B7- 1 and B7-2 also bind to the co-stimulatory receptor known as CTLA-4 (CD 152) on T cells.
  • CTLA-4 co-stimulatory receptor found on T cells.
  • ICOS co-stimulatory receptor found on T cells.
  • B7 molecules mediate both positive and negative signals to T cells by binding to costimulatory receptors on T cells.
  • CD28 is the most extensively studied receptor that accepts a secondary signal from B7-l(CD80) and B7-2(CD86, B 70 ⁇ to costimulate naive T cells to full activation in the presence of T cell receptor signaling (Linsley et all, 1990, PNAS USA 87: 5031-5035).
  • CTLA-4 a CD28 homolog expressed on activated T cells and interacting with the same set of ligands, attenuates T cell responses (Krummel et al, 1995, J. Exp. Med.
  • ICOS another CD28 homolog
  • ICOS another CD28 homolog
  • ICOS is expressed o ⁇ activated T ceils a ⁇ d eostimulates T ceil activation upon binding of a distinct ligaiid B7-H2 (ICOSLG, GL50, B7RP1, CD275, ICOSL, LICOS) (Hutloff et al., 1999, Nature 397: 263-266; Yoshinaga et al., 1999, Nature 402: 827-832).
  • CD28, CTLA-4 and ICOS form a tight gene cluster on human chromosome 2q33 and on mouse chromosome 1 , suggesting they originated by gene duplication during evolution (Swallow et al., 1999, Immunity 11 : 423-432).
  • CD28 and ICOS have distinct ligands, they share significant functional redundancy including their capacity in costimulating growth, survival and differentiation of T cells as well as their requirement for antibody response (Ling et al., 2000, J. Immunol.
  • CD28 and ICOS signals have been shown to costimulate an array of cytokines.
  • CD28 signal induces high level of IL-2
  • ICOS preferentially stimulates IL-IO (Hutloff et al., 1999, Nature 397: 263-266).
  • Modulation of costimulatory molecules and their receptors permits the modulation of various immune functions.
  • Agents that modulate the interaction between costimulatory molecules and their receptors may have beneficial use in a variety of applications, including, e.g., therapeutic and prophylactic uses and vaccinations.
  • the present invention fulfills these and other needs.
  • B7-H7 is a ligand for CD28 as well as CTLA-4.
  • Various embodiments presented herein are based, in part, on the discovery of these interactions and that modulation of such interactions can used to modulate immune function or response.
  • antibodies the specifically bind to B7-H7, B7- H7CR, or the complex of B7-H7 and B7-HCR.
  • methods for modulating the interaction between B7-H7 and its receptor or the interaction between B7-H2 and one or more of its receptors are presented herein.
  • methods for modulating the interaction between B7-H7 and B7-H7CR are methods for modulating the interaction between B7-H2 and one or more of the following receptors: ICOS, CD28 or CTLA-4.
  • presented herein are methods for modulating one or more signal transduction pathways induced by the binding of B7-H7CR to one or more of its ligands.
  • presented herein are methods for modulating one or more signal transduction pathways induced by the binding of B7-H7CR to B7-H7.
  • presented herein are methods for modulating one or more signal transduction pathways induced by B7-H7 binding to its receptor or B7-H2 binding to one or more of its receptors.
  • presented herein are methods for modulating one or more signal transduction pathways induced by B7-H7 binding to B7-H7CR.
  • presented herein are methods for modulating one or more signal transduction pathways induced by B7-H2 binding to one or more of the following receptors: ICOS, CD28 or CTLA-4.
  • Therapeutic Agents that are based, in part, on the discovery of the receptor-ligand interaction between B7-H7 and B7-H7CR and the receptor-ligand interactions between B7-H2 and ICOS, CD28, and CTLA-4.
  • the Therapeutic Agents or compositions thereof can be used in cell culture to modulate immune cell functions (e.g., lymphocyte proliferation, cytokine production, or antibody production).
  • a cell may be contacted with a Therapeutic Agent to modulate one or more immune cell functions.
  • Therapeutic Agents can be administered to a subject to prevent, treat or manage certain diseases, such as cancer, an infectious disease, an autoimmune disease, an
  • compositions comprising a Therapeutic Agent, and pharmaceutically acceptable carrier.
  • the Therapeutic Agent is present in the pharmaceutical composition in an amount effective to modulate T lymphocyte proliferation, modulate one or more immune functions, or to prevent, treat or manage cancer, an infectious disease, an autoimmune disorder, an inflammatory disorder, graft versus host disease, or organ transplant rejection.
  • presented herein are methods for modulating T lymphocyte proliferation, modulating one or more immune functions, or preventing, treating or managing cancer, an infectious disease, an autoimmune disorder, an inflammatory disorder, graft versus host disease, or organ transplant rejection utilizing an effective amount of Therapeutic Agent.
  • the Therapeutic Agent is an antibody that specifically binds to B7-H7CR, an antibody that specifically binds to B7-H7, an antibody that specifically binds to a B7-H7CR/B7-H7 complex, a B7-H7CR derivative, or a B7-H7 derivative.
  • the Therapeutic Agent is a fusion protein comprising: (i) the extracellular domain of B7-H7 or a fragment thereof and the Fc domain of an immunoglobulin or a constant region thereof; or (ii) the extracellular domain of B7-H7CR or a fragment thereof and the Fc domain of an immunoglobulin or a constant region thereof.
  • the therapeutic agent modulates one or more signal transduction pathways mediated by the interaction of B7-H7CR with one or more of its ligands (e.g., B7-H7).
  • the Therapeutic Agent is an antibody that specifically binds to ICOS, an antibody that specifically binds to B7-H2, an antibody that specifically binds to a B7-H2/ICOS complex, an ICOS derivative, a B7-H2 derivative, a fusion protein comprising the extracellular domain of ICOS or a fragment thereof and the Fc domain of an immunoglobulin or a constant region thereof, or a fusion protein comprising the extracellular domain of B7-H2 or a fragment thereof and the Fc domain of an immunoglobulin or a constant region thereof.
  • the Therapeutic Agent is an antibody that specifically binds to CD28, an antibody that specifically binds to CTLA-4, an antibody that specifically binds to a CD28/B7-H2 complex, an antibody that specifically binds to a CTLA- 4/B7-H2 complex, a CD28 derivative, a CTLA-4 derivative, a fusion protein comprising the extracellular domain of CD28 or a fragment thereof and the Fc domain of an immunoglobulin or a constant region thereof, or a fusion protein comprising the extracellular domain of CTLA-4 or a fragment thereof and the Fc domain of an immunoglobulin or a constant region thereof.
  • the Therapeutic Agent selectively modulates one or more signal transduction pathways induced by B7-H2 binding to one or more of its receptors (e.g., ICOS, CD28 or CTLA-4). In some embodiments, the Therapeutic Agent selectively modulates the binding of B7-H2 to one or more of its receptors (e.g., ICOS, CD28 or CTLA- [0015]
  • ICOS ICOS
  • CD28 CD28
  • described herein are methods of identifying receptor-ligand interactions. Such methods can be used to identify interactions between ligands and receptors, such as costimulatory ligands and costimulatory receptors.
  • abnormal in the context of expression of a
  • proteinaceous agent refers to a proteinaceous agent for which the expression is increased or decreased by at least 5%, 10%, 20%, 25%, 50%, 75%, 85%, 90%, or 95%, or 5% to 10%, 5% to 25%, 10% to 25%, 10% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, ot 75% to 95% to the expression of the proteinaceous agent by a normal subject or population (e.g., 5 or more normal subjects).
  • an agonist refers to a molecule(s) that binds to another molecule and induces a biological reaction.
  • an agonist is a molecule that binds to a receptor on a cell and triggers one or more signal transduction pathways.
  • an agonist includes an antibody or ligand that binds to a receptor on a cell and induces one or more signal transduction pathways.
  • the antibody or ligand binds to a receptor on a cell, induces one or more signal transduction pathways, and blocks or prevents a native ligand of the receptor from binding to the receptor.
  • a Therapeutic Agent is an agonist of signal transduction normally mediated by binding of a native ligand (e.g., B7-H7) to B7-HCR.
  • a Therapeutic Agent is an agonist of signal transduction normally mediated by binding of a native ligand (e.g., B7-H2) to one, two or all of the following receptors: ICOS, CD28, or CTLA-4.
  • the term "Immunostimulating Therapeutic Agent(s)” refers to a Therapeutic Agent(s) that induces, activates or enhances one or more immune functions or responses.
  • an antagonist refers to a molecule(s) that inhibits the action of another molecule without provoking a biological response itself.
  • an antagonist is a molecule that binds to a receptor on a cell and blocks or dampens the biological activity of an agonist.
  • an antagonist includes an antibody or ligand that binds to a receptor on a cell and blocks or dampens binding of the native ligand to the cell without inducing one or more signal transduction pathways.
  • an antagonist includes an antibody or soluble receptor that competes with the native receptor on cells for binding to the native ligand, and thus, blocks or dampens one or more signal transduction pathways induced when the native receptor binds to the native ligand.
  • a Therapeutic Agent is an antagonist of signal transduction normally mediated by binding of a native ligand (e.g., B7-H7) to B7-HCR.
  • a Therapeutic Agent is an antagonist of signal transduction normally mediated by binding of a native ligand (e.g., B7-H2) to one, two or all of the following receptors: ICOS, CD28, or CTLA-4.
  • the term "Inhibitory Therapeutic Agent(s)” refers to a Therapeutic Agent(s) that suppresses or reduces one or more immune functions or responses.
  • antibody refers to molecules that contain an antigen binding site, e.g., immunoglobulins.
  • Antibodies include, but are not limited to, monoclonal antibodies, bispecific antibodies, multispecific antibodies, human antibodies, humanized antibodies, synthetic antibodies, chimeric antibodies, polyclonal antibodies, single domain antibodies, camelized antibodies, single-chain Fvs (scFv), single chain antibodies, Fab fragments, F(ab') fragments, disulfide-linked bispecific Fvs (sdFv), intrabodies, and anti-idiotypic (anti-Id) antibodies (including, e.g., anti-Id and anti-anti-Id antibodies to antibodies), and epitope-binding fragments of any of the above.
  • antibodies include immunoglobulin molecules and immunologically active fragments of immunoglobulin molecules.
  • Immunoglobulin molecules can be of any type (e.g., IgG, IgE, IgM, IgD, IgA and IgY), class (e.g., IgGi, IgG 2 , IgG3, IgG 4 , IgAi and IgA 2 ) or subclass.
  • an antibody is a human or humanized monoclonal antibody.
  • B7-H2 refers to either a native B7-H2, a B7-H2 derivative, or both.
  • B7-H2 polypeptide refers to either a native B7-H2, a B7-H2 derivative, or both.
  • B7-H2/CD28 complex and “CD28/B7-H2 complex” refer to complexes formed as a result of the interaction between a native B7-H2 and a native CD28, a native B7-H2 and a CD28 derivative, a B7-H2 derivative and a native CD28, or a B7-H2 derivative and a CD28 derivative.
  • B7-H2/CTLA-4 complex and "CTLA-4/B7-H2 complex” refer to complexes formed as a result of the interaction between a native B7-H2 and a native CTLA-4, a native B7-H2 and a CTLA-4 derivative, a B7-H2 derivative and a native CTLA-4, or a B7-H2 derivative and a CTLA-4 derivative.
  • B7-H2/ICOS complex and "ICOS/B7-H2 complex” refer to complexes formed as a result of the interaction between a native B7-H2 and a native ICOS, a native B7-H2 and an ICOS derivative, a B7-H2 derivative and a native ICOS, or a B7-H2 derivative and an ICOS derivative.
  • B7-H7 refers to either a native B7-H7, a B7-H7 derivative, or both.
  • B7-H7 polypeptide refers to either a native B7-H7, a B7-H7 derivative, or both.
  • B7-H7CR refers to either a native B7-H7CR, a B7-H7CR derivative, or both.
  • B7-H7CR polypeptide refers to either a native B7-H7CR, a B7-H7CR derivative, or both.
  • B7-H7/B7-H7CR complex and “B7-H7CR/B7-H7 complex” refer to complexes formed as a result of the interaction between a native B7-H7 and a native B7-H7CR, a native B7-H7 and a B7-H7CR derivative, a B7-H7 derivative and a native B7-H7CR, or a B7-H7 derivative and a B7-H7CR derivative.
  • CD28 refers to either a native CD28, a CD28 derivative (e.g., a CD28 polypeptide), or both.
  • CTLA-4" refers to either a native CTLA-4, a CTLA-4 derivative (e.g., a CTLA-4 polypeptide), or both.
  • derivative in the context of proteins or polypeptides refers to: (a) a polypeptide that is at least 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%,
  • Derivatives also include a polypeptide that comprises the amino acid sequence of a naturally occurring mature form of a mammalian polypeptide and a heterologous signal peptide amino acid sequence.
  • derivatives include polypeptides that have been chemically modified by, e.g., glycosylation, acetylation, pegylation, phosphorylation, amidation, derivitization by known protecting/blocking groups, proteolytic cleavage, linkage to a cellular ligand or other protein moiety, etc.
  • derivatives include polypeptides comprising one or more non-classical amino acids.
  • a derivative is isolated or purified.
  • a derivative retains one or more functions of the native polypeptide from which it was derived.
  • Percent identity can be determined using any method known to one of skill in the art. In a specific embodiment, the percent identity is determined using the "Best Fit” or "Gap” program of the Sequence Analysis Software Package (Version 10; Genetics Computer Group, Inc., University of Wisconsin Biotechnology Center, Madison, Wisconsin).
  • disease and “disorder” are used interchangeably to refer to a condition, in particular, a pathological condition.
  • yielderly human refers to a human 65 years or older.
  • the term "effective amount" in the context of the administration of a therapy to a subject refers to the amount of a therapy that achieves a desired prophylactic or therapeutic effect. Examples of effective amounts are provided in Section 5.8.2, infra.
  • fragment in the context of a nucleotide sequence refers to a nucleotide sequence comprising an nucleic acid sequence of at least 5 contiguous nucleic acid bases, at least 10 contiguous nucleic acid bases, at least 15 contiguous nucleic acid bases, at least 20 contiguous nucleic acid bases, at least 25 contiguous nucleic acid bases, at least 40 contiguous nucleic acid bases, at least 50 contiguous nucleic acid bases, at least 60 contiguous nucleic acid bases, at least 70 contiguous nucleic acid bases, at least 80 contiguous nucleic acid bases, at least 90 contiguous nucleic acid bases, at least 100 contiguous nucleic acid bases, at least 125 contiguous nucleic acid bases, at least 150 contiguous nucleic acid bases, at least 175 contiguous nucleic acid bases, at least 200 contiguous nucleic acid bases, at least 250 contiguous nucleic acid bases, at least
  • the fragment is a fragment of the B7-H2, B7-H7, ICOS, B7-H7CR, CD28 or CTLA-4 gene.
  • the fragment is a fragment of the coding region of the B7-H2, B7-H7, ICOS, B7-H7CR, CD28 or CTLA-4 gene.
  • the fragment of the nucleic acid sequence of interest encodes a polypeptide that retains one or more functions of the polypeptide encoded by the nucleic acid sequence of interest - in other words, it is a functional fragment.
  • the polypeptide retains the ability to interact with another protein or to induce one or more signal transduction pathways.
  • fragment is the context of a fragment of a
  • proteinaceous agent refers to a fragment that is 8 or more contiguous amino acids, 10 or more contiguous amino acids, 15 or more contiguous amino acids, 20 or more contiguous amino acids, 25 or more contiguous amino acids, 50 or more contiguous amino acids, 75 or more contiguous amino acids, 100 or more contiguous amino acids, 150 or more contiguous amino acids, 200 or more contiguous amino acids, or in the range of between 10 to 300 contiguous amino acids, 10 to 200 contiguous amino acids, 10 to 250 contiguous amino acids, 10 to 150 contiguous amino acids, 10 to 100 contiguous amino acids, 10 to 50 contiguous amino acids, 50 to 100 contiguous amino acids, 50 to 150 contiguous amino acids, 50 to 200 contiguous amino acids, 50 to 250 contiguous amino acids, 50 to 300 contiguous amino acids, 25 to 50 contiguous amino acids, 25 to 75 contiguous amino acids,
  • a fragment of a proteinaceous agent retains one or more functions of the proteinaceous agent - in other words, it is a functional fragment.
  • a fragment of a proteinaceous agent retains the ability to interact with another protein or to induce one or more signal transduction pathways.
  • the term "functional fragment,” in the context of a proteinaceous agent, refers to a portion of a proteinaceous agent that retains one or more activities or functions of the proteinaceous agent.
  • a functional fragment of a B7-H7 polypeptide may retain the ability to bind one or more of its receptors (e.g., B7-H7CR) and/or induce or activate one or more signal transduction pathways mediated by the B7-H7 polypeptide binding to one or more of its receptors (e.g., B7-H7CR).
  • heterologous refers an entity not found in nature to be associated with another entity.
  • human adult refers to a human that is 18 years or older.
  • human child refers to a human that is 1 year to 18 years old.
  • human infant refers to a newborn to 1 year old human.
  • ICOS refers to either a native ICOS, an ICOS derivative, or both.
  • ICOS polypeptide refers to either a native ICOS, an ICOS derivative, or both.
  • immunospecifically binds As used herein, the terms “immunospecifically binds,” “immunospecifically recognizes,” “specifically binds,” and “specifically recognizes” are analogous terms in the context of antibodies and refer to molecules that specifically bind to an antigen ⁇ e.g., epitope or immune complex) as understood by one skilled in the art.
  • a molecule that specifically binds to an antigen may bind to other peptides or polypeptides with lower affinity as determined by, e.g., immunoassays (e.g., ELISA), surface plasmon resonance (e.g.,
  • BIAcore ® BIAcore ®
  • KinEx assay using, e.g., a KinExA 3000 instrument (Sapidyne Instruments,
  • molecules that specifically bind to an antigen bind to the antigen with a dissociation constant (i.e., K a ) that is at least 2 logs, 2.5 logs, 3 logs, 3.5 logs, 4 logs or greater than the K a when the molecules bind to another antigen.
  • K a dissociation constant
  • molecules that specifically bind to an antigen do not cross react with other proteins.
  • the term “in combination” refers to the use of more than one therapies (e.g., one or more prophylactic and/or therapeutic agents).
  • the use of the term “in combination” does not restrict the order in which therapies are administered to a subject with a disease or disorder, or the route of administration.
  • a first therapy (e.g., a prophylactic or therapeutic agent) can be administered prior to (e.g., 5 minutes, 15 minutes, 30 minutes, 45 minutes, 1 hour, 2 hours, 4 hours, 6 hours, 12 hours, 24 hours, 48 hours, 72 hours, 96 hours, 1 week, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 8 weeks, or 12 weeks before), concomitantly with, or subsequent to (e.g., 5 minutes, 15 minutes, 30 minutes, 45 minutes, 1 hour, 2 hours, 4 hours, 6 hours, 12 hours, 24 hours, 48 hours, 72 hours, 96 hours, 1 week, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 8 weeks, or 12 weeks after) the administration of a second therapy (e.g., a prophylactic or therapeutic agent) to a subject with a disease or disorder or a symptom thereof.
  • a second therapy e.g., a prophylactic or therapeutic agent
  • a subject is administered one or more therapies to "manage" a disease or disorder so as to prevent the progression or worsening of symptoms associated with a disease.
  • native B7-H2 in the context of proteins or polypeptides refers to any naturally occurring B7-H2 amino acid sequences, including immature or precursor and mature forms.
  • Accession Nos. for the amino acid sequence of native mammalian B7-H2 include: 075144-1 ⁇ homo sapiens), 075144-2 ⁇ homo sapiens), NP_056074.1 (GL27477039; homo sapiens), Q9JHJ8-1 (mouse), Q9JHJ8-2 (mouse), and NP_056605.1 (GL7657220; mouse).
  • Human B7-H2 isoform 2 differs from isoform 1 as follows: 300-302 GHV to ESWNLLLLLS.
  • native B7-H2 is the immature or precursor form of a naturally occurring mammalian B7-H2.
  • native B7-H2 is the mature form of a naturally occurring mammalian B7-H2.
  • native B7-H2 is the precursor form of naturally occurring human B7-H2.
  • native B7-H2 is the mature form of naturally occurring human B7-H2.
  • the native B7-H2 protein/polypeptide is isolated or purified.
  • the human B7-H2 polypeptide is otherwise referred to as ICOS ligand, B7RP1, ICOSL, and KIAA0653 in the literature.
  • At least one isoform of human B7-H2 polypeptide is 302 amino acids in length and has been reported to contain the following: a signal sequence, an extracellular domain, an Ig-like V-type domain, an Ig-like C2-type domain, a transmembrane domain, and a cytoplasmic domain.
  • at least one form of human B7-H2 isoform 1 has been reported to contain the following: a signal sequence at amino acid residues 1 to 18 of the sequence at Accession No.
  • nucleic acids refers to any naturally occurring nucleic acid sequences encoding B7-H2, including the immature or precursor and mature forms.
  • Accession Nos. for the nucleotide sequence of native mammalian B7-H2 include: AF289028.1 (GL9858866; homo sapiens) and BC029227.1 (GL22137738; mouse).
  • nucleic acid is an isolated or purified nucleic acid.
  • nucleic acids encode the immature or precursor form of a naturally occurring mammalian B7-H2.
  • nucleic acids encode the mature form of a naturally occurring mammalian B7-H2.
  • nucleic acids encoding native B7-H2 encode the precursor form of naturally occurring human B7-H2.
  • nucleic acids encoding native B7-H2 encode the mature form of naturally occurring human B7-H2.
  • native B7-H7 in the context of proteins or polypeptides refers to any naturally occurring B7-H7 amino acid sequences, including immature or precursor and mature forms.
  • Accession Nos. for the amino acid sequence of native mammalian B7-H7 include: O9UM44-1 (homo sapiens), NP_009003 (GI: 5901964, homo sapiens), and AAD48396 (GI: 15726285, homo sapiens).
  • a representative amino acid sequence of the immature/precursor form of native human B7-H7, which comprises the signal peptide (underlined) and the mature human native B7-H7 (the amino acid sequence after the signal peptide) is provided:
  • native B7-H7 is the immature or precursor form of a naturally occurring mammalian B7-H7. In other embodiments, native B7-H7 is the mature form of a naturally occurring mammalian B7-H7. In a specific embodiment, native B7-H7 is the precursor form of naturally occurring human B7-H7. In another embodiment, native B7- H7 is the mature form of naturally occurring human B7-H7. In one embodiment, the native B7-H7 protein/polypeptide is isolated or purified.
  • the human B7-H7 polypeptide is otherwise referred to as human endogenous retrovirus-H long terminal repeat-associating protein 2 (HHLA2) in the literature/databases but the function of B7-H7 was not previously identified.
  • Human B7-H7 polypeptide is 414 amino acids in length and has been reported to contain the following: a signal sequence, an extracellular domain, 3 immunoglobulin-like (Ig-like) domains, a transmembrane domain, and a cytoplasmic domain.
  • the human B7-H7 polypeptide has been reported to contain an Ig-like V-type 1 domain, an Ig-like C- 1 type domain, and an Ig-like V-type 2 domain.
  • the human B7-H7 has been reported to contain the following: a signal sequence at amino acid residues 1 to 22 of the sequence at Accession No. O9UM44-1, an Ig-like V-type 1 domain at amino acid reisdues 61 to 131 of the sequence at Accession No. O9UM44-1, an Ig- like C-I type domain at amino acid residues 138 to 222 of the sequence at Accession No. O9UM44-1, an Ig-like V-type 2 domain at amino acid residues 235 to 328 of the sequence at Accession No. O9UM44-1, and a transmembrane domain at amino acid residues 345 to 365 of the sequence at Accession No. O9UM44-1.
  • the predicted dimer interface for human B7- H7 polypeptide is amino acid residues 141-144, 156, 158, 160, 162, 193-196, 198, 200, 201, 224, and 225.
  • the predicted N-linked glycosylation sites for human B7-H7 polypeptide are at amino acid residues 90, 103, and 318.
  • Natural variations of human B7-H7 polypeptide include DOT, N344K, and S346R (UniProt Q9UM44).
  • the reported signal peptide is underlined (signal peptide), the IgV domains are in bold (IgV domains), the IgC domain is italicized and in bold (IgC domain), the IgV/IgC domain overlap is italicized (IgV/IgC overlap), the transmembrane domain is underlined and in bold (transmembrane domain).
  • the Ig domains of human B7-H7 comprise a pair of conserved cysteines that may form a disulphide bond. Cys residues at positions 159 and 210 of the IgC domain may form such disulphide bonds. Cys residues at positions 243 and 317 of the second IgV domain may form such disulphide bonds.
  • the reported signal is underlined (signal peptide), the IgV domains are in bold (IgV domains), the IgC domain is italicized and in bold (IgC domain), the IgV/IgC overlap is italicized (IgV/IgC overlap), and the transmembrane domain is underlined and in bold (transmembrane domain).
  • the reported signal is underlined (signal peptide), the IgV domains are in bold (IgV domains), the IgC domain is italicized and in bold (IgC domain), the IgV/IgC overlap is italicized (IgV/IgC overlap), and the transmembrane domain is underlined and in bold (transmembrane domain).
  • a representative amino acid sequence comprising a partial sequence of the native bovine B7-H7 is provided:
  • Figure 23 shows an alignment of the amino acid sequences of representative native human B7-H7, native pan troglodytes B7-H7 and native macaca mulatta B7-H7.
  • nucleic acids refer to any naturally occurring nucleic acid sequences encoding B7-H7, including the immature or precursor and mature forms.
  • Accession Nos. for the nucleotide sequence of native mammalian B7-H7 include: BC035971 (GL23272002; homo sapiens) and AK126162 (GL5726284; homo sapiens).
  • a representative nucleotide sequence encoding the immature/precursor form of native human B7-H7 which comprises the nucleotide sequence encoding the signal peptide (underlined) and the nucleotide sequence encoding the mature human native B7-H7 (italicized), is provided:
  • a representative nucleotide sequence encoding pan trolodytes is provided:
  • a representative nucleotide sequence encoding macaca mulatto is provided:
  • a representative nucleotide sequence encoding bovine is provided:
  • the nucleic acid is an isolated or purified nucleic acid.
  • nucleic acids encode the immature or precursor form of a naturally occurring mammalian B7-H7.
  • nucleic acids encode the mature form of a naturally occurring mammalian B7-H7.
  • nucleic acids encoding native B7-H7 encode the precursor form of naturally occurring human B7-H7.
  • nucleic acids encoding native B7-H7 encode the mature form of naturally occurring human B7-H7.
  • native B7-H7CR in the context of proteins or polypeptides refers to any naturally occurring B7-H7CR amino acid sequences, including immature or precursor and mature forms.
  • Accession Nos. for the amino acid sequence of native mammalian B7-H7CR include: Q96BF3-1 ⁇ homo sapiens), Q96BF3-2 ⁇ homo sapiens), and NP_653216.1 (GI: 21389429; homo sapiens).
  • a representative amino acid sequence of the immature/precursor form of one isoform of native human B7-H7CR, which comprises the signal peptide (underlined) and the mature human native B7-H7CR (italicized) is provided:
  • amino acid sequence of a second isoform of native human B7-H7CR differs from this first isoform in that amino acid residues 186 to 189 of SEQ ID NO:5 are missing in the second isoform.
  • a representative amino acid sequence of native bos taurus B7-H7CR is provided:
  • Figure 24 shows an alignment of the amino acid sequences of representative native human B7-H7CR, native pan troglodytes B7-H7CR, and native bos taurus B7-H7CR.
  • native B7-H7CR is the immature or precursor form of a naturally occurring mammalian B7-H7CR.
  • native B7-H7CR is the mature form of a naturally occurring mammalian B7-H7CR.
  • native B7-H7CR is the precursor form of naturally occurring human B7-H7CR.
  • native B7-H7CR is the mature form of naturally occurring human B7-H7CR.
  • the native B7-H7CR protein/polypeptide is isolated or purified.
  • the human B7-H7CR polypeptide is otherwise referred to as transmembrane and immunoglobulin domain containing 2 (TMIGD2) in the literature/databases but the function of B7-H7CR was not previously elucidated.
  • At least one isoform of human B7-H7CR polypeptide is 282 amino acids in length and has been reported to contain the following: a signal sequence, an immunoglobulin-like (Ig-like) domain, a transmembrane domain, and a cytoplasmic domain.
  • Ig-like immunoglobulin-like domain
  • the cytoplasmic domain of human B7-H7CR includes a proline rich region (amino acid residues 227-277), which may be involved in binding to SH3 domain-containing adaptor proteins.
  • the cytoplasmic domain of human B7-H7CR includes a serine residue (S220), which may be phosphorylated. Human B7-H7CR is also predicted to have N-linked glycosylation sites at amino acid residues 73, 105, and 127.
  • the IgV domain of human B7-H7CR comprises a pair of conserved cysteines at positions 44 and 112 that may form a disulphide bond. Cys residues at positions 67 and 81 may also form structurally important disulphide bonds. In addition, tyrosine residues of importance are found at positions 192, 197, and 222 of native human B7-H7CR (e.g., SEQ ID NO:5).
  • nucleic acids refers to any naturally occurring nucleic acid sequences encoding B7-H7CR, including the immature or precursor and mature forms.
  • Accession Nos. for the nucleotide sequence of native mammalian B7-H7CR include: AK358964 ⁇ homo sapiens) and BCO 15655 ⁇ homo sapiens).
  • native human B7-H7CR which comprises the nucleotide sequence encoding the signal peptide (underlined) and the nucleotide sequence encoding the mature human native B7-H7CR (italicized), is provided:
  • ggaagtctgt caactgggag ggggagaggg gggtgatggg ccaggaatgg ggtcccggg 60 catggtgctg ggcctcctgg tgcagatctg ggccctgcaa gaagcctcaa gcctgagcgt 120 gcagcagggg cccaacttgc tgcaggtgag gcagggcagt caggcgaccc tggtctgcca 180 ggtggaccag gccacagcct gggaacggct ccgtgttaag tggacaagg atggggccat 240 cctgtgtcaa ccgtacatca ccaacggcag cctcagcctg ggggtctgcg ggccccaggg 300 acggctctct
  • a representative nucleotide sequence encoding native bos taurus is provided: 1 atggggtccc cgggcacagt gctggtcctc ctggtgcagt tctgggtcct acaaggagtc
  • a nucleic acid alignment of representative native human B7-H7CR, native pan troglodytes B7-H7CR, and native bos taurus B7-H7CR is included as Figure 25.
  • the nucleic acid is an isolated or purified nucleic acid.
  • nucleic acids encode the immature or precursor form of a naturally occurring mammalian B7-H7CR.
  • nucleic acids encode the mature form of a naturally occurring mammalian B7-H7CR.
  • nucleic acids encoding native B7-H7CR encode the precursor form of naturally occurring human B7- H7CR.
  • nucleic acids encoding native B7-H7CR encode the mature of naturally occurring human B7-H7CR.
  • the term "native CD28" in the context of proteins or polypeptides refers to any naturally occurring CD28 amino acid sequences, including immature or precursor and mature forms.
  • Accession Nos. for the amino acid sequence of various species of native mammalian CD28 include: P10747-1 ⁇ homo sapiens), P 10747-2 (homo sapiens), P 10747-3 (homo sapiens), P 10747-4 (homo sapiens), P 10747-5 (homo sapiens), P10747-6 (homo sapiens), NP_006130.1 (GL5453611; homo sapiens), P31041-1 (mouse), and Q28071-1 (bovine).
  • a representative amino acid sequence of one isoform of the immature/precursor form of native human CD28, which comprises the signal peptide (underlined) and the mature human native CD28 (italicized) is provided:
  • native CD28 is the immature or precursor form of a naturally occurring mammalian CD28.
  • native CD28 is the mature form of a naturally occurring mammalian CD28.
  • native CD28 is the precursor form of naturally occurring human CD28.
  • native CD28 is the mature form of naturally occurring human CD28.
  • the native CD28 is not a naturally occurring mouse CD28.
  • the native CD28 protein/polypeptide is isolated or purified.
  • At least one isoform of human CD28 polypeptide is 220 amino acids in length and has been reported to contain the following: a signal sequence, an immunoglobulin-like (Ig- like) V-type domain, an extracellular domain, a transmembrane domain, and a cytoplasmic domain.
  • a human CD28 isoform has been reported to contain the following: a signal sequence at amino acid residues 1 to 18 of the sequence at Accession No. P 10747-1, an Ig-like V-type domain at amino acid reisdues 28 to 137 of the sequence at Accession No. P 10747-1, an extracellular domain at amino acid residues 19 to 152 of the sequence at Accession No.
  • nucleic acids in the context of nucleic acids refers to any naturally occurring nucleic acid sequences encoding CD28, including the immature or precursor and mature forms.
  • Accession Nos. for the nucleotide sequence of various species of native mammalian CD28 include: J02988.1 (GL338444; homo sapiens), BC093698.1 (GL62739452; homo sapiens), M34563.1 (GI: 19248; mouse), and X93304.1 (GI: 1369933; bovine).
  • a representative nucleotide sequence encoding the immature/precursor form of native human CD28 which comprises the nucleotide sequence encoding the signal peptide (underlined) and the nucleotide sequence encoding the mature human native CD28 (italicized), is provided:
  • nucleic acid is an isolated or purified nucleic acid.
  • nucleic acids encode the immature or precursor form of a naturally occurring mammalian CD28.
  • nucleic acids encode the mature form of a naturally occurring mammalian CD28.
  • nucleic acids encoding native CD28 encode the precursor form of naturally occurring human CD28.
  • nucleic acids encoding native CD28 encode the mature of naturally occurring human CD28.
  • nucleic acids do not encode native mouse CD28.
  • CTLA-4 in the context of proteins or polypeptides refers to any naturally occurring CTLA-4 amino acid sequences, including immature or precursor and mature forms.
  • Accession Nos. for the amino acid sequence of various species of native mammalian CTLA-4 include: P 16410-1 (homo sapiens), NP_001032720.1 (GL83700231; homo sapiens), NP_005205.2
  • native CTLA-4 is the immature or precursor form of a naturally occurring mammalian CTLA-4. In other embodiments, native CTLA-4 is the mature form of a naturally occurring mammalian CTLA-4. In a specific embodiment, native CTLA-4 is the precursor form of naturally occurring human CTLA-4. In another embodiment, native CTLA-4 is the mature form of naturally occurring human CTLA-4. In one embodiment, the native CTLA-4 protein/polypeptide is isolated or purified.
  • CTLA-4 polypeptide is also known as Cytotoxic T-lymphocyte-associated antigen 4 and CD52. At least one isoform of human CTLA-4 polypeptide is 223 amino acids in length and has been reported to contain the following: a signal sequence, an
  • immunoglobulin-like (Ig-like) V-type domain an extracellular domain, a transmembrane domain, and a cytoplasmic domain.
  • a human CTLA-4 isoform has been reported to contain the following: a signal sequence at amino acid residues 1 to 35 of the sequence at Accession No. P 16410-1, an Ig-like V-type domain at amino acid reisdues 39 to 140 ofthe sequence at Accession No. P16410-1, an extracellular domain at amino acid residues 36 to 161 ofthe sequence at Accession No. P16410-1, a transmembrane domain at amino acid residues 162 to 182 ofthe sequence at Accession No. P16410-1, and a cytoplasmic domain at amino acid residues 183 to 223 ofthe sequence at Accession No. P16410-1.
  • CTLA-4 in the context ofnucleic acids refers to any naturally occurring nucleic acid sequences encoding CTLA-4, including the immature or precursor and mature forms.
  • Non-limiting examples ofAccession Nos. for the nucleotide sequence ofvarious species ofnative mammalian CTLA-4 include: AF414120.1
  • a representative nucleotide sequence encoding the immature/precursor form of native human CTLA-4 which comprises the nucleotide sequence encoding the signal peptide (underlined) and the nucleotide sequence encoding the mature human native CTLA-4
  • nucleic acid is an isolated or purified nucleic acid.
  • nucleic acids encode the immature or precursor form of a naturally occurring mammalian CTLA-4.
  • nucleic acids encode the mature form of a naturally occurring mammalian CTLA-4.
  • nucleic acids encoding native CTLA-4 encode the precursor form of naturally occurring human CTLA-4.
  • nucleic acids encoding native CTLA-4 encode the mature of naturally occurring human CTLA-4.
  • ICOS in the context of proteins or polypeptides refers to any naturally occurring ICOS amino acid sequences, including immature or precursor and mature forms.
  • Accession Nos. for the amino acid sequence of various species of native mammalian ICOS include: Q9Y6W8-1 ⁇ homo sapiens), Q9Y6W8-1 (homo sapiens), ⁇ ?
  • _036224 ⁇ (GL 15029518; homo sapiens), Q9WVS0-1 (mouse), NP_059508.2 (GL224809335; mouse), Q9R1T7-1 (rat), Q9R1T7-2 (rat), Q58DF9- 1 (bovine), and NP_001029447.1 (GL77735505; bovine).
  • a representative amino acid sequence of a first isoform the immature/precursor of native human ICOS, which comprises the signal peptide (underlined) and the mature human native ICOS (italicized) is provided: MKSGLWYFFL FCLRIKVLTG EINGS ⁇ NYEM FIFHNGGVQI LCKYPDIVQQ
  • amino acid sequence of a second isoform of native human ICOS differs from this first isoform in that amino acid residues 168 to 199 of SEQ ID NO: 11 are as follows: KYSSSVHDPNGEYMFMRAVNTAKKSRLTDVTL (SEQ ID NO:26) ⁇ M.
  • This second isoform is predicted to be secreted.
  • native ICOS is the immature or precursor form of a naturally occurring mammalian ICOS. In other
  • native ICOS is the mature form of a naturally occurring mammalian ICOS.
  • native ICOS is the precursor form of naturally occurring human ICOS.
  • native ICOS is the mature form of naturally occurring human ICOS.
  • the native ICOS protein/polypeptide is isolated or purified.
  • ICOS is otherwise referred to as Inducible T-cell costimulator, Activation- inducible lymphocyte immunomediatory molecule, and CD278 in the literature.
  • At least one isoform of human ICOS polypeptide is 199 amino acids in length and has been reported to contain the following: a signal sequence, an immunoglobulin-like (Ig-like) V-type domain, an extracellular domain, a transmembrane domain, and a cytoplasmic domain.
  • a human ICOS isoform has been reported to contain the following: a signal sequence at amino acid residues 1 to 20 of the sequence at Accession No.
  • Q9Y6W8-1 an Ig-like V-type domain at amino acid reisdues 30 to 140 of the sequence at Accession No. Q9Y6W8-1, an extracellular domain at amino acid residues 21 to 140 of the sequence at Accession No. Q9Y6W8-1, a
  • transmembrane domain at amino acid residues 141 to 160 of the sequence at Accession No. Q9Y6W8-1, and a cytoplasmic domain at amino acid residues 161 to 199.
  • nucleic acids refers to any naturally occurring nucleic acid sequences encoding ICOS, including the immature or precursor and mature forms.
  • Accession Nos. for the nucleotide sequence of various species of native mammalian ICOS include: AF218312.1 (GL7963649; homo sapiens), AF216748.1 (GL7288512; mouse), and BT021638.1 (GL61553958; bovine).
  • nucleotide sequence encoding the immature/precursor form of native human ICOS which comprises the nucleotide sequence encoding the signal peptide (underlined) and the nucleotide sequence encoding the mature human native ICOS (italicized), is provided:
  • nucleic acid is an isolated or purified nucleic acid.
  • nucleic acids encode the immature or precursor form of a naturally occurring mammalian ICOS.
  • nucleic acids encode the mature form of a naturally occurring mammalian ICOS.
  • nucleic acids encoding native ICOS encode the precursor form of naturally occurring human ICOS.
  • nucleic acids encoding native ICOS encode the mature form of naturally occurring human ICOS.
  • the term "native ligand” refers to any naturally occurring ligand that binds to a naturally occurring receptor.
  • the ligand is a mammalian ligand.
  • the ligand is a human ligand.
  • the term “native receptor” refers to any naturally occurring receptor that binds to a naturally occurring ligand. In a specific embodiment, the receptor is a mammalian receptor. In another specific embodiment, the receptor is a human receptor.
  • the terms “nucleic acid”, “nucleotide” and “polynucleotide” refers to deoxyribonucleotides, deoxyribonucleic acids, ribonucleotides, and ribonucleic acids, and polymeric forms thereof, and includes either single- or double-stranded forms.
  • Nucleic acids include naturally occurring nucleic acids, such as deoxyribonucleic acid (“DNA”) and ribonucleic acid (“RNA”) as well as nucleic acid analogs. Nucleic acid analogs include those which include non-naturally occurring bases, nucleotides that engage in linkages with other nucleotides other than the naturally occurring phosphodiester bond or which include bases attached through linkages other than phosphodiester bonds.
  • DNA deoxyribonucleic acid
  • RNA ribonucleic acid
  • nucleic acid analogs include, for example and without limitation, phosphorothioates, phosphorodithioates, phosphorotriesters, phosphoramidates, boranophosphates, methylphosphonates, chiral-methyl phosphonates, 2-O-methyl ribonucleotides, peptide-nucleic acids (PNAs), locked-nucleic acids (LNAs), and the like.
  • premature human infant refers to a human infant born at less than 37 weeks of gestational age.
  • prevention in the context of administering a therapy to a subject refers to the prophylactic effect that a subject derives from receiving a therapy.
  • such terms refer to the inhibition of the development or onset of a disease or a symptom associated therewith, or inhibition of the recurrence of a disease or a symptom thereof.
  • the terms “purified” and “isolated” in the context of an agent refers to an agent that is substantially free of chemical precursors or other chemicals when chemically synthesized, i.e., it is separated from chemical precursors or other chemicals which are involved in the synthesis of the protein.
  • the agent is 60%, 65%, 75%, 80%, 85%, 90%, 95%, or 99% free (by dry weight) of other, different compounds or agents.
  • a natural source e.g., cells
  • contaminating materials from the natural source e.g., soil particles, minerals, chemicals from the environment, and/or cellular materials from the natural source, such as but not limited to cell debris, cell wall materials, membranes, organelles, the bulk of the nucleic acids, carbohydrates, proteins, and/or lipids present in cells.
  • substantially free of natural source materials refers to preparations of an agent that has been separated from the material (e.g., cellular components of the cells) from which it is isolated.
  • an agent that is isolated includes preparations of a compound or agent having less than about 30%, 20%, 10%, 5%, 2%, or 1% (by dry weight) of cellular materials and/or contaminating materials.
  • an "isolated" nucleic acid sequence or nucleotide sequence is one which is separated from other nucleic acid molecules which are present in a natural source of the nucleic acid sequence or nucleotide sequence.
  • an "isolated", nucleic acid sequence or nucleotide sequence, such as a cDNA molecule can be substantially free of other cellular material or culture medium when produced by recombinant techniques, or substantially free of chemical precursors when chemically synthesized.
  • an "isolated" nucleic acid sequence or nucleotide sequence is a nucleic acid sequence or nucleotide sequence that is recombinantly expressed in a heterologous cell.
  • polypeptide(s) interchangeably to refer to a chain of amino acids linked together by peptide bonds.
  • protein(s) and polypeptide(s) refer to a macromolecule which comprises amino acids that are linked together by peptide bonds.
  • the terms “subject” and “patient” are used interchangeably and refer to an animal.
  • a mammal such as a non- primate (e.g., cows, pigs, horses, cats, dogs, rats etc.) and a primate (e.g., monkey and human), most preferably a human.
  • a non-human animal e.g., a non-human animal such as a pig, horse, cow, cat, or dog.
  • such terms refer to a pet or farm animal.
  • such terms refer to a human.
  • the term "Therapeutic Agent(s)” refers to an agent(s) that modulates one or more immune system functions or responses.
  • a Therapeutic Agent modulates one or more of the signal transduction pathways induced when a native ligand binds to a native receptor.
  • a Therapeutic Agent modulates the interaction between a native receptor and one or more of its native ligands.
  • a Therapeutic Agent modulates the expression of a native receptor or a native ligand.
  • a therapeutic agent is an agonist.
  • a therapeutic agent is an antagonist.
  • the terms “therapies” and “therapy” can refer to any protocol(s), method(s), compositions, formulations, and/or agent(s) that can be used in the prevention, treatment, management, or amelioration of a disease, e.g., cancer, infectious disease, autoimmune disease, graft versus host disease, and transplantation rejection, or a symptom associated therewith.
  • the terms “therapies” and “therapy” refer to drug therapy, adjuvant therapy, radiation, surgery, biological therapy, supportive therapy, and/or other therapies useful in treatment, management, prevention, or amelioration of a condition or disorder or a symptom thereof.
  • a therapy includes the use of a Therapeutic Agent as an adjuvant therapy.
  • a therapeutic Agent in conjunction with a drug therapy, biological therapy, surgery, and/or supportive therapy.
  • a therapy includes a Therapeutic Agent.
  • a therapy includes an Immunostimulating Therapeutic Agent.
  • a therapy includes an Inhibitory Therapeutic Agent.
  • a therapy is not an Immunostimulating Therapeutic Agent.
  • a therapy is not an Inhibitory Therapeutic Agent.
  • treatment of a subject with a Therapeutic Agent achieves one, two, three, four, or more of the following effects: (i) reduction or amelioration the severity of disease or symptom associated therewith; (ii) reduction in the duration of a symptom associated with a disease; (iii) prevention of the progression of a disease or symptom associated therewith; (iv) regression of a disease or symptom associated therewith; (v) prevention of the development or onset of a symptom associated with a disease; (vi) prevention of the recurrence of a symptom associated with a disease; (vii) reduction in the hospitalization of a subject; (viii) reduction in the hospitalization length; (ix) an increase in the survival of a subject with a disease; (x) a reduction in the number of symptoms associated with
  • Table 1 List of the cDNA clone collection used in the receptor-ligand proteome. Over 1,900 human genes encoding for full length plasma membrane cDNA in mammalian expression vector are included in this proteome system for screening of receptor and ligand interactions.
  • FIG. 1 Schematic view of the receptor-ligand proteome.
  • a set of -1,900 plasmids encoding human transmembrane genes are placed individually into five 384-well plates and transfected into 293T cells by lipofectamine.
  • a target fusion protein and a secondary fluorescence-labeled antibody are subsequently added to the transfected cells after eight hours. Twenty-four hours later, the Applied Biosystem 8200 Cellular Detection System (CDS) performs the scanning on cell surface for positive wells. Individual plasmids within each well with positive hits will be picked and study further for validation.
  • CDS Cellular Detection System
  • FIG. 1 Identification of B7-H2 and CD28 interaction by the receptor-ligand proteomic system.
  • a set of ⁇ l,900 plasmids with human transmembrane genes at 30ng/well were placed individually into four 384-well plates, and transiently transfected into 293T cells by lipofectamine.
  • Human CD28Ig R&D systems, Minneapolis, MN
  • anti-human Ig FMAT blue secondary antibody Applied Biosystems, Foster City, CA
  • the plates were read 24 hrs after transfection by the Applied Biosystems 8200 cellular detection system and analyzed by CDS 8200 software.
  • the 3-D illustration represents the result of a 384-well plate.
  • each well is indicated at the bottom (from 1 to 24) and at the side (from A to P) of the plate.
  • Each bar represents the total fluorescence intensity in the FLl gate in each well of the 384-well plate.
  • the well transfected with human B7-H2 gene (Kl 1) was shown to be positive in addition to B7-1 (C17) and B7-2 (K24).
  • the Fc Receptors (D15, 05) are positive controls for transfection because they bind directly to labeled 2nd antibody.
  • P24 is the negative control with mock- transfected 293T cells.
  • Figures 3A-3K Identification and characterization of B7-H2 as the third ligand for CD28 and CTLA-4.
  • CD28-trans medium (D) or CTLA-4-transfected 293T cells (E) were also stained by B7-H2Ig with or without blocking mAb against B7-H2 (clone MIH12). All data were analyzed by a FACScan flow cytometry.
  • ICOSIg and CD28Ig at the indicated concentrations were injected into flow cells that were coated with B7-H2Ig at 500RUs and the responses were determined by Surface Plasmon Resonance.
  • CTLA4Ig at the indicated concentration were injected into a flow cell coated with B7-H2Ig at 5000RUs. In all experiments, injections of these fusion proteins into uncoated control flow cells were served as the control. Binding data were overlaid with the fit of 1 : 1 interaction model with drifting baseline.
  • G-I Interactions between B7-H2/ICOS and B7/CD28 pathways.
  • 293T cells were transiently transfected with full length human B7-H2 plasmids.
  • CD28Ig and CTLA4Ig were used to stain the transfectants, and analyzed by flow cytometry. Isotype-matched human Ig (control Ig) was included as controls (upper panels).
  • CD28Ig and CTLA4Ig at 10 ⁇ g/ml were pre-incubated with excessive amount of B7-lIg (middle panels) or B7-2Ig (lower panels) at 40 ⁇ g/ml for 15 minutes before staining B7-H2+ 293T cells.
  • B7-H2 with CD28/CTLA-4 vs. ICOS
  • CD28 (H) or CTLA-4 (I) transfected 293T cells were stained by B7-H2Ig at 10 ⁇ g/ml, and excess amount of ICOSIg at 20 ⁇ g/ml was included to compete the binding. All data were analyzed by a FACScan flow cytometry.
  • Peripheral blood T cells from healthy donor were negatively selected and purified by Pan T cell isolation kit on affinity column. Purified CD3+ T cells at 3x10 5 cells/well were stimulated with immobilized anti-human CD3 mAb (OKT3) at the indicated concentrations and 5 ⁇ g/ml B7-H2Ig or control Ig (ctl Ig) .
  • immobilized anti-human CD3 mAb OKT3
  • ctl Ig control Ig
  • blocking mAb against ICOS clone C398.4A
  • CD28 clone CD28.6
  • 3HTdR was added during the final six hours of culture, and the incorporation of 3HTdR was determined by a scintillation counter.
  • K Purified CD3+ T cells at 2.5xlO 5 cells/wells were stimulated by CD3 mAb/B7-H2Ig as described in (J).
  • B7-H2 mAb (clone MIH 12 or 9F.8A4) or control Ig (ctl Ig) at 10 ⁇ g/ml was included to block coated B7-H2Ig for lhr and unbound mAbs were subsequently washed away by media before addition of T cells.
  • Figure 4 Comparison of binding affinities of B7-H2 to ICOS, CD28 and CTLA- 4.
  • Human B7-H2-GFP plasmids were transiently transfected into 293T cell. GFP high population was gated and assessed for binding of ICOS, CD28 and CTLA4 fusion proteins at 10 ⁇ g/ml and analyzed by flow cytometry.
  • FIGS 5A-5B Interactions of the B7-CD28 family molecules. 293T cells were transfected with full length human (A) or mouse (B) B7-CD28 family genes as indicated on the X axis. Human (A) or mouse (B) fusion proteins were added to the culture as indicated on the Y axis to evaluate their bindings to the transfectants by CDS. Graphic view of individual wells is captured by 8200 CDS software.
  • Figures 6A-6B B7-H2 interacts with ICOS, CD28 and CTLA4 through overlapping domains.
  • FIG. 1 Cartoon illustration of B7-H2-ICOS interaction is modeled using crystal structure of B7-2-CTLA4 (RCSB PDB H85), and generated by Pymol software (DeLano Scientific LLC).
  • FIG. 1 Cartoon illustration of B7-H2-ICOS interaction is modeled using crystal structure of B7-2-CTLA4 (RCSB PDB H85), and generated by Pymol software (DeLano Scientific LLC).
  • FIG. 1 Cartoon illustration of B7-H2 with its receptors by site- directed mutagenesis. Human B7-H2 full length gene was cloned into pcDNA3.1 so that the gene as fused with C terminal GFP tag. Single point mutations were introduced into B7-H2- GFP plasmid at residues buried at ligand-receptor interacting interface (shown in purple in cartoon).
  • B7-H2 plasmids (wild-type and mutants) were then transiently transfected into 293T cells and the expression of B7-H2 was confirmed by anti-B7-H2 staining.
  • Binding of human ICOS, CD28, CTLA4 fusion proteins to B7-H2 mutant-GFP plasmids were measured by flow cytometry and normalized against 293T cells expressing wild-type B7-H2-GFP (100%) and vector control (0%). Binding percentages relative to wild type B7-H2 (100%) and vector control (0%) are positive and negative controls.
  • FIG. B7-H7 sequence homology to previously described B7 family molecules. Human B7-H7 protein sequence was aligned by ClustalW program with other B7 ligand family members including B7-1, B7-2, B7-H1, B7-DC, B7-H3 and B7-H4.
  • Figure 8 Identification of B7-H7 and B7-H7R interaction by the CDS system. Using the identical procedure as described in Figure 2, B7-H7Ig and anti-mlg FMAT blue secondary antibody were added to the 384-well plates 8 hours after transfection. The plates were read by the Applied Biosystems 8200 cellular detection system and analyzed by CDS 8200 software 24 hrs after transfection. Human B7-H7CR (Jl 8) was identified as a positive hit in addition to positive controls, FcR (05) and OLN (Pl).
  • FIG. 9 B7-H7CR sequence homology to previously described CD28 family members. Human B7-H7CR protein sequence was aligned by ClustalW program with other CD28 family members including CD28, CTLA-4, PD-I and ICOS.
  • Figures 10A-10F Identification and characterization of a novel T cell costimulatory pathway through B7-H7 and B7-H7CR interaction.
  • 293T cells were transiently transfected with the plasmid containing human B7-H7CR cDNA or vector plasmid, and were subsequently stained by specific mAb to B7-H7CR (clone 4-5, upper panels) or B7-H7Ig (lower panels). Data were analyzed by a FACScan flow cytometry.
  • B Constitutive and inducible expression of B7-H7 on macrophages and dendritic cells.
  • Human monocytes were purified from blood of healthy donors and cultured in vitro for one week at the presence of GM-CSF or GM-CSF + IL-4 to differentiate into macrophages (M ) or dendritic cells (DC), respectively.
  • Cells were also treated without (None) or with IFN- ⁇ , poly LC or heat-killed Listeria monocytogenes (HKLM) for 24 hrs and subsequently stained by a anti-B7-H7 mAb (clone 2D3). Data were analyzed by a FACScan flow cytometry.
  • (D)B7-H7Ig costimulates CD4+ T cell proliferation and cytokine production.
  • Peripheral blood CD4+ T cells from healthy donor were negatively selected and purified by affinity column.
  • Purified CD4+ T cells at 2.5xlO 5 cells/well were stimulated with immobilized anti-human CD3 mAb (OKT3) at the indicated concentrations and 5 ⁇ g/ml B7- H7Ig or control Ig (ctl Ig) .
  • 3HTdR was added during the final six hours of culture and the incorporation of 3HTdR was determined by a scintillation counter.
  • culture supernatants were collected and cytokines were measured by sandwich ELISA kits with specific pairs of mAb.
  • E Costimulation of CD4+ T cell proliferation by agonistic B7-H7CR mAb.
  • E CD4+ T cells were purified and stimulated as described in (D). Instead of B7-H7Ig, an anti-B7-H7CR mAb (clone 4-5) was co-immobilized with anti-CD3 mAb in the plate (left panel).
  • a CD28 mAb clone CD28.2, 1 ⁇ g/ml was added to the culture together with B7-H7CR mAb (right panel).
  • B7-H7 mAb 2D3 completely blocks the binding of B7-H7CR to B7- H7+ cells.
  • CHO cells were transfected with the plasmid encoding human B7-H7 and subsequently stained by 10 ⁇ g/ml B7-H7CRIg without (left panel) or with (right panel) a B7- H7 mAb (clone 2D3) at 20 ⁇ g/ml as described previously.
  • B7-H7CR specifically binds B7-H7 but not other B7 family members.
  • 293T cells were transfected with individual B7 family members including B7-1, B7-2, B7- Hl, B7-DC, B7-H2, B7-H3 (both 2Ig and 4 Ig forms) and B7-H4.
  • B7- H7CRIg After staining with B7- H7CRIg at lO ⁇ g/ml and fluorescence-labeled secondary mAb, cells were analyzed by flow cytometry and the data is shown as density of fluorescence.
  • Figure 13 Detection of human B7-H7 and B7-H7CR mRNA in tissues. Human tissue cDNA arrays (Clontech) were used as templates with B7-H7 and B7-H7CR specific primer pairs, respectively, to perform RT-PCR. G3PDH primer pairs serve as controls.
  • FIG. 14 Failure to detect cell surface B7-H7 on T, B, NK cells and monocytes.
  • Human peripheral blood mononuclear cells were purified and co-stained with anti-B7-H7 mAb and cell type specific antibody against T cells (CD3), B cells (CD 19), NK cells (CD56) and monocytes (CD 14). After staining, cells were analyzed by flow cytometry and the data is shown as density of fluorescence.
  • FIGS 15A-15B Illustration of new costimulatory pathways.
  • A Intersection between the B7-CD28 and B7-H2/ICOS pathways. Previously described interactions are indicated in black lines and newly described interactions are shown in bold.
  • B Newly described interactions between B7-H7 and B7-H7CR.
  • A-C Specificity of B7-H2 bindings to CD28 and CTLA-4.
  • 293T cells were transiently transfected with human full length B7-H2 (a), CD28 (b) or CTLA-4 (c) plasmids, and were subsequently stained by the indicated specific mAb or fusion proteins.
  • mAb or fusion proteins were also included with other agents to examine specificity of the binding. Cells were analyzed using FACScan flow cytometry.
  • ICOSIg left panel
  • CD28Ig middle panel
  • CTLA-4Ig right panel
  • the same fusion proteins were injected into uncoated control flow cells to serve as the control. Binding data was overlaid with the fit of 1 : 1 interaction model.
  • CD28Ig and CTLA-4Ig at lO ⁇ g/ml were pre-incubated with excessive amount of B7-lIg (middle panels) or B7-2Ig (lower panels) at 40 ⁇ g/ml for 15 minutes before staining.
  • FIG. 18 Identification of mAbs that differentially abrogate B7-H2/CD28 and B7-H2/ICOS interactions.
  • 293T cells were transiently transfected with human full length ICOS (ICOS+ 293T), CD28 (CD28+ 293T) or CTLA-4 (CTLA-4+ 293T) plasmids, and were stained by B7-H2Ig or control (ctl) Ig.
  • Specific mAbs to B7-H2, clone MIH 12 or 9F.8A4 as well as control mouse Ig were included in the cultures to examine their blocking effects of B7-H2Ig binding. Cells were analyzed by flow cytometry.
  • FIGS 19A-19B Mouse B7-H2 does not interact with mouse CD28 and CTLA- 4.
  • A 293T cells were transiently transfected with mouse full length B7-H2 plasmids, and were stained by mouse ICOSIg, CD28Ig and CTLA-4Ig.
  • B A mouse B7-H2/hB7-H2IgV chimera construct was made by replacing mouse B7-H2 Ig V region (Metl-Vall49) with the human corresponding region (Metl-Glnl23) in the mouse B7-H2 full length gene. 293T cells were transiently transfected to express this chimera gene, and were stained by mouse ICOSIg, CD28Ig and CTLA-4Ig. The results were analyzed by flow cytometry.
  • Figures 20A-20E B7-H2 costimulation of human T cells through CD28.
  • B7-H2/CD28 interaction costimulates human T cell proliferation.
  • Peripheral blood T cells from a healthy donor were negatively selected and purified using a Pan T cell isolation kit ( Miltenyi).
  • Purified CD3 + T cells at 2.5x10 /well were stimulated with immobilized anti-human CD3 mAb (OKT3) at the indicated concentrations and 5 ⁇ g/ml of immobilized B7-H2Ig or control Ig (ctl Ig).
  • B7-H2 mAb (clone M1H12 or 9F.8A4) or control mouse Ig (ctl Ig) at lO ⁇ g/ml was included in soluble form to block coated B7-H2Ig for lhr and unbound mAbs were subsequently washed away by media before addition of T cells.
  • 3 HTdR was added during the final six hours of culture, and the incorporation of 3 HTdR was determined by a scintillation counter.
  • B7-H2 costimulates cytokine production from human T cells through CD28.
  • Purified CD4 + T cells at 2.5x1 Ov'wclls were stimulated by immobilized CD3 mAb and B7- H2Ig as described in (a).
  • MIH 12, 9F.8A4 or control mouse Ig (ctl Ig) at lO ⁇ g/ml was used in soluble form to block B7-H2Ig interaction with its receptors.
  • Supernatants were collected daily up to three days. Cytokine levels were measured by BD Cytometric Bead Array (CBA) human Thl/Th2 cytokine kit and CBA IL- 17A Flex set, and analyzed by FCAP Array software. Each data point is an average of triplicates with standard deviation.
  • CBA Cytometric Bead Array
  • C & D B7-H2/CD28 interaction enhances response of tetanus toxoid-specific memory T cells.
  • C Monocyte-derived dendritic cells at 2.5xlO 4 /well and purified autologous T cells at 3xlO 5 /well were mixed together and incubated with tetanus toxoid at indicated concentration for five days. Blocking mAbs against CD28 (clone CD28.6), B7-H2 (clone MTH 12 and 9F.8A4) or control mouse Tg at lO ⁇ g/ml was included in soluble form at the beginning of the culture.
  • Blocking mAbs against CD28 (clone CD28.6), B7-H2 (clone MIH 12 and 9F.8A4) or control mouse Ig at 1 O ⁇ g/nil was included in soluble form at the beginning of the culture for five days.
  • Interferon gamma concentration was measured in day 5 supernatants by BD (CBA) Human Thl/Th2 cytokine kit and analyzed by FCAP Array software. Each data point is an average of triplicates with standard deviation.
  • FIG. 21 B7-H2/CD28 interaction promotes division of human T cells.
  • Peripheral blood T cells from a healthy donor were negatively selected and purified by Pan T cell isolation kit on affinity column.
  • Purified CD3 + T cells were labled with 5 ⁇ M CSFE.
  • Labeled human T cells at 2.5 x 10 5 cells/well were stimulated with immobilized anti-human CD3 niAB (OKT3) at the indicated concentrations and 5 ⁇ g/ml B7-H2Ig or control Ig (ctl Ig).
  • B7-H2 rnAB clone MIH 12 or 9F.8A4
  • control Ig (ctl Ig) at 10 ⁇ g/ml was included to block coated B7-H2Ig for 1 hour and unbound mAbs were subsequently washed away by media before addition of T cells.
  • T cells were collected on day 4 and analyzed by FACScan flow cytometry.
  • FIG. 22 Comparison of cytokine production induced by B7-1 and B7-2 costimulation.
  • Purified CD4 + T cells from PBMC of a healthy donor at 2.5 x 10 5 cells/well were stimulated by immobilized CD3 mAb and B7-lIg or B7-2Ig. Supernatants were collected daily up to three days. Cytokine levels were measured by BD Cytometric Bead Array (CBA) Human Thl/Th2 cytokine kit and CBA IL- 17A Flex set, and analyzed by FCAP Array software. Each data point is an average of triplicates.
  • CBA Cytometric Bead Array
  • Figure 23 An alignment of amino acid sequences of representative native human B7-H7, native pan troglodytes B7-H7, and native macaca mulatta B7-H7.
  • Figure 24 An alignment of the amino acid sequences of representative native human B7-H7CR, native pan troglodytes B7-H7CR, and native bos taurus B7-H7CR.
  • Figure 25 An alignment of the nucleic acid sequences of representative native human B7-H7CR, native pan troglodytes B7-H7CR, and native bos taurus B7-H7CR.
  • B7-H7CR as a co-stimulatory receptor and the modulation of one or more signal transduction pathways mediated by B7- H7CR to one or more of its ligands (e.g., B7-H7).
  • B7-H7CR antibodies that specifically bind to B7-H7, B7-H7CR, or the complex of B7-H7 and B7-HCR.
  • Therapeutic Agents that modulate the interaction between certain co-stimulatory receptors and one or more of their ligands, and the use of such Therapeutic Agents for modulating one or more immune system functions.
  • the Therapeutic Agents described herin are based, in part, on the discovery of new co-stimulatory receptor- ligand interactions.
  • the Therapeutic Agents can be used in cell culture to modulate immune cell functions (e.g., lymphocyte proliferation, cytokine production, or antibody production).
  • a cell may be contacted with a Therapeutic Agent to modulate one or more immune cell functions.
  • a Therapeutic Agent can be administered to a subject to prevent, treat or manage certain diseases, such as cancer, an infectious disease, an
  • Described herein are methods of identifying receptor-ligand interactions. Such methods can be used to identify interactions between costimulatory ligands and costimulatory receptors.
  • antibodies that specifically bind to a B7-H7 polypeptide In one aspect, presented herein are antibodies that specifically bind to a B7-H7 polypeptide. In a specific embodiment, presented herein are antibodies that specifically bind to a human B7-H7 polypeptide. In another specific embodiment, presented herein are antibodies that specifically bind to a native B7-H7 polypeptide ⁇ e.g., a native human B7-H7 polypeptide) and inhibit or reduce the binding of the native B7-H7 polypeptide to one or more B7-H7 receptors ⁇ e.g., a native B7-H7CR polypeptide). In a more specific
  • antibodies that specifically bind to a native B7-H7 polypeptide ⁇ e.g., a native human B7-H7 polypeptide) and inhibit or reduce the binding of native B7-H7 polypeptide ⁇ e.g., a native human B7-H7 polypeptide) to a native B7-H7CR polypeptide ⁇ e.g., a native human B7-H7CR polypeptide).
  • Such antibodies may block (sterically or non-sterically) the binding of the B7-H7 polypeptide to B7-H7CR polypeptide.
  • an antibody reduces the binding of the B7-H7 polypeptide to B7-H7CR polypeptide by at least 10%, 15%, 25%, 30%, 40%, 50%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 10% to 25%, 10% to 50%, 10% to 75%, 25% to 50%, 25% to 75%, 25% to 98%, 50% to 98%, or 75% to 100% relative to a negative control (e.g., binding of the B7-H7 polypeptide to B7- H7CR polypeptide in the absence of the antibody or in the presence of a negative control antibody that is known not to bind to B7-H7) as determined by methods well known in the art, e.g., ELISA, cell-based assays including flow cytometry, KinEx A assay, and plasmon surface resonance assay (e.g., BIAcore ® assay).
  • a negative control e.g., binding of the B7-H7 polypeptide to B7-
  • antibodies that specifically bind to a B7- H7CR polypeptide In another aspect, presented herein are antibodies that specifically bind to a B7- H7CR polypeptide. In a specific embodiment, presented herein are antibodies that specifically bind to a human B7-H7CR polypeptide. In another specific embodiment, presented herein are antibodies that specifically bind to a native B7-H7CR polypeptide (e.g., a native human B7-H7CR) and inhibits or reduces the binding of the native B7-H7CR to one or more B7-H7CR ligands (e.g., a native B7-H7 polypeptide). In a more specific
  • antibodies that specifically bind to a native B7-H7CR polypeptide (e.g., a native human B7-H7CR polypeptide) and inhibit or reduce the binding of a native B7-H7CR polypeptide (e.g., a native human B7-H7CR polypeptide) to a native B7- H7 polypeptide (e.g., native human B7-H7 polypeptide).
  • a native B7-H7CR polypeptide e.g., a native human B7-H7CR polypeptide
  • Such antibodies may block (sterically or non-sterically) the binding of the B7-H7 polypeptide to B7-H7CR polypeptide.
  • an antibody reduces the binding of the B7-H7 to B7-H7CR by at least 10%, 15%, 25%, 30%, 40%, 50%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 10% to 25%, 10% to 50%, 10% to 75%, 25% to 50%, 25% to 75%, 25% to 98%, 50% to 98%, or 75% to 100% relative to a negative control (e.g., binding of the B7-H7 polypeptide to B7-H7CR polypeptide in the absence of the antibody or in the presence of a negative control antibody that is known not to bind to B7-H7) as determined by methods well known in the art, e.g., ELISA, cell-based assays including flow cytometry, KinEx A assay, and plasmon surface resonance assay (e.g., BIAcore ® assay).
  • the antibody that specifically binds to a B7-H7CR polypeptide is an agonist
  • antibodies that specifically bind to B7- H7CR/B7-H7 complex are antibodies that specifically bind to human B7-H7CR/human B7-H7 complex.
  • antibodies that specifically bind to a native B7- H7CR/native B7-H7 complex e.g., a native human B7-H7CR/native human B7-H7 complex
  • a native B7-H7CR/native B7-H7 complex e.g., a native human B7-H7CR/native human B7-H7 complex
  • Such antibodies may block (sterically or non- stericaally) the native B7-H7CR to one or more B7-H7CR ligands.
  • the antibody reduces the binding of the native B7-H7CR polypeptide to one or more native B7-H7CR ligands by at least 10%, 15%, 25%, 30%, 40%, 50%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 10% to 25%, 10% to 50%, 10% to 75%, 25% to 50%, 25% to 75%, 25% to 98%, 50% to 98%, or 75% to 100% relative to a negative control (e.g., binding of the native B7-H7CR polypeptide to one or more native B7-H7CR ligands in the absence of the antibody or in the presence of a negative control antibody that is known not to bind to B7-H7) as determined by methods well known in the art, e.g., ELISA, cell-
  • an antibody that specifically binds to a B7- H7CR/B7-H7 complex inhibits or reduces the binding of native B7-H7 to one or more of its receptors.
  • Such antibodies may block (sterically or non-sterically) the binding of native B7- H7 to one or more its receptors.
  • antibodies that bind to B7-H7 and neutralize B7-H7 are presented herein.
  • antibodies that bind to B7-H7CR and neutralize B7-H7CR are antibodies that bind to B7-H7CR and neutralize B7-H7CR.
  • an antibody described in this section comprises a modified Fc domain.
  • Exemplary Fc domain modifications are described in Mueller et al, 1997, Molecular Immunology 34(6):441-452; Swann et al., 2008, Current Opinion in Immunology 20:493-499; and Presta, 2008, Current Opinion in Immunology 20:460-470.
  • antibodies that bind B7-H7 and increase degradation are presented herein.
  • polypeptide, or the B7-H7/B7-H7CR complex can be produced by any method well known in the art, e.g., as described in U.S. Patent Nos. 5,807,715, 6,331,415, and 6,818,216; U.S. Patent Application Publication Nos. US 2002/0098189, US 2004/0028685, US
  • This antibody as discussed in the example section below was generated from a hybridoma derived from the fusion of SP2 myeloma with B cells from a mouse immunized with human B7-H7-Ig.
  • the monoclonal antibody designated 4-5 was generated from a hybridoma derived from the fusion of SP2 myeloma with B cells from a hamster immunized with human B7-H7CR-Ig.
  • antigen-binding fragments e.g., Fab fragments, F(ab') fragments, F(ab') 2 fragments
  • antibodies such as monoclonal antibodies
  • competition assays known to one of skill in the art may be used to assess the competition of the 2D3 antibody or the 4-5 antibody for binding to native B7-H7 polypeptide or native B7-H7CR polypeptide, respectively.
  • an immunoassay e.g., an ELISA
  • a competitive format may be used.
  • an antibody that specifically binds to B7-H7 polypeptide comprises the VL chain or VH chain of the antibody 2D3.
  • an antibody that specifically binds to B7-H7 polypeptide comprises the VL chain of the antibody 2D3 and the VH chain of another antibody.
  • an antibody that specifically binds to B7-H7 polypeptide comprises the VH chain of the antibody 2D3 and the VL chain of another antibody.
  • an antibody that specifically binds to B7-H7 polypeptide comprises the VL chain of the antibody 2D3 and the VH chain of the antibody 2D3.
  • an antibody that specifically binds to B7-H7 polypeptide comprises the VL domain or VH domain of the antibody 2D3.
  • an antibody that specifically binds to B7-H7 polypeptide comprises the VL domain of the antibody 2D3 and the VH domain of another antibody.
  • an antibody that specifically binds to B7-H7 polypeptide comprises the VH domain of the antibody 2D3 and the VL domain of another antibody.
  • an antibody that specifically binds to B7-H7 polypeptide comprises the VL domain of the antibody 2D3 and the VH domain of the antibody 2D3.
  • an antibody that specifically binds to B7-H7CR polypeptide comprises the VL chain or VH chain of the antibody 4-5.
  • an antibody that specifically binds to B7-H7CR polypeptide comprises the VL chain of the antibody 4-5 and the VH chain of another antibody.
  • an antibody that specifically binds to B7-H7CR polypeptide comprises the VH chain of the antibody 4-5 and the VL chain of another antibody.
  • an antibody that specifically binds to B7-H7CR polypeptide comprises the VL chain of the antibody 4-5 and the VH chain of the antibody 4- 5.
  • an antibody that specifically binds to B7-H7CR polypeptide comprises the VL domain or VH domain of the antibody 4-5.
  • an antibody that specifically binds to B7-H7CR polypeptide comprises the VL domain of the antibody 4-5 and the VH domain of another antibody.
  • an antibody that specifically binds to B7-H7CR polypeptide comprises the VH domain of the antibody 4-5 and the VL domain of another antibody.
  • an antibody that specifically binds to B7-H7CR polypeptide comprises the VL domain of the antibody 4-5 and the VH domain of the antibody 4-5.
  • antibodies that specifically bind to B7-H7 comprising one, two or three complementarity determining regions (CDRs) of the variable heavy chain (VH CDRs) of the antibody 2D3 and/or one, two or three CDRs of the variable light chain (VL CDRs) of the antibody 2D3.
  • CDRs complementarity determining regions
  • an antibody that specifically binds to B7-H7 comprises (or alternatively, consists of) a VH CDRl and a VL CDRl; a VH CDRl and a VL CDR2; a VH CDRl and a VL CDR3; a VH CDR2 and a VL CDRl; VH CDR2 and a VL CDR2; a VH CDR2 and a VL CDR3; a VH CDR3 and a VL CDRl; a VH CDR3 and a VL CDR2; a VH CDR3 and a VL CDR3; a VHl CDRl, a VH CDR2 and a VL CDRl; a VH CDRl, a VH CDR2 and a VL CDR2; a VH CDRl, a VH CDR2 and a VL CDR2; a VH CDRl, a VH CDR2 and
  • antibodies that specifically bind to B7- H7CR polypeptide comprising one, two or three complementarity determining regions (CDRs) of the variable heavy chain (VH CDRs) of the antibody 4-5 and/or one, two or three CDRs of the variable light chain (VL CDRs) of the antibody 4-5.
  • CDRs complementarity determining regions
  • an antibody that specifically binds to B7-H7CR comprises (or alternatively, consists of) a VH CDRl and a VL CDRl; a VH CDRl and a VL CDR2; a VH CDRl and a VL CDR3; a VH CDR2 and a VL CDRl; VH CDR2 and a VL CDR2; a VH CDR2 and a VL CDR3; a VH CDR3 and a VL CDRl; a VH CDR3 and a VL CDR2; a VH CDR3 and a VL CDR3; a VHl CDRl, a VH CDR2 and a VL CDRl; a VH CDRl, a VH CDR2 and a VL CDR2; a VH CDRl, a VH CDR2 and a VL CDR2; a VH CDRl, a VH CDR2
  • the sequences of the antibody 2D3 and 4-5 can be determined using standard techniques known to one skilled in the art and the VH chain, VL chain, VH domain, VL domain, VH CDRs, and VL CDRs can be determined using, e.g. , the Kabat numbering system (such as the EU index in Kabat).
  • the antibodies presented herein include derivatives that are chemically modified by, e.g., the covalent or non-covalent attachment of any type of molecule to the antibody.
  • Antibody derivatives also include antibodies that have been chemically modified by, e.g., glycosylation, acetylation, pegylation, phosphorylation, amidation, derivatization by known protecting/blocking groups, proteolytic cleavage, linkage to a cellular ligand or other protein, etc. Any of numerous chemical modifications may be carried out by known techniques, including, but not limited to specific chemical cleavage, acetylation, formylation, metabolic synthesis of tunicamycin, etc. Additionally, the derivative may contain one or more non- classical amino acids.
  • the antibodies provided herein presented herein can comprise a framework region known to those of skill in the art (e.g., a human or non-human fragment).
  • the framework region may be naturally occurring or consensus framework regions.
  • nucleic acids encoding the antibodies presented herein.
  • a nucleic acid molecule(s) encoding an antibody presented herein is isolated.
  • a nucleic acid(s) encoding an antibody presented herein or generated in accordance with the methods provided herein is not isolated.
  • a nucleic acid(s) encoding an antibody presented herein is integrated, e.g., into chromosomal DNA or an expression vector.
  • a nucleic acid(s) presented herein encodes for the antibody 2D3, the antibody 4-5 or a fragment thereof (in particular, an antigen-binding fragment thereof).
  • the antibodies described herein can be affinity matured using techniques known to one of skill in the art.
  • the monoclonal antibodies described herein can be chimerized using techniques known to one of skill in the art.
  • a chimeric antibody is a molecule in which different portions of the antibody are derived from different immunoglobulin molecules. Methods for producing chimeric antibodies are known in the art. See, e.g., Morrison, 1985, Science 229: 1202; Oi et al, 1986, BioTechniques 4:214; Gillies et al, 1989, J. Immunol. Methods 125: 191-202; and U.S. Patent Nos. 5,807,715, 4,816,567, 4,816,397, and 6,331,415, which are incorporated herein by reference in their entirety.
  • a humanized antibody is an antibody which is capable of binding to a predetermined antigen and which comprises a framework region having substantially the amino acid sequence of a human immunoglobulin and a CDR having substantially the amino acid sequence of a non-human immunoglobulin.
  • a humanized antibody comprises substantially all of at least one, and typically two, variable domains (Fab, Fab', F(ab')2, Fv) in which all or substantially all of the CDR regions correspond to those of a non human immunoglobulin (i.e., donor antibody) and all or substantially all of the framework regions are those of a human immunoglobulin consensus sequence.
  • a humanized antibody also comprises at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin.
  • Fc immunoglobulin constant region
  • the antibody will contain both the light chain as well as at least the variable domain of a heavy chain.
  • the antibody also may include the CHl, hinge, CH2, CH3, and CH4 regions of the heavy chain.
  • the humanized antibody can be selected from any class of
  • immunoglobulins including IgM, IgG, IgD, IgA and IgE, and any isotype, including IgGl, IgG2, IgG3 and IgG4.
  • the constant domain is a complement fixing constant domain where it is desired that the humanized antibody exhibit cytotoxic activity, and the class is typically IgGl. Where such cytotoxic activity is not desirable, the constant domain may be of the IgG2 class.
  • VL and VH constant domains that can be used in certain embodiments include, but are not limited to, C-kappa and C-gamma-1 (nGlm) described in Johnson et al. (1997) J. Infect. Dis. 176, 1215-1224 and those described in U.S. Patent No.
  • the humanized antibody may comprise sequences from more than one class or isotype, and selecting particular constant domains to optimize desired effector functions is within the ordinary skill in the art.
  • the framework and CDR regions of a humanized antibody need not correspond precisely to the parental sequences, e.g., the donor CDR or the consensus framework may be mutagenized by substitution, insertion or deletion of at least one residue so that the CDR or framework residue at that site does not correspond to either the consensus or the import antibody. Such mutations, however, will not be extensive.
  • humanized antibody residues will correspond to those of the parental framework (FR) and CDR sequences, more often 90%, and most preferably greater than 95%.
  • Humanized antibodies can be produced using variety of techniques known in the art, including but not limited to, CDR-grafting (European Patent No. EP 239,400;
  • framework residues in the framework regions will be substituted with the corresponding residue from the CDR donor antibody to alter, preferably improve, antigen binding.
  • framework substitutions are identified by methods well known in the art, e.g., by modeling of the interactions of the CDR and framework residues to identify framework residues important for antigen binding and sequence comparison to identify unusual framework residues at particular positions. (See, e.g., Queen et al., U.S. Patent No. 5,585,089; and Reichmann et al., 1988, Nature 332:323, which are incorporated herein by reference in their entireties.)
  • antibodies presented herein are modified to have an extended (or increased) half-life in vivo.
  • presented herein are antibodies which have a half-life in a subject, preferably a mammal and most preferably a human, of from about 3 days to about 180 days (or more), and in some embodiments greater than 3 days, greater than 7 days, greater than 10 days, greater than 15 days, greater than 20 days, greater than 25 days, greater than 30 days, greater than 35 days, greater than 40 days, greater than 45 days, greater than 50 days, at least about 60 days, greater than 75 days, greater than 90 days, greater than 105 days, greater than 120 days, greater than 135 days, greater than 150 days, greater than 165 days, or greater than 180 days.
  • modified antibodies having an increased half-life in vivo are generated by introducing one or more amino acid modifications (i.e., substitutions, insertions or deletions) into an IgG constant domain, or FcRn-binding fragment thereof (preferably a Fc or hinge-Fc domain fragment).
  • amino acid modifications i.e., substitutions, insertions or deletions
  • FcRn-binding fragment thereof preferably a Fc or hinge-Fc domain fragment.
  • the antibodies may have one or more amino acid modifications in the second constant domain (i.e., the CH2 domain at, e.g., residues 231-340 of human IgGl) and/or the third constant domain (i.e., the CH3 domain at, e.g., residues 341-447 of human IgGl), with numbering according to the Kabat numbering system (e.g., the EU index in Kabat).
  • the Kabat numbering system e.g., the EU index in Kabat.
  • inert polymer molecules such as high molecular weight polyethyleneglycol (PEG) are attached to the antibodies with or without a multifunctional linker either through site-specific conjugation of the PEG to the N- or C-terminus of the antibodies or via epsilon-amino groups present on lysine residues.
  • PEG polyethyleneglycol
  • Linear or branched polymer derivatization that results in minimal loss of biological activity will be used.
  • the degree of conjugation can be closely monitored by SDS-PAGE and mass spectrometry to ensure proper conjugation of PEG molecules to the antibodies.
  • Unreacted PEG can be separated from antibody-PEG conjugates by size- exclusion or by ion-exchange chromatography.
  • PEG-derivatized antibodies can be tested for binding activity as well as for in vivo efficacy using methods well-known to those of skill in the art, for example, by immunoassays described herein.
  • antibodies are conjugated to albumin in order to make the antibody more stable in vivo or have a longer half-life in vivo.
  • the techniques are well- known in the art, see, e.g., International Publication Nos. WO 93/15199, WO 93/15200, and WO 01/77137; and European Patent No. EP 413,622, all of which are incorporated herein by reference.
  • antibodies are conjugated or recombinantly fused to a diagnostic, detectable or therapeutic agent or any other molecule.
  • a diagnostic, detectable or therapeutic agent or any other molecule When in vivo half-life is desired to be increased, said antibodies can be modified.
  • the conjugated or recombinantly fused antibodies can be useful, e.g., in detecting tissues or cells that express B7-H7 polypeptide or B7-H7CR polypeptide.
  • a method for detecting B7- H7 expressing cells or tissue comprises contacting an antibody that specifically binds to B7- H7 with cells or tissues of a subject and detecting the cells or tissues to which the antibody binds.
  • a method for detecting B7-H7CR expressing cells or tissue comprises contacting an antibody that specifically binds to B7-H7CR with cells or tissues of subject and detecting the cells or tissues to which the antibody binds.
  • the antibody can be conjugated to a detectable moiety and the binding of an antibody to cells or tissues can be detected by detecting the presence of the detectably moiety.
  • the binding of the antibody to cells or tissues can be detected by detecting using a labeled secondary antibody that binds to the antibody and detecting the presence of the labeled secondary antibody.
  • the methods for detecting B7-H7- or B7-H7CR-expressing cells or tissues includes the use of positive and/or negative controls.
  • cells or tissues known to express B7-H7 or B7-H7CR can be used in the methods as a positive control and cells or tissues known not to express B7-H7 or B7-H7CR can be used in the methods as a negative control.
  • detectable moieties include, but not limited to, various enzymes, such as, but not limited to, horseradish peroxidase, alkaline phosphatase, beta-galactosidase, or acetylcholinesterase; prosthetic groups, such as, but not limited to, streptavidin/biotin and avidin/biotin; fluorescent materials, such as, but not limited to, umbelliferone, fluorescein, fluorescein isothiocynate, rhodamine, dichlorotriazinylamine fluorescein, dansyl chloride or phycoerythrin; luminescent materials, such as, but not limited to, luminol; bioluminescent materials, such as but not limited to, luciferase, luciferin, and aequorin; radioactive materials, such as, but not limited to, iodine ( 131 I, 125 I, 123 I, and 121 I,), carbon ( 14 C),
  • antibodies recombinantly fused or chemically conjugated including both covalent and non-covalent conjugations
  • a heterologous protein or polypeptide or fragment thereof, preferably to a polypeptide of about 5, about 10, about 20, about 30, about 40, about 50, about 60, about 70, about 80, about 90 or about 100 amino acids
  • fusion proteins comprising an antigen-binding fragment of a monoclonal antibody (e.g., a Fab fragment, Fd fragment, Fv fragment, F(ab)2 fragment, a VH domain, a VH CDR, a VL domain or a VL CDR) and a heterologous protein, polypeptide, or peptide.
  • a monoclonal antibody e.g., a Fab fragment, Fd fragment, Fv fragment, F(ab)2 fragment, a VH domain, a VH CDR, a VL domain or a VL CDR
  • heterologous protein, polypeptide, or peptide that the antibody is fused to is useful for targeting the antibody to a particular cell type.
  • Therapeutic moieties or drug moieties are not to be construed as limited to classical chemical therapeutic agents.
  • the drug moiety may be a peptide or polypeptide possessing a desired biological activity.
  • Such proteins may include, for example, interferon- ⁇ , interferon- ⁇ , interferon- ⁇ , interleukin-2 (“IL-2”), interleukin-7 (“IL-7”), interleukin 9 (“IL-9”), interleukin- 10 (“IL-10”), interleukin- 12 (“IL-12”), interleukin- 15 (“IL- 15”), interleukin-23 (“IL-23”), granulocyte macrophage colony stimulating factor (“GM-CSF”), granulocyte colony stimulating factor (“G-CSF” )), or a growth factor.
  • the therapeutic moiety or drug conjugated or recombinantly fused to an antibody should be chosen to achieve the desired prophylactic or therapeutic effect(s). A clinician or other medical personnel should consider the following when deciding on which therapeutic moiety or drug to conjugate or
  • antibodies can be fused to marker sequences, such as a peptide to facilitate purification.
  • the marker amino acid sequence is a hexa- histidine peptide, such as the tag provided in a pQE vector (QIAGEN, Inc.), among others, many of which are commercially available.
  • hexa-histidine provides for convenient purification of the fusion protein.
  • peptide tags useful for purification include, but are not limited to, the hemagglutinin ("HA") tag, which corresponds to an epitope derived from the Influenza hemagglutinin protein (Wilson et al., 1984, Cell 37:767), and the "flag" tag.
  • HA hemagglutinin
  • fusion proteins may be generated, for example, through the techniques of gene-shuffling, motif-shuffling, exon-shuffling, and/or codon-shuffling (collectively referred to as "DNA shuffling").
  • DNA shuffling may be employed to alter the activities of the monoclonal antibodies described herein or generated in accordance with the methods provided herein (e.g., antibodies with higher affinities and lower dissociation rates). See, generally, U.S. Patent Nos. 5,605,793, 5,811,238, 5,830,721, 5,834,252, and 5,837,458; Patten et al., 1997, Curr. Opinion Biotechnol.
  • Antibodies, or the encoded antibodies may be altered by being subjected to random mutagenesis by error-prone PCR, random nucleotide insertion or other methods prior to recombination.
  • a polynucleotide encoding a monoclonal antibody described herein or generated in accordance with the methods provided herein may be recombined with one or more components, motifs, sections, parts, domains, fragments, etc. of one or more heterologous molecules.
  • An antibody can also be conjugated to a second antibody to form an antibody heteroconjugate as described by Segal in U.S. Patent No. 4,676,980, which is incorporated herein by reference in its entirety.
  • An antibody can also be linked to two, three, or more antibodies to form a bispecific or multispecific antibody.
  • An antibody can also be attached to solid supports, which are particularly useful for immunoassays or purification of an antigen.
  • solid supports include, but are not limited to, glass, cellulose, polyacrylamide, nylon, polystyrene, polyvinyl chloride or polypropylene.
  • an antibody described in this section comprises a modified Fc domain.
  • Exemplary Fc domain modifications are described in Mueller et al., 1997, Molecular Immunology 34(6):441-452; Swann et al, 2008, Current Opinion in Immunology 20:493-499; and Presta, 2008, Current Opinion in Immunology 20:460-470.
  • Therapeutic Agents that modulate one or more of the signal transduction pathways mediated by a native B7-H7 polypeptide binding to one or more of its ligands (e.g., B7-H7CR).
  • Therapeutic Agents that modulate one or more of the signal transduction pathways mediated by a native B7-H7CR binding to one or more of its ligands (e.g., B7-H7).
  • Therapeutic Agents that modulate one or more of the signal transduction pathways induced when a native B7-H7 polypeptide binds to a native B7-H7CR polypeptide.
  • a Therapeutic Agent modulates the interaction between a native B7-H7CR polypeptide and a native B7-H7 polypeptide.
  • Therapeutic Agents that modulate the expression of a native B7-H7CR polypeptide or a native B7-H7 polypeptide.
  • a Therapeutic Agent selectively modulates the expression of a native B7-H7CR polypeptide or a native B7-H7 polypeptide. See Sections 5.2.1 to 5.2.6, infra, for specific examples of Therapeutic Agents.
  • one or more signal transduction pathways are modulated by contacting a Therapeutic Agent with an immune cell or a population of immune cells.
  • the interaction between B7-H7 and one or more of its receptors e.g., B7-H7CR
  • B7-H7CR one or more of its receptors
  • B7-H7CR and its ligands e.g., B7-H7
  • B7-H7CR is modulated by contacting a Therapeutic Agent with an immune cell or a population of immune cells.
  • the expression of B7- H7 or B7-H7CR is modulated by contacting a Therapeutic Agent with an immune cell or a population of immune cells expressing B7-H7 or B7-HCR, respectively.
  • a Therapeutic Agent modulates one or more of the signal transduction pathways induced by B7-H7 binding to B7-H7CR.
  • a Therapeutic Agent selectively modulates one or more signal transduction pathways induced by B7-H7 binding to B7-H7CR. In certain embodiments, a Therapeutic Agent selectively induces one or more of the signal transduction pathways induced by the binding of B7-H7 to B7-H7CR.
  • a Therapeutic Agent induces one or more of the signal transduction pathways induced by the binding of B7-H7 to B7-H7CR by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H7 to B7-H7CR in the absence of the Therapeutic Agent.
  • a Therapeutic Agent induces one or more of the signal transduction pathways induced by the binding of B7-H7 to B7-H7CR by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H7 to B7-H7CR in the absence of the Therapeutic Agent; and (ii) does not induce, or induces one or more of the signal transduction pathways induced by the binding of B7-H7CR to one or more other ligands by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 2% to 5%, 2% to 10%, 5% to 10%, 5% to 15%, 5% to 20%, 10% to 15%, or 15% to 20% relative to the one or more signal transduction pathways
  • a Therapeutic Agent induces one or more of the signal transduction pathways induced by the binding of B7-H7 to B7-H7CR by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H7 to B7- H7CR in the absence of the Therapeutic Agent; and (ii) does not induce, or induces one or more of the signal transuction pathways induced by the binding of B7-H7 to one or more other receptors by less than 20%, 15%, 10%, 5%, or 2%, or in the rnage of between 2% to 5%, 2% to 10%, 5% to 10%, 5% to 15%, 5% to 20%, 10% to 15%, or 15% to 20% relative to the one or more
  • a Therapeutic Agent selectively activates or enhances one or more of the signal transduction pathways induced by the binding of B7-H7 to B7-H7CR.
  • a Therapeutic Agent activates or enhances one or more of the signal transduction pathways induced by the binding of B7-H7 to B7-H7CR by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H7 to B7-H7CR in the absence of the Therapeutic Agent.
  • a Therapeutic Agent activates or enhances one or more of the signal transduction pathways induced by the binding of B7-H7 to B7-H7CR by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H7 to B7-H7CR in the absence of the Therapeutic Agent; and (ii) does not activate or enhance, or activates or enhances one or more of the signal transduction pathways induced by the binding of B7-H7 to one or more other receptors by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 2% to 5%, 2% to 10%, 5% to 10%, 5% to 15%, 5% to 20%, 10% to 15%, or 15% to 20% relative to the one or
  • a Therapeutic Agent activates or enhances one or more of the signal transduction pathways induced by the binding of B7-H7 to B7-H7CR by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7- H7 to B7-H7CR in the absence of the Therapeutic Agent; and (ii) does not activate or enhance, or activates or enhances one or more of the signal transduction pathways induced by the binding of B7-H7CR to one or more other ligands by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 2% to 5%, 2% to 10%, 5% to 10%, 5% to 15%, 5% to 20%, 10% to 15%, or 15%
  • a Therapeutic Agent selectively inhibits or reduces one or more of the signal transduction pathways induced by the binding of B7-H7 to B7-H7CR.
  • a Therapeutic Agent inhibits or reduces one or more of the signal transduction pathways induced by the binding of B7-H7 to B7-H7CR by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H7 to B7-H7CR in the absence of the Therapeutic Agent.
  • a Therapeutic Agent (i) inhibits or reduces one or more of the signal transduction pathways induced by the binding of B7-H7 to B7-H7CR by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H7 to B7-H7CR in the absence of the Therapeutic Agent; and (ii) does not inhibit or reduce, or inhibits or reduces one or more of the signal transduction pathways induced by the binding of B7-H7 to one or more other receptors by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 2% to 5%, 2% to 10%, 5% to 10%, 5% to 15%, 5% to 20%, 10% to 15%, or 15% to 20% relative to the one or
  • a Therapeutic Agent (i) inhibits or reduces one or more of the signal transduction pathways induced by the binding of B7-H7 to B7-H7CR by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H7 to B7-H7CR in the absence of the Therapeutic Agent; and (ii) does not inhibit or reduce, or inhibits or reduces one or more of the signal transduction pathways induced by the binding of B7-H7CR to one or more other ligands by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 2% to 5%, 2% to 10%, 5% to 10%, 5% to 15%, 5% to 20%, 10% to 15%, or 15%
  • a Therapeutic Agent modulates the B7-H7 polypeptide and B7-H7CR polypeptide interaction.
  • the Therapeutic Agent selectively modulates the B7-H7 and B7-H7CR interaction.
  • a Therapeutic Agent inhibits or reduces the binding of B7-H7 to B7-H7CR by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the binding of B7-H7 to B7-H7CR in the absence of the Therapeutic Agent.
  • a Therapeutic Agent (i) inhibits or reduces the binding of B7-H7 to B7-H7CR by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the binding of B7-H7 to B7-H7CR in the absence of the Therapeutic Agent, and (ii) does not inhibit or reduce, or inhibits or reduces the binding of B7-H7 to one or more other receptors by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 2% to 5%, 2% to 10%, 5% to 10%, 5% to 15%, 5% to 20%, 10% to 15%, or 15% to 20% relative to the binding of B7-H7 to such one or more other receptors in the absence of the Therapeutic Agent.
  • a Therapeutic Agent (i) inhibits or reduces the binding of B7-H7 to B7-H7CR by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the binding of B7-H7 to B7-H7CR in the absence of the Therapeutic Agent, and (ii) does not inhibit or reduce, or inhibits or reduces the binding of B7-H7CR to one or more other ligands by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 2% to 5%, 2% to 10%, 5% to 10%, 5% to 15%, 5% to 20%, 10% to 15%, or 15% to 20% relative to the binding of B7-H7CR to such one or more other ligands in the absence of the Therapeutic Agent.
  • the Therapeutic Agents induce, activate or enhance one or more immune functions or responses (i.e, the agents are Immunostimulating Therapeutic Agents).
  • the Therapeutic Agents suppress or reduce one or more immune functions or responses (i.e.., the agents are Inhibitory Therapeutic Agents).
  • the modulation of one or more immune functions or responses can be in the form of, e.g., an antibody response (humoral response) or a cellular immune response, e.g., cytokine secretion (e.g., interferon-gamma), helper activity or cellular cytotoxicity.
  • cytokine secretion, antibody production, effector function, T cell proliferation, and/or NK cell proliferation is modulated following contact with a Therapeutic Agent.
  • one or more immune functions or responses is modulated by contacting a Therapeutic Agent with an immune cell or a population of immune cells.
  • the Therapeutic Agent is an antibody that specifically binds to a native B7-H7 polypeptide and modulates one or more of the signal transduction pathways mediated by the binding of the native B7-H7 polypeptide to one or more of its ligands (e.g., B7-H7CR).
  • the Therapeutic Agent is an antibody that specifically binds to a native B7-H7CR polypeptide and modulates one or more of the signal transduction pathways mediated by the native B7-H7CR polypeptide binding to one or more of its ligands (e.g., B7-H7).
  • the Therapeutic Agent activates, enhances, or induces one or more of the signal transduction pathways.
  • the Therapeutic Agent inhibits or reduces one or more of the signal transduction pathways.
  • the Therapeutic Agent is an antibody that modulates one or more of the signal transduction pathways induced by the B7-H7 polypeptide and B7-H7CR polypeptide interaction.
  • a Therapeutic Agent is an antibody that modulates the interaction between B7-H7CR and B7-H7.
  • the Therapeutic Agent is an antibody that specifically binds to B7-H7 polypeptide and inhibits or reduces the binding of B7-H7 polypeptide to B7-H7CR polypeptide.
  • the Therapeutic Agent is an antibody that specifically binds to B7-H7 polypeptide and inhibits or reduces the binding of B7-H7 polypeptide to B7-H7CR polypeptide.
  • Therapeutic Agent is an antibody that specifically binds to B7-H7 polypeptide and inhibits or reduces the binding of B7-H7CR polypeptide to B7-H7 polypeptide. See Section 5.1 et seq., supra, for antibodies and conjugates or fusion thereof that modulate the B7-H7 polypeptide and B7-H7CR polypeptide interaction. In some embodiments, such antibodies are
  • an antibody that modulates the B7-H7 polypeptide and B7- H7CR polypeptide interaction induces at least 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 25% to 98%, 50% to 75%, or 75% to 100% one or more of the signal transduction pathways induced when a native mammalian B7-H7 polypeptide binds to a native receptor of B7-H7 polypeptide ⁇ e.g., a native B7-H7CR polypeptide), as measured by assays well-known in the art.
  • an antibody that modulates the B7-H7 polypeptide and B7-H7CR polypeptide interaction activates or enhances by at least 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 25% to 98%, 50% to 75%, or 75% to 100% one or more of the signal transduction pathways induced when a native mammalian B7-H7 polypeptide binds to a native receptor of B7-H7 polypeptide ⁇ e.g., a native B7-H7CR polypeptide), as measured by assays well-known in the art.
  • an antibody that modulates the B7-H7 polypeptide and B7-H7CR polypeptide interaction does not induce or induces less than 20%, 15%, 10%, 5% or 2%, or in the range of between 2% to 20%, 2% to 15%, 2% to 10%, or 2% to 5% of one or more of the signal transduction pathways induced when a native mammalian B7-H7 polypeptide binds to a receptor of B7-H7 polypeptide ⁇ e.g., a native B7-H7CR polypeptide), as measured by assays well-known in the art.
  • the one or more signal transduction pathways induced by the binding of a native receptor of B7-H7 can be measured by, e.g., assessing the activation of a signal transduction moiety ⁇ e.g., Jun kinase activation, MAP kinase activation, PKC activation), the translocation of a transcription factor ⁇ e.g., NF-kappa B or Statl), and cytokine production ⁇ e.g., IL-2, IL-4, IL-5, IL-10, IL-17, interferon-gamma, or tumor necrosis factor-alpha) using techniques such as ELISAs, Western blots, electromobility shift assays, and other immunoassays.
  • a signal transduction moiety e.g., Jun kinase activation, MAP kinase activation, PKC activation
  • a transcription factor e.g., NF-kappa B or Statl
  • cytokine production
  • a Therapeutic Agent is the antibody designated 2D3, or an antigen-bindign fragment thereof, or a human or humanized for thereof. In some embodiments, a Therapeutic Agent is the antibody designated 4-5, or an antigen-bindign fragment thereof, or a human or humanized for thereof.
  • an antibody described in this section comprises a modified Fc domain.
  • Exemplary Fc domain modifications are described in Mueller et al, 1997, Molecular Immunology 34(6):441-452; Swann et al., 2008, Current Opinion in Immunology 20:493-499; and Presta, 2008, Current Opinion in Immunology 20:460-470.
  • a Therapeutic Agent is a B7-H7 polypeptide.
  • such a Therapeutic Agent modulates one or more of the signal transduction pathways mediated by B7-H7CR.
  • the B7-H7 protein binds to and agonizes signal transduction through B7-H7CR.
  • the B7-H7 protein binds to B7- H7CR and antagonizes signal transduction by blocking binding of a native ligand (e.g., B7- H7).
  • a Therapeutic Agent modulates one or more of the signal transduction pathways induced by B7-H7 binding to B7-H7CR.
  • such a Therapeutic Agent modulates the B7-H7 polypeptide and B7-H7CR polypeptide interaction.
  • a Therapeutic Agent is a B7-H7 derivative.
  • a Therapeutic Agent is a B7-H7 derivative that modulates one or more signal transduction pathways mediated by B7-H7CR.
  • a Therapeutic Agent is a B7-H7 derivative that modulates one or more of the signal transduction pathways induced by B7-H7 binding to B7-H7CR.
  • a Therapeutic Agent is a B7-H7 derivative that modulates the B7-H7 polypeptide and B7-H7CR polypeptide interaction.
  • the B7-H7 derivative is an Immunostimulating Therapeutic Agent.
  • the B7-H7 derivative is an Inhibitory Therapeutic Agent.
  • a B7-H7 derivative is: (a) a polypeptide that is at least 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 99% or is 40% to 65%, 50% to 90%, 65% to 90%, 70% to 90%, 75% to 95%, 80% to 95%, or 85% to 99% identical to a native mammalian B7-H7 polypeptide; (b) a polypeptide encoded by a nucleic acid sequence that is at least 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 99% or is 40% to 65%, 50% to 90%, 65% to 90%, 70% to 90%, 75% to 95%, 80% to 95%, or 85% to 99% identical a nucleic acid sequence encoding a native mammalian B7-H7 polypeptide; (c) a polypeptide that is at least 40%,
  • a B7-H7 derivative is a derivative of a native human B7-H7 polypeptide.
  • a B7-H7 derivative is a derivative of an immature or precursor form of naturally occurring human B7-H7 polypeptide.
  • a B7-H7 derivative is a derivative of a mature form of naturally occurring human B7-H7 polypeptide.
  • a B7-H7 derivative is isolated or purified.
  • a B7-H7 derivative comprises (or consists) of the amino acid sequence ofnative B7-H7 with 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20 or more, or in the range of 1 to 5, 1 to 10, 2 to 15, 5 to 20, 5 to 30, 10 to 50, 25 to 75 mutations (e.g., amino acid substitutions, insertions and/or deletions).
  • mutations e.g., amino acid substitutions, insertions and/or deletions.
  • a B7-H7 derivative comprises one or more mutations that increase the affinity of B7-H7 for one or more of its receptors, e.g., B7-H7CR (in particular, native B7-H7CR). In other embodiments, a B7-H7 derivative comprises one or more mutations that decrease the affinity of B7-H7 for one or more of its receptors, e.g., B7-H7CR (in particular, native B7- H7CR).
  • a B7-H7 derivative comprises one or more mutations in one or more of the Ig-like V-type domains and/or Ig-like C-I type domains of native B7-H7 and such mutations change (e.g., increase) the affinity of B7-H7 for B7-H7CR.
  • a B7-H7 derivative comprises one or more mutations at one or more of the following amino acid residues of native B7-H7: 141-144, 156, 158, 160, 162, 193-196, 198, 200, 201, 224, and/or 225.
  • a B7-H7 derivative comprises one or more mutations at one or more of the following amino acid residues which are predicted to be N-linked glycosylation sites: 90, 103, and/or 127.
  • Mutations can be introduced at specific positions with native B7-H7 using, e.g., site-directed mutagenesis techniques and/or PCR- mediated mutagenesis techniques. Mutations can also be introduced randomly along all or part of the coding sequence using, e.g., saturation mutagenesis techniques. In specific embodiments, the mutations are conservative amino acid substitutions.
  • a B7-H7 derivative comprises (or consists) of the amino acid sequence ofnative B7-H7 with 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20 or more, or in the range of 1 to 5, 1 to 10, 2 to 15, 5 to 20, 5 to 30, 10 to 50, or 25 to 75 amino acid substitutions.
  • amino acid substitutions can be either conservative, non- conservative, or a combination of both.
  • the amino acid substitutions are conservative amino acid substitutions, and in certain embodiments, introduced at one or more predicted non-essential amino acid residues.
  • a conservative amino acid substitution is one in which the amino acid residue is replaced with an amino acid residue having a side chain with a similar charge.
  • Families of amino acid residues having side chains with similar charges have been defined in the art. These families include amino acids with basic side chains ⁇ e.g., lysine, arginine, histidine), acidic side chains ⁇ e.g., aspartic acid, glutamic acid), uncharged polar side chains ⁇ e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains ⁇ e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains ⁇ e.g. , tyrosine, phenylalanine, tryptophan, histidine).
  • amino acids with basic side chains ⁇ e.g., lysine, arginine, hist
  • a B7-H7 derivative comprises (or consists of) one or more mutations in the Ig-like V-type 2 domain.
  • a B7-H7 derivative comprises (or consists) of the amino acid sequence of native B7-H7 with 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20 or more, or in the range of 1 to 5, 1 to 10, 2 to 15, 5 to 20, 5 to 30, 10 to 50, or 25 to 75 amino acid substitutions in the Ig-like V-type 2 domain.
  • a B7-H7 derivative comprises (or consists of) one or more mutations in the Ig-like C-type 1 domain.
  • a B7-H7 derivative comprises (or consists) of the amino acid sequence of native B7-H7 with 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20 or more, or in the range of 1 to 5, 1 to 10, 2 to 15, 5 to 20, 5 to 30, 10 to 50, or 25 to 75 amino acid substitutions in the Ig-like C-type 1 domain.
  • a B7-H7 derivative comprises a fragment of native B7- H7.
  • a B7-H7 derivative comprises (or consists of) amino acid residues 23 to 280, 23 to 275, 23 to 250, 23 to 225, 23 to 200, 23 to 175, 23 to 150, 23 to 125, 23 to 100, 23 to 95, 23 to 75, 23 to 70, 23 to 65, 23 to 60, 23 to 50, 15 to 30 or 5 to 25 of native B7-H7 of the sequence found at Accession No. O9UM44-1 (UniParc).
  • a B7-H7 derivative is a soluble form of B7-H7.
  • a B7-H7 derivative comprises (or consists of) the extracellular domain of native B7-H7, or the extracellular domain of native B7-H7 containing 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 15, 20 or more amino acid substitutions, deletions, and/or additions.
  • a B7-H7 derivative comprises (or consists of) amino acid residues 23 to 344 of the sequence found at Accession No. O9UM44-1 (UniParc).
  • a B7- H7 derivative comprises (or consists of) a fragment of the extracellular domain of native B7- H7, or a fragment of the extracellular domain of native B7-H7 containing 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 15, 20 or more mutations (e.g., amino acid substitutions, deletions, and/or additions).
  • a B7-H7 derivative comprises (or consists of) at least 25, 50, 75, 100, 125, 150, 175, 200, 225, 250, 275, 300 or 325 amino acids of the
  • a B7-H7 derivative comprises (or consists of) amino acid residues 23 to 340, 23 to 325, 23 to 300, 23 to 275, 23 to 250, 23 to 225, 23 to 200, 23 to 175, 23 to 150, 23 to 125, 23 to 100, 23 to 75, or 23 to 50 of native B7-H7.
  • a B7-H7 derivative comprises (or consists of) amino acid residues 23 to 375, 23 to 350, 23 to 23 to 340, 23 to 325, 23 to 300, 23 to 275, 23 to 250, 23 to 225, 23 to 200, 23 to 175, 23 to 150, 23 to 125, 23 to 100, 23 to 75, 23 to 50, 15 to 30 or 5 to 25 of the sequence found at Accession No. O9UM44-1 (UniParc).
  • a B7-H7 derivative comprises (or consists of) the Ig-like V-type 1 domain of native B7-H7.
  • a B7-H7 derivative comprises (or consists of) amino acid residues 61 to 131 or 61 to 122 of the sequence found at
  • a B7-H7 derivative comprises (or consists of) the Ig-like C-I type domain of native B7-H7.
  • a B7-H7 derivative comprises (or consists of) amino acid residues 138 to 222 or 140 to 225 of the sequence found at Accession No. O9UM44-1 (UniParc).
  • a B7- H7 derivative comprises (or consists of) the Ig-like V-type 2 domain of native B7-H7.
  • a B7-H7 derivative comprises (or consists of) amino acid residues 235 to 328 or 239 to 317 of the sequence found at Accession No. O9UM44-1 (UniParc).
  • a B7-H7 derivative comprises (or consists of) amino acid residues 140 to 222 of native B7-H7.
  • a B7-H7 derivative comprises (or consists of) the Ig-like V-type 1 and Ig-like C-I type domains of native B7-H7.
  • a B7-H7 derivative comprises (or consists of) amino acid residues 61 to 222 or 61 to 225 of the sequence found at Accession No. O9UM44-1 (UniParc).
  • a B7-H7 derivative comprises (or consists of) the Ig-like C-I type and Ig-like V-type 2 domains of the extracelluar domain of native B7-H7.
  • a B7-H7 derivative comprises (or consists of) amino acid residues 138 to 328 or 140 to 317 of the sequence found at Accession No. O9UM44-1 (UniParc).
  • a B7-H7 derivative comprises (or consists of the Ig-like V-type 1 and Ig-like V-type 2 of the extracellular domain of native B7-H7.
  • a B7-H7 derivative comprises (or consists of) the Ig-like V-type 1, Ig-like C-I type, and Ig-like V-type 2 domains of the extracellular domain of native B7-H7.
  • a B7-H7 derivative comprises (or consists of) amino acid residues 61 to 317 or 61 to 328 of the sequence found at Accession No. O9UM44- 1 (UniParc).
  • a B7-H7 derivative comprises an amino acid substitution at one, two, or more of the following positions: 159, 210, 243, or 317 of native B7-H7 (e.g., native human B7-H7).
  • a B7-H7 derivative comprises (or consists of) the extracellular and cytoplasmic domains of native B7-H7 or fragments thereof.
  • a B7-H7 derivative comprises (or consists of) the extracellular and cytoplasmic domains of native B7-H7 or fragments thereof containing 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 15, 20 or more or 5 to 15, 5 to 20, 2 to 10, or 2 to 5 amino acid substitutions, deletions, and/or additions.
  • a B7-H7 derivative comprises (or consists) a fragment of the extracellular domain of native B7-H7 and the cytoplasmic domain of native B7-H7 or a fragment thereof.
  • a B7-H7 derivative comprises (or consists of) the extracellular domain of native B7-H7 and a fragment of the cytoplasmic domain of native B7-H7. In another embodiment, a B7-H7 derivative lacks the transmembrane domain of native B7-H7 or a fragment thereof. In certain embodiments, a B7-H7 derivative comprises a heterologous transmembrane domain in place of the transmembrane domain of native B7-H7. In another embodiment, a B7-H7 derivative comprises (or consists of) the extracellular domain of native B7-H7 or a fragment thereof and the transmembrane domain of native B7- H7 or a fragment thereof.
  • B7-H7 derivatives can be assessed using techniques known to those skilled in the art, or described herein.
  • the ability of a B7-H7 derivative to bind to one or more receptors may be assessed using techniques described herein, or known to those skilled in the art. More specifically, the ability of a B7-H7 derivative to bind to B7-H7CR may be assessed.
  • the ability of a B7-H7 derivative to bind to one or more receptors and induce one or more of the signal transduction pathways induced by native B7-H7 binding to the one or more receptors may be assessed using techniques described herein, or known to those skilled in the art. More specifically, the ability of a B7-H7 derivative to bind to B7-H7CR and induce one or more of the signal transduction pathways induced by native B7-H7 binding to native B7-H7CR may be assessed.
  • a B7-H7 derivative retains at least 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 25% to 98%, 50% to 75%, or 75% to 100% of the function of a native B7-H7 polypeptide to bind to a native receptor of B7-H7 (e.g. , B7- H7CR), as measured by assays/techniques well known in the art, e.g., ELISA, Biacore, or co- immunoprecipitation.
  • a B7-H7 derivative retains at least 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 25% to 98%, 50% to 75%, or 75% to 100% of the function of a native B7-H7 polypeptide to bind to B7-H7CR.
  • a B7-H7 derivative binds to a native receptor of B7-H7 (e.g., B7-H7CR) with a higher affinity than the native B7-H7 binds to the same receptor, as measured by assays/techniques well known in the art, e.g., ELISA, cell-based assays including flow cytometry, KinEx A assay, plasmon surface resonance assay (e.g., Biacore ® assay), or co-immunoprecipitation.
  • B7-H7 e.g., B7-H7CR
  • assays/techniques well known in the art, e.g., ELISA, cell-based assays including flow cytometry, KinEx A assay, plasmon surface resonance assay (e.g., Biacore ® assay), or co-immunoprecipitation.
  • a B7-H7 derivative binds to a native receptor of B7-H7 (e.g., B7-H7CR) with a 50%, 75%, 80%, 85%, 90%, 95%, or 98%, or 25% to 50%, 25% to 75%, 50% to 95%, or 75% to 95% higher affinity than the native B7-H7 binds to the same receptor as measured by well-known assays/techniques.
  • B7-H7CR B7-H7CR
  • a B7-H7 derivative binds to a native receptor of B7-H7 (e.g., B7-H7CR) with 0.5 log, 1 log, 1.5 log, 2 log, 2.5 log, or 3 log higher affinity than the native B7-H7 binds to the same receptor, as measured by assays/techniques well known in the art, e.g., ELISA, Biacore, or co-immunoprecipitation.
  • B7-H7 e.g., B7-H7CR
  • a B7-H7 derivative binds to a native receptor of B7-H7 (e.g., B7-H7CR) with a lower affinity than the native B7-H7 binds to the same receptor, as measured by assays/techniques well known in the art.
  • a B7-H7 derivative binds to a native receptor of B7-H7 (e.g., B7-H7CR) with a 50%, 75%, 80%, 85%, 90%, 95%, or 98%, or 25% to 50%, 25% to 75%, 50% to 95%, or 75% to 95% lower affinity than the native B7-H7 binds to the same receptor as measured by assays/techniques known in the art.
  • B7-H7CR B7-H7CR
  • a B7-H7 derivative binds to a native receptor of B7-H7 (e.g., B7-H7CR) with a 0.5 log, 1 log, 1.5 log, 2 log, 2.5 log, or 3 log lower affinity than the native B7-H7 binds to the same receptor, as measured by assays/techniques well known in the art.
  • B7-H7CR B7-H7CR
  • a B7-H7 derivative retains less than 20%, 15%, 10%, 5% or 2%, or in the range of between 2% to 20%, 2% to 15%, 2% to 10%, or 2% to 5% of the function of a native B7-H7 polypeptide to bind to a native receptor of B7-H7 (e.g., B7- H7CR), as measured by assays/techniques well known in the art, e.g., ELISA, cell-based assays including flow cytometry, KinEx A assay, plasmon surface resonance assay (e.g., Biacore ® assay), or co-immunoprecipitation.
  • B7-H7 native receptor of B7-H7
  • a B7-H7 derivative retains less than 20%, 15%, 10%, 5% or 2%, or in the range of between 2% to 20%, 2% to 15%, 2% to 10%, or 2% to 5% of the function of a native B7-H7 polypeptide to bind to B7- H7CR.
  • a B7-H7 derivative retains at least 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 25% to 98%, 50% to 75%, or 75% to 100% of the ability to activate or induce one or more of the signal transduction pathways induced when a native B7-H7 polypeptide binds to a native receptor of B7-H7 (e.g., B7-H7CR), as measured by assays well-known in the art.
  • B7-H7CR native receptor of B7-H7
  • the one or more signal transduction pathways induced by the binding of a native receptor of B7-H7 (e.g., B7-H7CR) to a B7-H7 polypeptide can be measured by, e.g., assessing the activation of a signal transduction moiety (e.g., Jun kinase activation, MAP kinase activation, PKC activation), the translocation of a transcription factor (e.g., NF-kappa B or Statl), and cytokine production (e.g., IL-2, IL-4, IL-5, IL-10, IL-17, interferon-gamma, or tumor necrosis factor-alpha) using techniques such as ELISAs, Western blots, electromobility shift assays, and other immunoassays.
  • a signal transduction moiety e.g., Jun kinase activation, MAP kinase activation, PKC activation
  • a transcription factor e
  • a B7- H7 derivative retains at least 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 25% to 98%, 50% to 75%, or 75% to 100% of the ability to activate or induce one or more of the signal transduction pathways induced by the binding of a native B7-H7 polypeptide to B7-H7CR.
  • a B7-H7 derivative binds to its native receptor (e.g., native B7-H7CR) and induces a higher level of activity than native B7-H7 binding to the native receptor as assessed by, e.g., the induction of one or more signal transduction molecules.
  • a B7-H7 derivative binds to native B7-H7CR and induces a higher level of activity than native B7-H7 binding to native B7-H7CR as assessed by, e.g., the activation or induction of one or more signal transduction molecules.
  • a B7-H7 derivative binds to native B7-H7CR and induces at least 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 25% to 98%, 50% to 75%, 50% to 98%, or 75% to 100% higher level of activity than native B7-H7 binding to native B7-H7CR as assessed by, e.g., the activation or induction of one or more signal transduction molecules.
  • a B7-H7 derivative retains less than 20%, 15%, 10%, 5% or 2%, or in the range of between 2% to 20%, 2% to 15%, 2% to 10%, or 2% to 5% of the ability to activate or induce one or more of the signal transduction pathways induced when a native B7-H7 polypeptide binds to a receptor of B7-H7 (e.g., B7-H7CR), as measured by assays well-known in the art.
  • B7-H7CR B7-H7
  • a B7-H7 derivative retains less than 20%, 15%, 10%, 5% or 2%, or in the range of between 2% to 20%, 2% to 15%, 2% to 10%, or 2% to 5% of the ability to activate or induce one or more of the signal transduction pathways induced by the binding of a native B7-H7 polypeptide to B7-H7CR.
  • a Therapeutic Agent is a B7-H7CR polypeptide.
  • a Therapeutic Agent is a B7-H7CR polypeptide that modulates one or more of the signal transduction pathways mediated by B7-H7.
  • the B7-H7CR protein binds to and agonizes signal transduction through the B7-H7.
  • the B7-H7CR protein binds to B7-H7 and blocks binding to B7-H7CR.
  • a Therapeutic Agent is a B7-H7CR polypeptide that modulates one or more of the signal transduction pathways induced by B7-H7 binding to B7-H7CR.
  • a Therapeutic Agent is a B7-H7CR polypeptide that modulates the B7-H7 polypeptide and B7-H7CR polypeptide interaction.
  • a Therapeutic Agent is a B7-H7CR derivative.
  • a Therapeutic Agent is a B7-H7CR derivative that modulates one or more of the signal transduction pathways mediated by B7-H7.
  • a Therapeutic Agent is a B7-H7CR derivative that modulates one or more of the signal transduction pathways induced by B7-H7 binding to B7-H7CR. In another embodiment, such a
  • Therapeutic Agent modulates the B7-H7 polypeptide and B7-H7CR polypeptide interaction.
  • the B7-H7 derivative is an Immunostimulating Therapeutic Agent.
  • the B7-H7 derivative is an Inhibitory Therapeutic Agent.
  • a B7-H7CR derivative is: (a) a polypeptide that is at least 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 99% or is 40% to 65%, 50% to 90%, 65% to 90%, 70% to 90%, 75% to 95%, 80% to 95%, or 85% to 99% identical to a native B7-H7CR polypeptide; (b) a polypeptide encoded by a nucleic acid sequence that is at least 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 99% or is 40% to 65%, 50% to 90%, 65% to 90%, 70% to 90%, 75% to 95%, 80% to 95%, or 85% to 99% identical a nucleic acid sequence encoding a native B7-H7CR polypeptide; (c) a polypeptide that contains 1,
  • B7-H7CR derivatives also include a polypeptide that comprises the amino acid sequence of a naturally occurring mature form of a mammalian B7-H7CR polypeptide and a heterologous signal peptide amino acid sequence.
  • a B7-H7CR derivative is a derivative of a native human B7-H7CR polypeptide.
  • a B7-H7CR derivative is a derivative of an immature or precursor form of naturally occurring human B7- H7CR polypeptide.
  • a B7-H7CR derivative is a derivative of a mature form of naturally occurring human B7-H7CR polypeptide.
  • a B7- H7CR derivative is isolated or purified.
  • a B7-H7CR derivative comprises (or consists) of the amino acid sequence ofnative B7-H7CR with 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20 or more, or in the range of 1 to 5, 1 to 10, 2 to 15, 5 to 20, 5 to 30, 10 to 50, 25 to 75 mutations (e.g., amino acid substitutions, insertions and/or deletions).
  • a B7-H7CR derivative comprises one or more mutations that increase the affinity of B7-H7CR for one or more of its ligands, e.g., B7-H7 (in particular, native B7-H7).
  • a B7-H7CR derivative comprises one or more mutations that decrease the affinity of B7-H7CR for one or more of its ligands, e.g., B7-H7 (in particular, native B7- H7).
  • a B7-H7CR derivative comprises one or more mutations in the Ig-like V-type domain of native B7-H7CR and such mutations increase the affinity of B7- H7CR for B7-H7.
  • Mutations can be introduced at specific positions with native B7-H7CR using, e.g. , site-directed mutagenesis techniques and/or PCR-mediated mutagenesis techniques. Mutations can also be introduced randomly along all or part of the coding sequence using, e.g. , saturation mutagenesis techniques.
  • a B7-H7CR derivative comprises (or consists) of the amino acid sequence ofnative B7-H7CR with 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20 or more, or in the range of 1 to 5, 1 to 10, 2 to 15, 5 to 20, 5 to 30, 10 to 50, or 25 to 75 amino acid substitutions.
  • amino acid substitutions can be either
  • amino acid substitutions are conservative amino acid substitutions, and in certain embodiments
  • inventions introduced at one or more predicted non-essential amino acid residues.
  • a B7-H7CR derivative comprises a fragment of native B7-H7CR.
  • a B7-H7CR derivative comprises (or consists of) amino acid residues 23 to 280, 23 to 275, 23 to 250, 23 to 225, 23 to 200, 23 to 175, 23 to 150, 23 to 125, 23 to 100, 23 to 95, 23 to 75, 23 to 70, 23 to 65, 23 to 60, 23 to 50, 15 to 30 or 5 to 25 of native B7-H7CR of the sequence found at Accession No. Q96BF3-1 (UniParc).
  • a B7-H7CR derivative has one or more mutations in amino acid residues 227- 277.
  • a B7-H7CR derivative has one or more mutations at the N- linked glycosylation sites (amino acid residues 73, 105, and 127). In certain embodiments, a B7-H7CR derivative has a mutation (e.g., a substitution) at the serine residue 220.
  • a B7-H7CR derivative is a soluble form of B7-H7CR.
  • a B7-H7CR derivative comprises (or consists of) the extracellular domain of native B7-H7CR, or the extracellular domain of native B7-H7CR containing 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 15, 20 or more or 2 to 5, 5 to 10, 5 to 15, or 10 to 20 amino acid substitutions, deletions, and/or additions.
  • a B7-H7CR derivative comprises (or consists of) amino acid residues 23 to 150 of the sequence found at Accession No. Q9BF3-1 (UniParc).
  • a B7-H7CR derivative comprises (or consists of) a fragment of the extracellular domain of native B7-H7CR, or a fragment of the extracellular domain of native B7-H7CR containing 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 15, 20 or more mutations (e.g., amino acid substitutions, deletions, and/or additions).
  • a B7-H7CR derivative comprises (or consists of) at least 25, 50, 75, 100, or 125 amino acids of the extracellular domain of native B7-H7CR.
  • a B7-H7CR derivative comprises (or consists of) amino acid residues 23 to 145, 23 to 140, 23 to 130, 23 to 125, 23 to 100, 23 to 95, 23 to 75, 23 to 70, 23 to 65, 23 to 60, or 23 to 50 of native B7-H7CR.
  • a B7-H7CR derivative comprises (or consists of) 23 to 145, 23 to 140, 23 to 130, 23 to 125, 23 to 100, 23 to 95, 23 to 75, 23 to 70, 23 to 65, 23 to 60, or 23 to 50 amino acid residues of the sequence found at Accession No. Q96BF3-1 (UniParc).
  • a B7-H7CR derivative comprises (or consists of) the Ig- like domain of native B7-H7CR.
  • a B7-H7CR derivative comprises (or consists of) amino acid residues 23 to 129 of the sequence found at Accession No.
  • a B7-H7CR derivative comprises (or consists of) amino acid residues 23 to 129, 23 to 150, or 129 to 150 of the sequence Q96BF3-1.
  • a B7-H7CR derivative comprises an amino acid substitution at one, two, or more of the following positions: 44, 67, 81, 112, 192, 197, or 222 of native B7-H7CR (e.g., native human B7-H7CR).
  • a B7-H7CR derivative comprises (or consists of) the extracellular and cytoplasmic domains of native B7-H7CR or fragments thereof.
  • a B7-H7CR derivative comprises (or consists of) the extracellular and cytoplasmic domains of native B7-H7CR or fragments thereof containing 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 15, 20 or more, or 2to 5, 5 to 10, 5 to 15, 5 to 20, or 10 to 20 amino acid substitutions, deletions, and/or additions.
  • a B7-H7CR derivative comprises (or consists) a fragment of the extracellular domain of native B7-H7CR and the cytoplasmic domain of native B7-H7CR or a fragment thereof.
  • a B7-H7CR derivative comprises (or consists of) the extracellular domain of native B7-H7CR and a fragment of the cytoplasmic domain of native B7-H7CR.
  • a B7-H7CR derivative lacks the transmembrane domain of native B7-H7CR or a fragment thereof.
  • a B7-H7CR derivative comprises a heterologous transmembrane domain in place of the transmembrane domain of native B7-H7CR.
  • a B7-H7CR derivative comprises (or consists of) the extracellular domain of native B7-H7CR or a fragment thereof and the transmembrane domain of native B7-H7CR or a fragment thereof.
  • B7-H7CR derivatives can be assessed using techniques known to those skilled in the art, or described herein. For example, the ability of a B7-H7CR derivative to bind to one or more ligands may be assessed using techniques described herein, or known to those skilled in the art. More specifically, the ability of a B7-H7CR derivative to bind to B7-H7 may be assessed. In addition, the ability of a B7-H7CR derivative to bind to one or more ligands and induce one or more of the signal transduction pathways induced by native B7-H7CR binding to the one or more ligands may be assessed using techniques described herein, or known to those skilled in the art. More specifically, the ability of a B7- H7CR derivative to bind to B7-H7 and induce one or more of the signal transduction pathways induced by native B7-H7 binding to native B7-H7CR may be assessed.
  • a B7-H7CR derivative retains at least 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 25% to 98%, 50% to 75%, or 75% to 100% of the function of a native B7-H7CR polypeptide to bind to a native ligand of B7-H7CR (e.g. , B7-H7), as measured by assays/techniques well known in the art, e.g., ELISA, Biacore, or co- immunoprecipitation.
  • a native B7-H7CR polypeptide to bind to a native ligand of B7-H7CR (e.g. , B7-H7), as measured by assays/techniques well known in the art, e.g., ELISA, Biacore, or co- immunoprecipitation
  • a B7-H7CR derivative retains at least 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 25% to 98%, 50% to 75%, or 75% to 100% of the function of a native B7-H7CR polypeptide to bind to B7-H7.
  • a B7-H7CR derivative binds to a native ligand of B7- H7CR (e.g., B7-H7) with a higher affinity than native B7-H7CR binds to the same ligand, as measured by assays/techniques well known in the art, e.g., ELISA, Biacore, or co- immunoprecipitation.
  • B7-H7CR native ligand of B7- H7CR
  • a B7-H7CR derivative binds to a native ligand of B7-H7CR (e.g., B7-H7) with a 25%, 50%, 75%, 80%, 85%, 90%, 95%, or 25% to 50%, 25% to 75%, 50% to 95%, or 75% to 95% higher affinity than the native B7-H7CR binds to the same ligand, as measured by known assays/techniques.
  • B7-H7CR native ligand of B7-H7CR
  • a B7- H7CR derivative binds to a native ligand of B7-H7CR (e.g., B7-H7) with 0.5 logs, 1 log, 1.5 logs, 2 logs, 2.5 logs, or 3 logs higher affinity than the native B7-H7CR binds to the same ligand, as measured by assays/techniques well known in the art, e.g., ELISA, Biacore, or co- immunoprecipitation.
  • B7-H7CR native ligand of B7-H7CR
  • a B7-H7CR derivative binds to a native ligand of B7- H7CR with a lower affinity than the native B7-H7CR binds to the same ligand, as measured by well-known assays/techniques.
  • a B7-H7CR derivative binds to a native ligand of B7-H7CR with 25%, 50%, 75%, 80%, 85%, 90%, 95%, 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, or 75% to 95% lower affinity than the native B7-H7CR binds to the same ligand, as measured by well-known assays/techniques.
  • a B7-H7CR derivative binds to a native ligand of B7-H7CR with 0.5 logs, 1 log, 1.5 logs, 2 logs, 2.5 logs, or 3 logs lower affinity than the native B7-H7CR binds to the same ligand, as measured by well-known assays/techniques.
  • a B7-H7CR derivative retains less than 20%, 15%, 10%, 5% or 2%, or in the range of between 2% to 20%, 2% to 15%, 2% to 10%, or 2% to 5% of the function of a native B7-H7CR polypeptide to bind to a native ligand of B7-H7CR (e.g. , B7-H7), as measured by assays/techniques well known in the art, e.g., ELISA, Biacore, or co- immunoprecipitation.
  • a B7-H7CR derivative retains less than 20%, 15%, 10%, 5% or 2%, or in the range of between 2% to 20%, 2% to 15%, 2% to 10%, or 2% to 5% of the function of a native B7-H7CR polypeptide to bind to B7-H7.
  • a B7-H7CR derivative retains at least 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 25% to 98%, 50% to 75%, or 75% to 100% of the ability to activate or induce one or more of the signal transduction pathways induced when a native ligand of B7-H7CR (e.g., B7-H7) binds to a native B7-H7CR polypeptide (e.g., a native mammalian B7-H7CR polypeptide), as measured by assays well-known in the art.
  • a native ligand of B7-H7CR e.g., B7-H7
  • a native B7-H7CR polypeptide e.g., a native mammalian B7-H7CR polypeptide
  • the one or more signal transduction pathways induced by the binding of a native ligand of B7-H7CR to a B7-H7CR polypeptide can be measured by, e.g., assessing the activation of a signal transduction moiety (e.g., Jun kinase activation, MAP kinase activation, PKC activation), the translocation of a transcription factor (e.g., NF -kappa B or Statl), and cytokine production (e.g., IL-2, IL-4, IL-5, IL-10, IL- 17, interferon-gamma, or tumor necrosis factor-alpha) using techniques such as ELISAs, Western blots, electromobility shift assays, and other immunoassays.
  • a signal transduction moiety e.g., Jun kinase activation, MAP kinase activation, PKC activation
  • a transcription factor e.g., NF -
  • a B7-H7CR derivative retains at least 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 25% to 98%, 50% to 75%, or 75% to 100% of the ability to activate or induce one or more of the signal transduction pathways induced by the binding of B7-H7 to a native B7-H7CR polypeptide.
  • a B7-H7CR derivative binds to its native ligand (e.g., native B7-H7) and induces a higher level of activity than native B7-H7CR binding to the native ligand as assessed by, e.g., the induction of one or more signal transduction molecules.
  • a B7-H7CR derivative binds to native B7-H7 and induces a higher level of activity than native B7-H7CR binding to native B7-H7 as assessed by, e.g., the induction of one or more signal transduction molecules.
  • a B7-H7CR derivative binds to B7-H7 and induces at least 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 25% to 98%, 50% to 75%, 50% to 98%, or 75% to 90% higher level of activity than native B7-H7CR binding to native B7-H7 as assessed by, e.g., the induction of one or more signal transduction molecules.
  • a B7-H7CR derivative retains less than 20%, 15%, 10%, 5% or 2%, or in the range of between 2% to 20%, 2% to 15%, 2% to 10%, or 2% to 5% of the ability to activate or induce one or more of the signal transduction pathways induced when a native ligand (e.g., B7-H7) binds to a native B7-H7CR polyeptide (e.g., a native mammalian B7-H7CR polyeptide), as measured by assays well-known in the art.
  • a native ligand e.g., B7-H7
  • a native B7-H7CR polyeptide e.g., a native mammalian B7-H7CR polyeptide
  • a B7-H7CR derivative retains less than 20%, 15%, 10%, 5% or 2%, or in the range of between 2% to 20%, 2% to 15%, 2% to 10%, or 2% to 5% of the ability to activate or induce one or more of the signal transduction pathways induced by the binding of B7-H7 to a native B7-H7CR polypeptide.
  • a Therapeutic Agent is a protein comprising B7-H7 polypeptide and a heterologous molecule (e.g., a heterologous amino acid sequence).
  • a Therapeutic Agent modulates one or more of the signal transduction pathways mediated B7-H7CR.
  • the Therapeutic Agent binds to and agonizes signal transduction through the B7-H7CR receptor.
  • the Therapeutic Agent binds to B7-H7CR and antagonizes signal transduction by blocking binding of a native ligand (e.g. B7-H7).
  • such a Therapeutic Agent modulates one or more of the signal transduction pathways induced by the binding of B7-H7 to B7-H7CR. In another specific embodiment, such a Therapeutic Agent modulates the B7-H7 polypeptide and B7- H7CR polypeptide interaction.
  • a Therapeutic Agent comprises native B7-H7 and a heterologous molecule.
  • a Therapeutic Agent comprises a B7-H7 derivative and a heterologous amino acid sequence. See Section 5.2.2.1, supra, for B7-H7 derivatives.
  • such Therapeutic Agents are Immunostimulating Therapeutic Agents. In other embodiments, such Therapeutic Agents are Inhibitory
  • a Therapeutic Agent is a fusion protein comprising B7- H7 polypeptide and a heterologous amino acid sequence.
  • a Therapeutic Agent is a fusion protein comprising a B7-H7 polypeptide and a constant region of an immunoglobulin or a fragment thereof (e.g., CHl, CH2, and/or CH3). Fc regions from, e.g., native IgGl, IgG2, or IgG4 can be used to produce such a fusion protein.
  • hybrid IgGl/IgG4 Fc domains can be used to produce such a fusion protein as can modified IgGl Fc domains (e.g., IgGl modified to improve binding to certain Fc gamma receptors; IgGl modified to minimize effector function; IgGl with altered/no glycan; and IgGl with altered pH-dependent binding to FcRn) and modified IgG4 Fc domains (e.g., IgG4 modified to prevent binding to Fc gamma receptors and/or complement).
  • modified IgGl Fc domains e.g., IgGl modified to improve binding to certain Fc gamma receptors; IgGl modified to minimize effector function; IgGl with altered/no glycan; and IgGl with altered pH-dependent binding to FcRn
  • modified IgG4 Fc domains e.g., IgG4 modified to prevent binding to Fc gamma receptors and/
  • a Therapeutic Agent is the B7-H7-Ig fusion protein described in Example 6, infra.
  • such Therapeutic Agents are Immunostimulating Therapeutic Agents.
  • such Therapeutic Agents are Inhibitory Therapeutic Agents.
  • a Therapeutic Agent is a fusion protein or a conjugate comprising a B7-H7 polypeptide and an organic molecule of interest.
  • the B7-H7 polypeptide can be used as a targeting moiety to target the organic molecule to which it is fused or conjugated to particular organs or tissues (e.g., lymphoid organs or tissues).
  • organs or tissues e.g., lymphoid organs or tissues.
  • the B7-H7 polypeptide comprises the extracellular domain of native B7-H7 or a fragment thereof that retains the ability to bind to one or more receptors of B7-H7 (e.g., B7-H7CR).
  • the B7-H7 polypeptide is a derivative of native B7-H7.
  • the organic molecule fused or conjugated to the B7-H7 polypeptide may be a molecule that one skilled in the art is interested in targeting to a particular organ(s) or tissue(s) (e.g., lymphoid organs or tissues) (e.g., a cytokine, drug, marker, etc.).
  • a Therapeutic Agent is a protein comprising B7-H7CR polypeptide and a heterologous molecule.
  • such a Therapeutic Agent modulates one or more signal transduction pathways mediated by B7-H7.
  • the Therapeutic Agent binds to and agonizes signal transduction through the B7- H7.
  • the Therapeutic Agent binds to native B7-H7 and blocks binding to B7-H7CR.
  • such a Therapeutic Agent modulates the B7-H7 and B7-H7CR interaction.
  • a Therapeutic Agent comprises native B7-H7CR and a heterologous molecule.
  • a Therapeutic Agent comprises a B7- H7CR derivative and a heterologous amino acid sequence. See Section 5.2.2.2, supra, for B7-H7CR derivatives.
  • such Therapeutic Agents are
  • Such Therapeutic Agents are Inhibitory Therapeutic Agents.
  • a Therapeutic Agent is a fusion protein comprising B7- H7CR and a heterologous molecule.
  • a Therapeutic Agent is a fusion protein comprising a B7-H7 polypeptide and a constant region of an immunoglobulin or a fragment thereof (e.g., CHl, CH2, and/or CH3). Fc regions from, e.g., native IgGl, IgG2, or IgG4 can be used to produce such a fusion protein.
  • hybrid IgGl/IgG4 Fc domains can be used to produce such a fusion protein as can modified IgGl Fc domains (e.g., IgGl modified to improve binding to certain Fc gamma receptors; IgGl modified to minimize effector function; IgGl with altered/no glycan; and IgGl with altered pH- dependent binding to FcRn) and modified IgG4 Fc domains (e.g., IgG4 modified to prevent binding to Fc gamma receptors and/or complement).
  • modified IgGl Fc domains e.g., IgGl modified to improve binding to certain Fc gamma receptors; IgGl modified to minimize effector function; IgGl with altered/no glycan; and IgGl with altered pH- dependent binding to FcRn
  • modified IgG4 Fc domains e.g., IgG4 modified to prevent binding to Fc gamma receptors and/
  • a Therapeutic Agent is the B7-H7CR-Ig fusion protein described in Example 6, infra.
  • such Therapeutic Agents are Immunostimulating Therapeutic Agents.
  • such Therapeutic Agents are Inhibitory Therapeutic Agents.
  • a Therapeutic Agent is a fusion protein or a conjugate comprising B7-H7CR polypeptide and an organic molecule.
  • the B7-H7CR polypeptide can be used as a targeting moiety to target the organic molecule to which it is fused or conjugated to particular organs or tissues (e.g., lymphoid organs or tissues).
  • organs or tissues e.g., lymphoid organs or tissues.
  • the examples below provide information regarding organs and tissues expressing.
  • the B7-H7CR polypeptide comprises the extracellular domain of native B7-HCR or a fragment thereof that retains the ability to bind to one or more ligands of B7-H7CR (e.g., B7-H7).
  • the B7-H7CR polypeptide is a derivative of native B7-H7CR.
  • the organic molecule fused or conjugated to the B7-H7CR polypeptide may be any molecule that one skilled in the art is interested in targeting to particular organs or tissues (e.g., testis, colon, lung, kidney, pancreas, small intestine, liver, or skeletal muscle) (e.g., a cytokine, drug, marker, etc.).
  • the B7-H7 polypeptide or B7-H7CR polypeptide may be covalently or non- covalently linked to a heterologous molecule.
  • B7-H7 polypeptide or B7-H7CR polypeptide is covalently or non-covalently linked directly to a heterologous molecule (e.g., by combining amino acid sequences via peptide bonds).
  • B7-H7 polypeptide or B7-H7CR polypeptide is linked to a heterologous molecule using one or more linkers.
  • Linkers suitable for conjugating B7-H7 polypeptide or B7-H7CR polypeptide to a heterologous molecule comprise peptides, alkyl groups, chemically substituted alkyl groups, polymers, or any other covalently -bonded or non- covalently bonded chemical substance capable of binding together two or more components.
  • Polymer linkers comprise any polymers known in the art, including polyethylene glycol (“PEG").
  • the linker is a peptide that is 1, 2, 3, 4, 5,6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20 or more amino acids long.
  • the linker is long enough to preserve the ability of B7-H7 polypeptide to bind to B7-H7CR polypeptide. In other embodiments, the linker is long enough to preserve the ability of the B7-H7 polypeptide to bind to B7-H7CR polypeptide and to induce one or more signal transduction pathways induced by the interaction between native B7-H7 polypeptide and native B7-H7CR polypeptide. In specific embodiments, the linker preserves the formation of disulphide bonds.
  • the heterologous molecule is the Fc domain of an IgG immunoglobulin or a fragment thereof.
  • the heterologous molecule is polyethylene glycol (PEG).
  • the heterologous molecule is a therapeutic moiety possessing a desired biological activity.
  • the heterologous molecule is interferon- ⁇ , interferon- ⁇ , interferon- ⁇ , interleukin-2 (“IL-2”), interleukin-7 (“IL-7”), interleukin 9 (“IL-9”), interleukin-10 (“IL-10”), interleukin-12 (“IL- 12”), interleukin- 15 (“IL-15”), interleukin-23 (“IL-23”), granulocyte macrophage colony stimulating factor (“GM-CSF”), granulocyte colony stimulating factor (“G-CSF” )), or a growth factor.
  • IL-2 interleukin-2
  • IL-7 interleukin-7
  • IL-9 interleukin 9
  • IL-10 interleukin-10
  • IL-12 interleukin-12
  • IL-15 interleukin-15
  • IL-23 interleukin-23
  • GM-CSF granulocyte macrophage colony stimulating factor
  • G-CSF granulocyte colony stimulating factor
  • the heterologous molecule increases protein stability.
  • Non-limiting examples of such molecules include polyethylene glycol (PEG), Fc domain of an IgG immunoglobulin, a fragment thereof or modified form thereof, or albumin that increase the half-life of B7-H7 or B7-H7CR in vivo. See, e.g., Section 5.1.1 for a discussion regarding modified Fc domains.
  • the heterologous molecules is not an Fc domain of an immunoglobulin molecule or a fragment thereof.
  • the heterologous molecules reduce binding to Fc receptors, e.g., the heterologous molecule is an Fc domain of an immunoglobulin or a fragment therof with reduced affinity for an Fc receptor (e.g., FcRn).
  • FcRn Fc receptor
  • the heterologous molecule is a detectable moiety.
  • detectable moieties include various enzymes, such as, but not limited to, horseradish peroxidase, alkaline phosphatase, beta-galactosidase, or acetylcholinesterase; prosthetic groups, such as, but not limited to, streptavidin/biotin and avidin/biotin; fluorescent materials, such as, but not limited to, umbelliferone, fluorescein, fluorescein isothiocynate, rhodamine, dichlorotriazinylamine fluorescein, dansyl chloride or phycoerythrin; luminescent materials, such as, but not limited to, luminol; bioluminescent materials, such as but not limited to, luciferase, luciferin, and aequorin; radioactive materials, such as, but not limited to, iodine ( 131), aluminescent materials, such as but not
  • the heterologous molecule is a marker amino acid sequence or a penetrating peptide.
  • Marker amino acid sequences may facilitate purification of a protein.
  • marker amino acid sequences include, but are not limited to, a hexa-histidine peptide (such as the tag provided in a pQE vector (QIAGEN, Inc.)), a hemagglutinin ("HA") tag (which corresponds to an epitope derived from the Influenza hemagglutinin protein (Wilson et al., 1984, Cell 37:767)), the Fc domain of an hexa-histidine peptide (such as the tag provided in a pQE vector (QIAGEN, Inc.)), a hemagglutinin (“HA”) tag (which corresponds to an epitope derived from the Influenza hemagglutinin protein (Wilson et al., 1984, Cell 37:767)), the Fc domain of an
  • nucleic acids encoding B7-H7.
  • the B7-H7 encoded by the nucleic acid is capable of binding to one or more receptors of native B7-H7 (e.g., B7-H7CR).
  • native B7-H7 e.g., B7-H7CR
  • the B7-H7 encoded by the nucleic acids is capable of binding to B7-H7CR.
  • the B7-H7 encoded by the nucleic acids are Immunostimulating Therapeutic Agents.
  • the B7-H7 encoded by the nucleic acids are Inhibitory Therapeutic Agents.
  • Nucleic acid sequences encoding native B7-H7 are known in the art and have been described in the literature.
  • the nucleic acid sequences encoding native B7- H7 can be found in publicly available publications and databases, e.g., National Center for Biotechnology Information website at ncbi.nlm.nih.gov.
  • Cloning techniques well known in the art can be used to generate nucleic acids encoding B7-H7. See, e.g., Ausubel et al, Current Protocols in Molecular Biology, John Wiley and Sons, Inc. (1995); Sambrook et al, Molecular Cloning, A Laboratory Manual (2d ed.), Cold Spring Harbor Press, Cold Spring Harbor, N. Y. (1989); Birren et al, Genome Analysis: A Laboratory Manual, volumes 1 through 4, Cold Spring Harbor Press, Cold Spring Harbor, N. Y. (1997-1999).
  • the Therapeutic Agent comprises nucleic acids that encode native B7-H7.
  • the Therapeutic Agent comprises nucleic acids that encode a fusion protein described in Section 5.2.3, supra.
  • the Therapeutic Agent comprises nucleic acids that encode a B7-H7 derivative. See Section 5.2.2.1, supra, for B7-H7 derivatives that the nucleic acids might encode.
  • nucleic acids encoding B7-H7 include: (a) a nucleic acid sequence that is at least 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 99% or is 40% to 65%, 50% to 90%, 65% to 90%, 70% to 90%, 75% to 95%, 80% to 95%, or 85% to 99% identical to the naturally occurring nucleic acid sequence encoding a native B7-H7 polypeptide; (b) a nucleic acid sequence encoding a polypeptide that is at least 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 99% or is 40% to 65%, 50% to 90%, 65% to 90%, 70% to 90%, 75% to 95%, 80% to 95%, or 85% to 99% identical the amino acid sequence of a native B7-H7 polypeptide; (c) a nucleic acid sequence that
  • a nucleic acid sequence encoding a B7-H7 polypeptide is a derivative of a naturally occurring nucleic acid sequence encoding a native human B7-H7 polypeptide.
  • a nucleic acid sequence encoding a B7-H7 polypeptide is a derivative of a naturally occurring nucleic acid sequence encoding an immature or precursor form of a native human B7-H7 polypeptide.
  • a nucleic acid sequence encoding a B7-H7 polypeptide is a derivative of a naturally occurring nucleic acid sequence encoding a mature form of a native human B7-H7 polypeptide.
  • a nucleic acid sequence encodes a B7-H7 derivative described in Section 5.2.2.1, supra.
  • the nucleic acid sequence encoding a B7-H7 polypeptide includes non-naturally occurring residues.
  • nucleic acid sequences include codon-optimized nucleic acid sequences that encode native B7-H7 polypeptide, including mature and immature forms of B7-H7 polypeptide.
  • nucleic acid sequences include nucleic acids that encode B7-H7 RNA transcripts containing mutations that eliminate potential splice sites and instability elements (e.g., A/T or A/U rich elements) without affecting the amino acid sequence to increase the stability of the B7-H7 RNA transcripts.
  • nucleic acid sequences encode a B7-H7 polypeptide that retains at least 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 25% to 98%, 50% to 75%, or 75% to 100% of the function of a native B7-H7 polypeptide to bind to a native receptor of B7-H7 polypeptide (e.g., B7-H7CR), as measured by assays well known in the art, e.g., ELISA, Biacore, or co-immunoprecipitation.
  • B7-H7 polypeptide e.g., B7-H7CR
  • nucleic acid sequences encode a B7-H7 polypeptide that retains at least 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 25% to 98%, 50% to 75%, or 75% to 100% of the function of a native B7-H7 polypeptide to bind to B7-H7CR.
  • nucleic acid sequences encode a B7-H7 polypeptide that has a higher affinity for a native receptor of B7-H7 (e.g., native B7-H7CR) than native B7- H7 for the same receptor, as measured by assays/techniques well known in the art, e.g., ELISA, Biacore, or co-immunoprecipitation.
  • nucleic acid sequences encode a B7-H7 polypeptide that binds to a native receptor of B7-H7 (e.g., B7-H7CR) with 25%, 50%, 75%, 80%, 85%, 85%, 90%, 95%, or 25% to 50%, 50% to 75%, 75% to 95%, or 50% to 95% higher affinity than native B7-H7 for the same receptor, as measured by known assays/techniques.
  • B7-H7 e.g., B7-H7CR
  • nucleic acid sequences encode a B7-H7 polypeptide that binds to a native receptor of B7-H7 (e.g., B7-H7CR) with 0.5 logs, 1 log, 1.5 logs, 2 logs, 2.5 logs, or 3 logs higher affinity than the native B7-H7 binds to the same receptor, as measured by assays/techniques well known in the art, e.g., ELISA, Biacore, or co-immunoprecipitation.
  • B7-H7 e.g., B7-H7CR
  • nucleic acid sequences encode a B7-H7 polypeptide that binds to a native receptor of B7-H7 with a lower affinity than the native B7-H7 binds to the same receptor, as measured by well-known assays/techniques.
  • nucleic acid sequences encode a B7-H7 polypeptide that binds to a native receptor of B7-H7 with 25%, 50%, 75%, 80%, 85%, 90%, 95%, 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, or 75% to 95% lower affinity than the native B7-H7 binds to the same receptor, as measured by well-known assays/techniques.
  • nucleic acid sequences encode a B7-H7 polypeptide that binds to a native receptor of B7-H7 with 0.5 logs, 1 log, 1.5 logs, 2 logs, 2.5 logs, or 3 logs lower affinity than the native B7-H7 binds to the same receptor, as measured by well-known assays/techniques.
  • nucleic acid sequences encode a B7-H7 polypeptide that retains less than 20%, 15%, 10%, 5% or 2%, or in the range of between 2% to 20%, 2% to 15%, 2% to 10%, or 2% to 5% of the function of a native B7-H7 polypeptide to bind to a native receptor of B7-H7 (e.g., B7-H7CR), as measured by assays well known in the art, e.g., ELISA, Biacore, or co-immunoprecipitation.
  • B7-H7 native receptor of B7-H7
  • nucleic acid sequences encode a B7-H7 polypeptide that retains less than 20%, 15%, 10%, 5% or 2%, or in the range of between 2% to 20%, 2% to 15%, 2% to 10%, or 2% to 5% of the function of a native B7-H7 polypeptide to bind to B7-H7CR.
  • nucleic acid sequences encode a B7-H7 polypeptide that retains at least 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 25% to 98%, 50% to 75%, or 75% to 100% of the ability to activate or induce one or more of the signal transduction pathways induced when a native receptor of B7-H7 (e.g., B7-H7CR) binds to a native B7-H7 polypeptide, as measured by assays well-known in the art.
  • B7-H7 e.g., B7-H7CR
  • the one or more signal transduction pathways induced by the binding of a B7-H7 polypeptide to a receptor of B7-H7 can be measured by, e.g., assessing the activation of a signal transduction moiety (e.g., Jun kinase activation, MAP kinase activation, PKC activation), the translocation of a transcription factor (e.g., NF -kappa B or Statl), and cytokine production (e.g., IL-2, IL-4, 11-5, IL-10, IL-17, interferon-gamma, or tumor necrosis factor-alpha) using techniques such as ELISAs, Western blots, electromobility shift assays, and other immunoassays.
  • a signal transduction moiety e.g., Jun kinase activation, MAP kinase activation, PKC activation
  • a transcription factor e.g., NF -kappa B or Stat
  • nucleic acid sequences encode a B7-H7 polypeptide that retains at least 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 25% to 98%, 50% to 75%, or 75% to 100% of the ability to activate or induce one or more of the signal transduction pathways induced by the binding of a native B7-H7 polypeptide to B7-H7CR.
  • nucleic acid sequences encode a B7-H7 polypeptide that binds to its native receptor (e.g., native B7-H7CR) and induces a higher level of activity than native B7-H7 binding to the native receptor as assessed by, e.g., the activation or induction of one or more signal transduction molecules.
  • nucleic acid sequences encode a B7-H7 polypeptide that binds to B7-H7CR and induces a higher level of activity than native B7-H7 binding to native B7-H7CR as assessed by, e.g., the activation or induction of one or more signal transduction molecules.
  • nucleic acid sequences encode a B7-H7 polypeptide that binds to B7-H7CR and induces at least 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 25% to 98%, 50% to 75%, 50% to 98%, or 75% to 90% higher level of activity than native B7-H7 binding to native B7- H7CR as assessed by, e.g., the activation or induction of one or more signal transduction molecules.
  • nucleic acid sequences encode a B7-H7 polypeptide that retains less than 20%, 15%, 10%, 5% or 2%, or in the range of between 2% to 20%, 2% to 15%, 2% to 10%, or 2% to 5% of the ability to activate or induce one or more of the signal transduction pathways induced when a native B7-H7 polypeptide binds to a receptor of a native receptor of B7-H7 (e.g., B7-H7CR, as measured by assays well-known in the art.
  • nucleic acid sequences encode a B7-H7 polypeptide that retains less than 20%, 15%, 10%, 5% or 2%, or in the range of between 2% to 20%, 2% to 15%, 2% to 10%, or 2% to 5% of the ability to activate or induce one or more of the signal transduction pathways induced by the binding of a native B7-H7 polypeptide to B7-H7CR.
  • the B7-H7CR encoded by the nucleic acids is capable of binding to one or more ligands of native B7-H7CR (e.g., B7-H7).
  • the B7-H7CR encoded by the nucleic acids is capable of binding to B7-H7.
  • the B7-H7CR encoded by the nucleic acids are Immunostimulating Therapeutic Agents.
  • the B7-H7CR encoded by the nucleic acids are Inhibitory Therapeutic Agents.
  • Nucleic acid sequences encoding native B7-H7CR are known in the art and have been described in the literature.
  • the nucleic acid sequences encoding native B7- H7CR can be found in publicly available publications and databases, e.g., National Center for Biotechnology Information website at ncbi.nlm.nih.gov.
  • Cloning techniques well known in the art can be used to generate nucleic acids encoding B7-H7CR. See, e.g., Ausubel et ah, Current Protocols in Molecular Biology, John Wiley and Sons, Inc.
  • the Therapeutic Agent comprises nucleic acids that encode native B7-H7CR. In another embodiment, the Therapeutic Agent comprises nucleic acids that encode a fusion protein described in Section 5.2.3, supra. In another embodiment, the Therapeutic Agent comprises nucleic acids that encode a B7-H7CR derivative. See Section 5.2.2.2, supra, for B7-H7CR derivatives that the nucleic acids might encode.
  • nucleic acids encoding B7-H7CR include: (a) a nucleic acid sequence that is at least 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 99% or is 40% to 65%, 50% to 90%, 65% to 90%, 70% to 90%, 75% to 95%, 80% to 95%, or 85% to 99% identical to the naturally occurring nucleic acid sequence encoding a native B7-H7CR polypeptide; (b) a nucleic acid sequence encoding a polypeptide that is at least 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 99% or is 40% to 65%, 50% to 90%, 65% to 90%, 70% to 90%, 75% to 95%, 80% to 95%, or 85% to 99% identical the amino acid sequence of a native B7-H7CR polypeptide
  • hybridization conditions to a fragment of a naturally occurring nucleic acid sequence encoding a native B7-H7CR polypeptide; and (f) a nucleic acid sequence encoding a fragment of a naturally occurring nucleic acid sequence encoding a native B7-H7CR polypeptide.
  • a B7-H7CR derivative in the context of nucleic acids is a derivative of a naturally occurring nucleic acid sequence encoding a human B7-H7CR polypeptide.
  • a B7-H7CR derivative in the context of nucleic acids is a derivative of a naturally occurring nucleic acid sequence encoding an immature or precursor form of a native human B7-H7CR polypeptide.
  • a B7- H7CR derivative in the context of nucleic acids is a derivative of a naturally occurring nucleic acid sequence encoding a mature form of a native human B7-H7CR polypeptide.
  • a nucleic acid sequence encoding a B7-H7CR polypeptide is a derivative of a naturally occurring nucleic acid sequence encoding a native human B7-H7CR polypeptide.
  • a nucleic acid sequence encoding a B7-H7CR polypeptide is a derivative of a naturally occurring nucleic acid sequence encoding an immature or precursor form of a native human B7-H7CR polypeptide.
  • a nucleic acid sequence encoding a B7-H7CR polypeptide is a derivative of a naturally occurring nucleic acid sequence encoding a mature form of a native human B7-H7 polypeptide.
  • a nucleic acid sequence encodes a B7-H7CR derivative described in Section 5.2.2.2, supra.
  • the nucleic acid sequence encoding a B7-H7CR polypeptide includes non-naturally occurring residues.
  • nucleic acid sequences include codon-optimized nucleic acid sequences that encode native B7-H7CR polypeptide, including mature and immature forms of B7-H7CR polypeptide.
  • nucleic acid sequences include nucleic acids that encode B7-H7CR RNA transcripts containing mutations that eliminate potential splice sites and instability elements (e.g., A/T or A/U rich elements) without affecting the amino acid sequence to increase the stability of the mammalian B7-H7CR RNA transcripts.
  • nucleic acid sequences encode a B7-H7CR polypeptide that retains at least 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 25% to 98%, 50% to 75%, or 75% to 100% of the function of a native B7-H7CR polypeptide to bind to a native ligand of B7-H7CR (e.g., B7-H7), as measured by assays well known in the art, e.g., ELISA, Biacore, or co-immunoprecipitation.
  • B7-H7CR polypeptide that retains at least 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%
  • nucleic acid sequences encode a B7-H7CR polypeptide that retains at least 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 25% to 98%, 50% to 75%, or 75% to 100% of the function of a native B7-H7CR polypeptide to bind to B7-H7.
  • nucleic acid sequences encode a B7-H7CR polypeptide that has a higher affinity for a native ligand of B7-H7CR (e.g., native B7-H7) than native B7- H7CR for the same ligand, as measured by assays/techniques well known in the art, e.g., ELISA, Biacore, or co-immunoprecipitation.
  • nucleic acid sequences encode a B7-H7CR polypeptide that binds to a native ligand of B7-H7CR (e.g., B7-H7) with 25%, 50%, 75%, 80%, 85%, 85%, 90%, 95%, or 25% to 50%, 50% to 75%, 75% to 95%, or 50% to 95% higher affinity than native B7-H7CR for the same ligand, as measured by known assays/techniques.
  • B7-H7CR polypeptide that binds to a native ligand of B7-H7CR (e.g., B7-H7) with 25%, 50%, 75%, 80%, 85%, 85%, 90%, 95%, or 25% to 50%, 50% to 75%, 75% to 95%, or 50% to 95% higher affinity than native B7-H7CR for the same ligand, as measured by known assays/techniques.
  • nucleic acid sequences encode a B7-H7CR polypeptide that binds to a native ligand of B7-H7CR (e.g., B7-H7) with 0.5 logs, 1 log, 1.5 logs, 2 logs, 2.5 logs, or 3 logs higher affinity than the native B7-H7CR binds to the same ligand, as measured by assays/techniques well known in the art, e.g., ELISA, Biacore, or co- immunoprecipitation.
  • B7-H7CR polypeptide that binds to a native ligand of B7-H7CR (e.g., B7-H7) with 0.5 logs, 1 log, 1.5 logs, 2 logs, 2.5 logs, or 3 logs higher affinity than the native B7-H7CR binds to the same ligand, as measured by assays/techniques well known in the art, e.g., ELISA, Biacore, or co- immunoprecip
  • nucleic acid sequences encode a B7-H7CR polypeptide that binds to a native ligand of B7-H7CR with a lower affinity than the native B7-H7CR binds to the same ligand, as measured by well-known assays/techniques.
  • nucleic acid sequences encode a B7-H7CR polypeptide that binds to a native ligand of B7- H7CR with 25%, 50%, 75%, 80%, 85%, 90%, 95%, 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, or 75% to 95% lower affinity than the native B7-H7CR binds to the same ligand, as measured by well-known assays/techniques.
  • nucleic acid sequences encode a B7-H7CR polypeptide that binds to a native ligand of B7-H7CR with 0.5 logs, 1 log, 1.5 logs, 2 logs, 2.5 logs, or 3 logs lower affinity than the native B7-H7CR binds to the same ligand, as measured by well-known assays/techniques.
  • nucleic acid sequences encode a B7-H7CR polypeptide that retains less than 20%, 15%, 10%, 5% or 2%, or in the range of between 2% to 20%, 2% to 15%, 2% to 10%, or 2% to 5% of the function of a native B7-H7CR polypeptide to bind to a native ligand of B7-H7CR (e.g., B7-H7), as measured by assays well known in the art, e.g., ELISA, Biacore, or co-immunoprecipitation.
  • B7-H7CR e.g., B7-H7
  • nucleic acid sequences encode a B7-H7CR polypeptide that retains less than 20%, 15%, 10%, 5% or 2%, or in the range of between 2% to 20%, 2% to 15%, 2% to 10%, or 2% to 5% of the function of a native B7-H7CR polypeptide to bind to B7-H7.
  • nucleic acid sequences encode a B7-H7CR polypeptide that retains at least 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 25% to 98%, 50% to 75%, or 75% to 100% of the ability to activate or induce one or more of the signal transduction pathways induced when a native ligand of B7-H7CR (e.g., B7-H7) binds to a native B7-H7CR polypeptide, as measured by assays well-known in the art.
  • B7-H7CR native ligand of B7-H7CR
  • the one or more signal transduction pathways induced by the binding of a ligand of B7-H7CR polypeptide to a B7-H7CR polypeptide can be measured by, e.g., assessing the activation of a signal transduction moiety (e.g., Jun kinase activation, MAP kinase activation, PKC activation), the translocation of a transcription factor (e.g., NF -kappa B or Statl), and cytokine production (e.g., IL-2, IL-4, 11-5, IL-10, IL-17, interferon-gamma, or tumor necrosis factor-alpha) using techniques such as ELISAs, Western blots, electromobility shift assays, and other immunoassays.
  • a signal transduction moiety e.g., Jun kinase activation, MAP kinase activation, PKC activation
  • a transcription factor e.g., NF
  • B7-H7CR derivative nucleic acid sequences encode a protein or polypeptide that retains at least 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 25% to 98%, 50% to 75%, or 75% to 100% of the ability to activate or induce one or more of the signal transduction pathways induced by the binding of B7-H7 to a native B7-H7CR polypeptide.
  • nucleic acid sequences encode a B7-H7CR polypeptide that binds to its native ligand (e.g., native B7-H7) and induces a higher level of activity than native B7-H7CR binding to the native ligand as assessed by, e.g., the induction of one or more signal transduction molecules.
  • nucleic acid sequences encode a B7-H7CR polypeptide that binds to B7-H7 and induces a higher level of activity than native B7-H7CR binding to native B7-H7 as assessed by, e.g., the induction of one or more signal transduction molecules.
  • nucleic acid sequences encode a B7-H7CR polypeptide that binds to B7-H7 and induces at least 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 25% to 98%, 50% to 75%, 50% to 98%, or 75% to 90% higher level of activity than native B7-H7CR binding to native B7-H7 as assessed by, e.g., the induction of one or more signal transduction molecules.
  • nucleic acid sequences encode a B7-H7CR polypeptide that retains less than 20%, 15%, 10%, 5% or 2%, or in the range of between 2% to 20%, 2% to 15%, 2% to 10%, or 2% to 5% of the ability to activate or induce one or more of the signal transduction pathways induced when a native ligand (e.g., B7-H7) binds to a native B7-H7CR polypeptide, as measured by assays well-known in the art.
  • a native ligand e.g., B7-H7
  • nucleic acid sequences encode a B7-H7CR polypeptide that retains less than 20%, 15%, 10%, 5% or 2%, or in the range of between 2% to 20%, 2% to 15%, 2% to 10%, or 2% to 5% of the ability to activate or induce one or more of the signal transduction pathways induced by the binding of B7-H7 to a native B7-H7CR polypeptide.
  • a Therapeutic Agent is a nucleic acid sequence encoding an antibody that modulates the interaction between B7-H7 and one or more of its receptors (e.g., B7-H7CR).
  • a Therapeutic Agent is a nucleic acid sequence encoding an antibody that modulates the interaction between B7-H7CR and one or more of its ligands (e.g., B7-H7).
  • a Therapeutic Agent is a nucleic acid sequence encoding an antibody that modulates the B7-H7 polypeptide and B7-H7CR polypeptide interaction.
  • the Therapeutic Agent is a nucleic acid sequence encoding an antibody that specifically binds to B7-H7 polypeptide and inhibits or reduces the binding of B7-H7 polypeptide to B7-H7CR polypeptide.
  • a Therapeutic Agent is a nucleic acid sequence encoding an antibody that specifically binds to B7-H7CR polypeptide and inhibits or reduces the binding of B7-H7CR polypeptide to B7-H7 polypeptide.
  • a Therapeutic Agent is antibody (including antibody conjugates or fusion proteins) described in Section 5.1, supra or Section 5.2.1, supra.
  • antibodies encoded by the nucleic acid sequences are
  • antibodies encoded by the nucleic acid sequences are Inhibitory Therapeutic Agents.
  • nucleic acids encoding a protein can be inserted into nucleic acid constructs for expression in mammalian cells, non-mammalian animal cells, insect cells, plant cells, bacteria, fungus, yeast, and viruses.
  • Nucleic acid constructs may comprise one or more transcriptional regulatory element(s) operably linked to the coding sequence of a protein.
  • the transcriptional regulatory elements are typically 5' to the coding sequence and direct the transcription of the nucleic acids encoding a protein.
  • one or more of the transcriptional regulatory elements that are found in nature to regulate the transcription of the native gene are used to control transcription.
  • one or more transcriptional regulatory elements that are heterologous to the native gene are used to control transcription. Any transcriptional regulatory element(s) known to one of skill in the art may be used.
  • Non- limiting examples of the types of transcriptional regulatory element(s) include a constitutive promoter, a tissue-specific promoter, and an inducible promoter.
  • transcription is controlled, at least in part, by a mammalian (in some embodiments, human) transcriptional regulatory element(s). In a specific embodiment, transcription is controlled, at least in part, by a strong promoter, e.g., CMV.
  • promoters which may be used to control transcription include, but are not limited to, the SV40 early promoter region (Bernoist & Chambon, 1981, Nature 290:304-310), the promoter contained in the 3' long terminal repeat of Rous sarcoma virus (Yamamoto et al, 1980, Cell 22:787-797), the herpes thymidine kinase promoter (Wagner et al., 1981, Proc. Natl. Acad. Sci. U.S.A.
  • telomeres the regulatory sequences of the metallothionein gene (Brinster et al., 1982, Nature 296:39-42); adenovirus (ADV), cytomegalovirus (CMV), bovine papilloma virus (BPV), parovirus B19p6 promoter, prokaryotic expression vectors such as the .beta. -lactamase promoter (Villa-Kamaroff et al., 1978, Proc. Natl. Acad. Sci. U.S.A. 75:3727-3731), or the tac promoter (DeBoer et al., 1983, Proc. Natl. Acad. Sci. U.S.A.
  • promoter of the photosynthetic enzyme ribulose biphosphate carboxylase (Herrera-Estrella et al., 1984, Nature 310: 115-120); promoter elements from yeast or other fungi such as the Gal 4 promoter, the ADC (alcohol dehydrogenase) promoter, PGK
  • elastase I gene control region which is active in pancreatic acinar cells (Swift et al., 1984, Cell 38:639-646; Ornitz et al., 1986, Cold Spring Harbor Symp. Quant. Biol. 50:399-409; MacDonald, 1987, Hepatology 7:425-515); insulin gene control region which is active in pancreatic beta cells (Hanahan, 1985, Nature 315: 115-122),
  • immunoglobulin gene control region which is active in lymphoid cells (Grosschedl et al., 1984, Cell 38:647-658; Adames et al., 1985, Nature 318:533-538; Alexander et al., 1987, MoI. Cell. Biol. 7: 1436-1444), mouse mammary tumor virus control region which is active in testicular, breast, lymphoid and mast cells (Leder et al., 1986, Cell 45:485-495), albumin gene control region which is active in liver (Pinkert et al., 1987, Genes and Devel.
  • beta-globin gene control region which is active in myeloid cells (Mogram et al, 1985, Nature 315:338-340; Kollias et al., 1986, Cell 46:89-94; myelin basic protein gene control region which is active in oligodendrocyte cells in the brain (Readhead et al., 1987, Cell 48:703-712); myosin light chain-2 gene control region which is active in skeletal muscle (Sani, 1985, Nature 314:283-286), and gonadotropic releasing hormone gene control region which is active in the hypothalamus (Mason et al., 1986, Science 234: 1372-1378).
  • an inducible promoter can be used.
  • Nucleic acid constructs also may comprise one or more post-transcriptional regulatory element(s) operably linked to the coding sequence of a protein.
  • the post- transcriptional regulatory elements can be 5 ' and/or 3 ' to the coding sequence and direct the post-transcriptional regulation of the translation of RNA transcripts encoding a protein.
  • the nucleic acid construct can be a gene targeting vector that replaces a gene's existing regulatory region with a regulatory sequence isolated from a different gene or a novel regulatory sequence as described, e.g., in International Publication Nos. WO 94/12650 and WO 01/68882, which are incorporated by reference herein in their entireties.
  • the nucleic acid construct chosen will depend upon a variety of factors, including, without limitation, the strength of the transcriptional regulatory elements and the cell to be used to express a protein.
  • the nucleic acid constructs can be a plasmid, phagemid, cosmid, viral vector, phage, artificial chromosome, and the like.
  • the vectors can be episomal, non-homologously, or homologously integrating vectors, which can be introduced into the appropriate cells by any suitable means (transformation, transfection, conjugation, protoplast fusion, electroporation, calcium phosphate-precipitation, direct microinjection, etc.) to transform them.
  • the nucleic acid constructs can be a plasmid or a stable integration vector for transient or stable expression of a protein in cells.
  • the vector can mediate chromosomal integration at a target site or a random chromosomal site.
  • Non- limiting examples of cell-vector systems that may be used to express a protein include mammalian cell systems infected with virus (e.g., vaccinia virus, adenovirus, retroviruses, lentiviruses, etc.); insect cell systems infected with virus (e.g., baculovirus); microorganisms such as yeast containing yeast vectors, or bacteria transformed with bacteriophage, DNA, plasmid DNA, or cosmid DNA; and stable cell lines generated by transformation using a selectable marker.
  • virus e.g., vaccinia virus, adenovirus, retroviruses, lentiviruses, etc.
  • insect cell systems infected with virus e.g., baculovirus
  • microorganisms such as yeast containing yeast vectors, or bacteria transformed with bacteriophage, DNA, plasmid DNA, or cosmid DNA
  • stable cell lines generated by transformation using a selectable marker e.g., vac
  • the nucleic acid constructs include a selectable marker gene including, but not limited to, neo, gpt, dhfr, ada, pac, hyg, CAD and hisD.
  • the nucleic acid constructs can be monocistronic or multicistronic.
  • multicistronic nucleic acid construct may encode 2, 3, 4, 5, 6, 7, 8, 9, 10 or more, or in the range of 2-5, 5-10 or 10-20 genes/nucleotide sequences.
  • a bicistronic nucleic acid construct may comprise in the following order a promoter, a first gene and a second gene.
  • the transcription of both genes is driven by the promoter, whereas the translation of the mRNA from the first gene is by a cap-dependent scanning mechanism and the translation of the mRNA from the second gene is by a cap- independent mechanism, e.g., by an IRES.
  • Nucleic acid constructs comprising nucleic acids encoding a protein can be administered in vivo to a mammal or transfected into primary or immortalized cells in culture.
  • nucleic acid constructs comprising nucleic acids encoding a protein are administered to a mammal for recombinant expression of a protein in vivo.
  • cells transfected with the nucleic acid constructs ex vivo are transplanted or implanted in a subject.
  • a nucleic acid construct is a Therapeutic Agent.
  • cells transplanted with a nucleic acid construct are the Therapeutic Agent.
  • the nucleic acids encoding a protein can be used to generate mammalian cells that recombinantly express a protein in high amounts for the isolation and purification.
  • Recombinant protein production and purification are well known in the art, e.g., see International Publication No. WO 07/070488, which is incorporated by reference herein in its entirety.
  • the polypeptide can be produced intracellularly, in the periplasmic space, or directly secreted into the medium.
  • Cell lysate or supernatant comprising the polypeptide can be purified using, for example, hydroxylapatite chromatography, gel electrophoresis, dialysis, and affinity chromatography.
  • Cells can be engineered to express the protein(s) encoded by the nucleic acids and nucleic acid constructs described in Section 5.2.4, supra (e.g., Section 5.2.4.4, supra).
  • such cells express amounts of protein that are at least 1 fold, 2 fold, 3 fold, 4 fold, 5 fold, 6 fold, 7 fold, 8 fold, 9 fold, 10 fold, 20 fold, 30 fold, 40 fold, 50 fold or more than 50 fold higher than amounts of protein expressed endogenously by control cells ⁇ e.g., cells that have not been genetically engineered to recombinantly express protein, or cells comprising an empty vector).
  • cells can be engineered to express the antibodies described in Sections 5.1 and 5.2.1 supra, using techniques well-known to one of skill in the art, see, e.g., U.S. Patent Nos. 5,807,715, 6,331,415, and 6,818,216; U.S. Patent Application Publication Nos. US 2002/0098189, US 2004/0028685, US 2005/0019330, and US
  • Non-limiting examples of cells that can be used to express the protein(s) encoded by the nucleic acid constructs described in Section 5.2.4.4, supra, or the antibodies described in Sections 5.1 and 5.2.1, supra, include mammalian cells, non-mammalian animal cells, bacterial cells, fungal cells, yeast cells, primary cells, immortalized cells, plant cells, and insect cells.
  • the cells are a mammalian cell line.
  • mammalian cell lines include, but are not limited to, COS, CHO, HeLa, NIH3T3, HepG2, MCF7, HEK, 293T, RD, PC 12, hybridomas, pre-B cells, 293, 293H, K562, SkBr3, BT474, A204, M07Sb, Raji, Jurkat, MOLT-4, CTLL-2, MC-IXC, SK-N-MC, SK-N-MC, SK-N-DZ, SH-SY5Y, C 127, NO, and BE(2)-C cells.
  • Other mammalian cell lines available as hosts for expression are known in the art and include many immortalized cell lines available from the American Type Culture Collection (ATCC).
  • ATCC American Type Culture Collection
  • the cells are immortalized cell lines derived from a subject.
  • the cells are primary or secondary cells from a subject.
  • the cells are cancer cells.
  • the cells are fetal/embryonic cells.
  • the cells are progenitor cells.
  • the cells are lymphocytes (e.g., T cells and B cells).
  • the cells are stem cells.
  • the cells engineered to express the nucleic acid constructs of Section 5.2.4.4, supra, are from an adult.
  • reference to a cell transfected with nucleic acids includes the particular subject cell transfected with the nucleic acids and the progeny or potential progeny of such a cell. Progeny of such a cell may not be identical to the parent cell transfected with the nucleic acid molecule due to mutations or environmental influences that may occur in succeeding generations or integration of the nucleic acid molecule into the cell genome.
  • isolated cells are utilized herein.
  • isolated cells are utilized herein.
  • the isolated cells are at least 80%, 90%, 95% or 98% free of a different cell type as measured by a technique known to one of skill in the art, such as flow cytometry. In other words, at least 80%, 90%, 95% or 98% of the isolated cells are of the same cell type.
  • Any techniques known to one of skill in the art can be used to transfect or transduce cells with nucleic acids including, e.g., transformation, trans fection, conjugation, protoplast fusion, electroporation, calcium phosphate-precipitation, direct microinjection, and infection with viruses, including but not limited to adenoviruses, lentiviruses, and
  • the cells are transiently transfected with nucleic acids. In another embodiment, the cells are stably transfected with nucleic acids.
  • cell lines can be transformed using the nucleic acid constructs of Section 5.2.4.4 which may contain a selectable marker gene on the same or on a separate nucleic acid construct.
  • the selectable marker gene can be introduced into the same cell by co-transfection. Following the introduction of the vector, cells are allowed to grow for 1-2 days in an enriched media before they are switched to selective media to allow growth and recovery of cells that successfully express the introduced nucleic acids. Resistant clones of stably transformed cells may be proliferated using tissue culture techniques well known in the art that are appropriate to the cell type.
  • the cell line has been adapted to grow in serum- free medium. In one embodiment, the cell line has been adapted to grow in serum-free medium in shaker flasks. In one embodiment, the cell line has been adapted to grow in stir or rotating flasks. In certain embodiments, the cell line is cultured in suspension.
  • a particularly preferred method of high-yield production of a recombinant polypeptide of the present invention is through the use of dihydro folate reductase (DHFR) amplification in DHFR-deficient CHO cells, by the use of successively increasing levels of methotrexate as described in U.S. Patent No. 4,889,803, which is incorporated by reference herein in its entirety.
  • DHFR dihydro folate reductase
  • the polypeptide obtained from such cells may be in a glycosylated form.
  • the nucleic acid constructs are suitable for introduction and expression in primary cells isolated from a subject.
  • the primary cells are engineered to express a protein.
  • the primary cells isolated from a subject are further engineered to recombinantly express another therapeutic polypeptide, e.g. , a cytokine (e.g., IL-I, IL-2, IL-6, IL-I l, IL-12, IL-13, TNF-alpha, GM-CSF, interferon- ⁇ , interferon- ⁇ , or interferon- ⁇ ), CD3, a growth factor or a fragment or derivative thereof.
  • the primary cells isolated from a subject are further engineered to
  • cells engineered to express a protein are used as a Therapeutic Agent and are implanted or transplanted into a subject to prevent, treat or manage a disease.
  • a Therapeutic Agent is a compound (e.g., a small molecule).
  • a Therapeutic Agent is a compound that modulates the interaction between B7-H7 and one or more of its receptors (e.g., B7-H7CR).
  • a Therapeutic Agent is a compound that modulates the interaction between B7-H7CR and one or more of its ligands (e.g., B7-H7).
  • a Therapeutic Agent is a compound that modulates the interaction between B7-H7 and B7-H7CR.
  • a Therapeutic Agent is a compound that modulates the expression of B7-H7 or B7-H7CR.
  • a Therapeutic Agent is an Immunostimulating
  • a Therapeutic Agent is an Inhibitory Therapeutic Agent.
  • compounds include, but are not limited to, peptides;
  • a Therapeutic Agent is a small molecule.
  • a Therapeutic Agent is an antisense nucleic acid molecule that inhibits or reduces the expression of B7-H7 or B7-H7CR.
  • An antisense molecule can hydrogen bond to a sense nucleic acid.
  • the antisense nucleic acid can be complementary to an entire coding strand, or to only a fragment thereof, e.g. , all or part of the protein coding region (or open reading frame).
  • An antisense nucleic acid molecule can be antisense to all or part of a non-coding region of the coding strand of a nucleotide sequence encoding a protein.
  • the non-coding regions (“5' and 3' untranslated regions") are the 5' and 3' sequences which flank the coding region and are not translated into amino acids.
  • An antisense nucleic acid molecule can be, for example, about 5, 10, 15, 20, 25, 30, 35, 40, 45, or 50, or 5 to 25, 5 to 50, 10 to 25, 10 to 50, 15 to 25, 15 to 50, 20 to 30, 20 to 40, 20 to 50, 25 to 40, or 25 to 50 nucleotides or more in length.
  • An antisense nucleic acid molecule can be constructed using chemical synthesis and enzymatic ligation reactions using procedures known in the art.
  • an antisense nucleic acid e.g., an antisense oligonucleotide
  • an antisense nucleic acid can be chemically synthesized using naturally occurring nucleotides or variously modified nucleotides designed to increase the biological stability of the molecules or to increase the physical stability of the duplex formed between the antisense and sense nucleic acids, e.g., phosphorothioate derivatives and acridine substituted nucleotides can be used.
  • modified nucleotides which can be used to generate the antisense nucleic acid molecule include 5-fluorouracil, 5-bromouracil, 5-chlorouracil, 5-iodouracil, hypoxanthine, xanthine, 4-acetylcytosine, 5-(carboxyhydroxylmethyl) uracil, 5- carboxymethylaminomethyl-2-thiouridine, 5-carboxymethylaminomethyluracil,
  • dihydrouracil beta-D-galactosylqueosine, inosine, N6-isopentenyladenine, 1 -methylguanine, 1 -methylinosine, 2,2-dimethylguanine, 2-methyladenine, 2 -methylguanine, 3-methylcytosine, 5-methylcytosine, N6-adenine, 7 -methylguanine, 5-methylaminomethyluracil, 5- methoxyaminomethyl-2-thiouracil, beta-D-mannosylqueosine, 5'- methoxycarboxymethyluracil, 5-methoxyuracil, 2-methylthio-N6-isopentenyladenine, uracil- 5-oxyacetic acid (v), wybutoxosine, pseudouracil, queosine, 2-thiocytosine, 5-methyl-2- thiouracil, 2-thiouracil, 4-thiouracil, 5-methyluracil, uracil-5-oxyacetic acid
  • the antisense nucleic acid can be produced biologically using an expression vector into which a nucleic acid has been subcloned in an antisense orientation (i.e., RNA transcribed from the inserted nucleic acid will be of an antisense orientation to a target nucleic acid of interest, described further in the following subsection).
  • an expression vector into which a nucleic acid has been subcloned in an antisense orientation i.e., RNA transcribed from the inserted nucleic acid will be of an antisense orientation to a target nucleic acid of interest, described further in the following subsection.
  • a Therapeutic Agent is a ribozyme that is specific for B7- H7 or B7-H7CR nucleic acids.
  • Ribozymes are catalytic RNA molecules with ribonuclease activity which are capable of cleaving a single-stranded nucleic acid, such as an mRNA, to which they have a complementary region.
  • ribozymes e.g., hammerhead ribozymes (described in Haselhoff and Gerlach (1988) Nature 334:585-591)
  • a ribozyme having specificity for a nucleic acid molecule encoding a polypeptide can be designed based upon the nucleotide sequence of a cDNA disclosed herein.
  • a derivative of a Tetrahymena L- 19 IVS RNA can be constructed in which the nucleotide sequence of the active site is complementary to the nucleotide sequence to be cleaved in a Cech et al. U.S. Pat. No. 4,987,071; and Cech et al. U.S. Pat. No. 5,116,742.
  • an mRNA encoding a polypeptide can be used to select a catalytic RNA having a specific ribonuclease activity from a pool of RNA molecules. See, e.g., Bartel and Szostak (1993) Science 261 : 1411-1418.
  • a Therapeutic Agent is a small interfering RNA (siRNA) that inhibits or reduces the expression of B7-H7 or B7-H7CR.
  • siRNA small interfering RNA
  • Techniques for generating and using siRNA are known in the art. See, e.g., U.S. Patent Nos. 7,651,541, 7,608,707, and 7,056,704; Lopez-Fraga et al., 2009, BioDrugs 23(5): 305-332; Hajeri et al., 2009, Drug Discov Today 14(17-18):851-8; and Tilesi et al., 2009, Curr Opin MoI Ther. 11(2): 156-64 for information concerning siRNA.
  • a Therapeutic Agent that modulate one or more of the signal transduction pathways induced when a native B7-H2 polypeptide binds to either a native ICOS polypeptide, native CD28 polypeptide, or native CTLA-4 polypeptide.
  • a Therapeutic Agent selectively modulates one or more of the signal transduction pathways induced when a native B7-H2 binds to either a native ICOS polypeptide, native CD28 polypeptide, or a native CTLA-4 polypeptide.
  • a Therapeutic Agent modulates the interaction between a native B7-H2 polypeptide and a native ICOS polypeptide, native CD28 polypeptide, or native CTLA-4 polypeptide.
  • a Therapeutic Agent selectively modulates the interaction between either a native B7-H2 polypeptide and a native ICOS polypeptide, native CD28 polypeptide, or native CTLA-4 polypeptide.
  • Therapeutic Agents that modulate the expression of a native B7-H2 polypeptide, native ICOS polypeptide, native CD28 polypeptide, or native CTLA-4 polypeptide.
  • a Therapeutic Agent selectively modulates the expression of a native B7-H2 polypeptide, native ICOS
  • polypeptide native CD28 polypeptide, or native CTLA-4 polypeptide. See Sections 5.3.1 to 5.3.6, infra, for specific examples of Therapeutic Agents.
  • one or more signal transduction pathways mediated by B7-H2 binding to one or more of its receptors are modulated by contacting a Therapeutic Agent with an immune cell or a population of immune cells.
  • a Therapeutic Agent with an immune cell or a population of immune cells.
  • the interaction between B7-H2 and one or more of its receptors e.g., ICOS, CD28 or CTLA-4
  • B7-H2 and one or more of its receptors e.g., ICOS, CD28 or CTLA-4
  • the expression of B7-H2, ICOS, CD28 or CTLA-4 is modulated by contacting a Therapeutic Agent with an immune cell or a population of immune cells expressing B7-H2, ICOS, CD28 or CTLA-4, respectively.
  • a Therapeutic Agent modulates one or more of the signal transduction pathways induced by B7-H2 binding to ICOS. In certain embodiments, a Therapeutic Agent selectively modulates one or more signal transduction pathways induced by B7-H2 binding to ICOS. In certain embodiments, a Therapeutic Agent selectively activates or enhances one or more of the signal transduction pathways induced by the binding of B7-H2 to ICOS.
  • a Therapeutic Agent activates or enhances one or more of the signal transduction pathways induced by the binding of B7-H2 to ICOS by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7- H2 to ICOS in the absence of the Therapeutic Agent.
  • a Therapeutic Agent activates or enhances one or more of the signal transduction pathways induced by the binding of B7-H2 to ICOS by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H2 to ICOS in the absence of the Therapeutic Agent; and (ii) does not activate or enhance, or activates or enhances one or more of the signal transduction pathways induced by the binding of B7-H2 to one or more other receptors (e.g., CTLA-4 or CD28) by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 2% to 5%, 2% to 10%, 5% to 10%, 5% to 15%, 5% to 20%, 10% to 15%, or 15%
  • a Therapeutic Agent (i) activates or enhances one or more of the signal transduction pathways induced by the binding of B7-H2 to ICOS by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7- H2 to ICOS in the absence of the Therapeutic Agent; and (ii) does not activate or enhance, or activates or enhances one or more of the signal transduction pathways induced by the binding of ICOS to one or more other ligands by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 2% to 5%, 2% to 10%, 5% to 10%, 5% to 15%, 5% to 20%, 10% to 15%, or 15% to 20% relative to the one or more
  • a Therapeutic Agent selectively induces one or more of the signal transduction pathways induced by the binding of B7-H2 to ICOS.
  • a Therapeutic Agent induces one or more of the signal transduction pathways induced by the binding of B7-H2 to ICOS by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H2 to ICOS in the absence of the Therapeutic Agent.
  • a Therapeutic Agent induces one or more of the signal transduction pathways induced by the binding of B7-H2 to ICOS by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H2 to ICOS in the absence of the Therapeutic Agent; and (ii) does not induce, or induces one or more of the signal transduction pathways induced by the binding of B7-H2 to one or more other receptors (e.g., CTLA-4 or CD28) by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 2% to 5%, 2% to 10%, 5% to 10%, 5% to 15%, 5% to 20%, 10% to 15%, or 15% to 20% relative to the one or more
  • other receptors e.
  • a Therapeutic Agent induces one or more of the signal transduction pathways induced by the binding of B7-H2 to ICOS by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H2 to ICOS in the absence of the Therapeutic Agent; and (ii) does not induce, or induces one or more of the signal transduction pathways induced by the binding of ICOS to one or more other ligands by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 2% to 5%, 2% to 10%, 5% to 10%, 5% to 15%, 5% to 20%, 10% to 15%, or 15% to 20% relative to the one or more signal transduction pathways induced by the binding of ICOS
  • a Therapeutic Agent selectively inhibits or reduces one or more of the signal transduction pathways induced by the binding of B7-H2 to ICOS.
  • a Therapeutic Agent inhibits or reduces one or more of the signal transduction pathways induced by the binding of B7-H2 to ICOS by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H2 to ICOS in the absence of the Therapeutic Agent.
  • a Therapeutic Agent (i) inhibits or reduces one or more of the signal transduction pathways induced by the binding of B7-H2 to ICOS by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H2 to ICOS in the absence of the Therapeutic Agent; and (ii) does not inhibit or reduce, or inhibits or reduces one or more of the signal transduction pathways induced by the binding of B7-H2 to one or more other receptors (e.g., CTLA-4 or CD28) by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 2% to 5%, 2% to 10%, 5% to 10%, 5% to 15%, 5% to 20%, 10% to 15%, or 15%
  • a Therapeutic Agent inhibits or reduces one or more of the signal transduction pathways induced by the binding of B7-H2 to ICOS by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H2 to ICOS in the absence of the Therapeutic Agent.
  • a Therapeutic Agent (i) inhibits or reduces one or more of the signal transduction pathways induced by the binding of B7-H2 to ICOS by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H2 to ICOS in the absence of the Therapeutic Agent; and (ii) does not inhibit or reduce, or inhibits or reduces one or more of the signal transduction pathways induced by the binding of ICOS to one or more other ligands by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 2% to 5%, 2% to 10%, 5% to 10%, 5% to 15%, 5% to 20%, 10% to 15%, or 15% to 20% relative to the one or more signal transduction pathways
  • a Therapeutic Agent modulates the B7-H2 polypeptide and ICOS polypeptide interaction. In certain embodiments, the Therapeutic Agent selectively modulates the B7-H2 and ICOS interaction. In another embodiment, a
  • Therapeutic Agent inhibits or reduces the binding of B7-H2 to ICOS by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the binding of B7-H2 to ICOS in the absence of the Therapeutic Agent.
  • a Therapeutic Agent (i) inhibits or reduces the binding of B7-H2 to ICOS by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the binding of B7-H2 to ICOS in the absence of the Therapeutic Agent, and (ii) does not inhibit or reduce, or inhibits or reduces the binding of B7-H2 to one or more other receptors (e.g., CTLA-4 or CD28) by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 2% to 5%, 2% to 10%, 5% to 10%, 5% to 15%, 5% to 20%, 10% to 15%, or 15% to 20% relative to the binding of B7-H2 to such one or more other receptors in the absence of the Therapeutic Agent.
  • one or more other receptors e.g
  • a Therapeutic Agent (i) inhibits or reduces the binding of B7-H2 to ICOS by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the binding of B7-H2 to ICOS in the absence of the Therapeutic Agent, and (ii) does not inhibit or reduce, or inhibits or reduces the binding of ICOS to one or more other ligands by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 2% to 5%, 2% to 10%, 5% to 10%, 5% to 15%, 5% to 20%, 10% to 15%, or 15% to 20% relative to the binding of ICOS to such one or more other ligands in the absence of the Therapeutic Agent.
  • a Therapeutic Agent modulates one or more of the signal transduction pathways induced by B7-H2 binding to CD28. In certain embodiments, a Therapeutic Agent selectively modulates one or more signal transduction pathways induced by B7-H2 binding to CD28. In certain embodiments, a Therapeutic Agent selectively activates or enhances one or more of the signal transduction pathways induced by the binding of B7-H2 to CD28.
  • a Therapeutic Agent activates or enhances one or more of the signal transduction pathways induced by the binding of B7-H2 to CD28 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7- H2 to CD28 in the absence of the Therapeutic Agent.
  • a Therapeutic Agent activates or enhances one or more of the signal transduction pathways induced by the binding of B7-H2 to CD28 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7
  • Therapeutic Agent activates or enhances one or more of the signal transduction pathways induced by the binding of B7-H2 to CD28 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H2 to CD28 in the absence of the Therapeutic Agent; and (ii) does not activate or enhance, or activates or enhances one or more of the signal transduction pathways induced by the binding of B7-H2 to one or more other receptors (e.g., ICOS or CTLA-4) by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 2% to 5%, 2% to 10%, 5% to 10%, 5% to 15%, 5% to 20%, 10% to 15%, or 15% to 20% relative to the one or more
  • a Therapeutic Agent activates or enhances one or more of the signal transduction pathways induced by the binding of B7-H2 to CD28 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7- H2 to CD28 in the absence of the Therapeutic Agent; and (ii) does not activate or enhance, or activates or enhances one or more of the signal transduction pathways induced by the binding of CD28 to one or more other ligands (e.g., B7-1 and/or B7-2) by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 2% to 5%, 2% to 10%, 5% to 10%, 5% to 15%, 5% to 20%, 10%
  • other ligands e.g.,
  • a Therapeutic Agent selectively induces one or more of the signal transduction pathways induced by the binding of B7-H2 to CD28.
  • a Therapeutic Agent induces one or more of the signal transduction pathways induced by the binding of B7-H2 to CD28 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H2 to CD28 in the absence of the Therapeutic Agent.
  • a Therapeutic Agent induces one or more of the signal transduction pathways induced by the binding of B7-H2 to CD28 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H2 to CD28 in the absence of the Therapeutic Agent; and (ii) does not induce, or induces one or more of the signal transduction pathways induced by the binding of B7-H2 to one or more other receptors (e.g., ICOS or CTLA-4) by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 2% to 5%, 2% to 10%, 5% to 10%, 5% to 15%, 5% to 20%, 10% to 15%, or 15% to 20% relative to the one or more signal
  • a Therapeutic Agent induces one or more of the signal transduction pathways induced by the binding of B7-H2 to CD28 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H2 to CD28 in the absence of the Therapeutic Agent; and (ii) does not induce, or induces one or more of the signal transduction pathways induced by the binding of CD28 to one or more other ligands (e.g., B7-1 and/or B7-2) by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 2% to 5%, 2% to 10%, 5% to 10%, 5% to 15%, 5% to 20%, 10% to 15%, or 15% to 20% relative to the one or more
  • a Therapeutic Agent selectively inhibits or reduces one or more of the signal transduction pathways induced by the binding of B7-H2 to CD28.
  • a Therapeutic Agent inhibits or reduces one or more of the signal transduction pathways induced by the binding of B7-H2 to CD28 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H2 to CD28 in the absence of the Therapeutic Agent.
  • a Therapeutic Agent (i) inhibits or reduces one or more of the signal transduction pathways induced by the binding of B7-H2 to CD28 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H2 to CD28 in the absence of the Therapeutic Agent; and (ii) does not inhibit or reduce, or inhibits or reduces one or more of the signal transduction pathways induced by the binding of B7-H2 to one or more other receptors (e.g., ICOS or CTLA-4) by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 2% to 5%, 2% to 10%, 5% to 10%, 5% to 15%, 5% to 20%, 10% to 15%, or 15% to
  • a Therapeutic Agent (i) inhibits or reduces one or more of the signal transduction pathways induced by the binding of B7-H2 to CD28 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H2 to CD28 in the absence of the Therapeutic Agent; and (ii) does not inhibit or reduce, or inhibits or reduces one or more of the signal transduction pathways induced by the binding of CD28 to one or more other ligands (e.g., B7-1 and/or B7-2) by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 2% to 5%, 2% to 10%, 5% to 10%, 5% to 15%, 5% to 20%, 10%
  • other ligands e.
  • Therapeutic Agent inhibits or reduces the binding of B7-H2 to CD28 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the binding of B7-H2 to CD28 in the absence of the Therapeutic Agent.
  • a Therapeutic Agent (i) inhibits or reduces the binding of B7-H2 to CD28 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the binding of B7-H2 to CD28 in the absence of the Therapeutic Agent, and (ii) does not inhibit or reduce, or inhibits or reduces the binding of B7-H2 to one or more other receptors (e.g., ICOS or CTLA-4) by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 2% to 5%, 2% to 10%, 5% to 10%, 5% to 15%, 5% to 20%, 10% to 15%, or 15% to 20% relative to the binding of B7-H2 to such one or more other receptors in the absence of the Therapeutic Agent.
  • one or more other receptors e.g.
  • a Therapeutic Agent (i) inhibits or reduces the binding of B7-H2 to CD28 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the binding of B7-H2 to CD28 in the absence of the Therapeutic Agent, and (ii) does not inhibit or reduce, or inhibits or reduces the binding of CD28 to one or more other ligands (e.g., B7-1 and/or B7-2) by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 2% to 5%, 2% to 10%, 5% to 10%, 5% to 15%, 5% to 20%, 10% to 15%, or 15% to 20% relative to the binding of CD28 to such one or more other ligands in the absence of the Therapeutic Agent.
  • one or more other ligands e.
  • a Therapeutic Agent modulates one or more of the signal transduction pathways induced by B7-H2 binding to CTLA-4.
  • a Therapeutic Agent selectively modulates one or more signal transduction pathways induced by B7-H2 binding to CTLA-4. In certain embodiments, a Therapeutic Agent selectively activates or enhances one or more of the signal transduction pathways induced by the binding of B7-H2 to CTLA-4.
  • a Therapeutic Agent activates or enhances one or more of the signal transduction pathways induced by the binding of B7-H2 to CTLA-4 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H2 to CTLA-4 in the absence of the Therapeutic Agent.
  • a Therapeutic Agent activates or enhances one or more of the signal transduction pathways induced by the binding of B7-H2 to CTLA-4 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H2 to CTLA-4 in the absence of the Therapeutic Agent; and (ii) does not activate or enhance, or activates or enhances one or more of the signal transduction pathways induced by the binding of B7-H2 to one or more other receptors (e.g., ICOS or CD28) by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 2% to 5%, 2% to 10%, 5% to 10%, 5% to 15%, 5% to 20%, 10% to 15%, or 15%
  • a Therapeutic Agent activates or enhances one or more of the signal transduction pathways induced by the binding of B7-H2 to CTLA-4 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7- H2 to CTLA-4 in the absence of the Therapeutic Agent; and (ii) does not activate or enhance, or activates or enhances one or more of the signal transduction pathways induced by the binding of CTLA-4 to one or more other ligands (e.g., B7-1 and/or B7-2) by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 2% to 5%, 2% to 10%, 5% to 10%, 5% to 15%, 5% to
  • B7-1 and/or B7-2 e
  • a Therapeutic Agent selectively induces one or more of the signal transduction pathways induced by the binding of B7-H2 to CTLA-4.
  • a Therapeutic Agent induces one or more of the signal transduction pathways induced by the binding of B7-H2 to CTLA-4 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H2 to CTLA-4 in the absence of the Therapeutic Agent.
  • a Therapeutic Agent induces one or more of the signal transduction pathways induced by the binding of B7-H2 to CTLA-4 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H2 to CTLA-4 in the absence of the Therapeutic Agent; and (ii) does not induce, or induces one or more of the signal transduction pathways induced by the binding of B7-H2 to one or more other receptors (e.g., ICOS or CD28) by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 2% to 5%, 2% to 10%, 5% to 10%, 5% to 15%, 5% to 20%, 10% to 15%, or 15% to 20% relative to the one or more
  • other receptors e.
  • a Therapeutic Agent selectively inhibits or reduces one or more of the signal transduction pathways induced by the binding of B7-H2 to CTLA-4.
  • a Therapeutic Agent inhibits or reduces one or more of the signal transduction pathways induced by the binding of B7-H2 to CTLA-4 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H2 to CTLA-4 in the absence of the Therapeutic Agent.
  • a Therapeutic Agent (i) inhibits or reduces one or more of the signal transduction pathways induced by the binding of B7-H2 to CTLA-4 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H2 to CTLA-4 in the absence of the Therapeutic Agent; and (ii) does not inhibit or reduce, or inhibits or reduces one or more of the signal transduction pathways induced by the binding of B7-H2 to one or more other receptors (e.g., ICOS or CD28) by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 2% to 5%, 2% to 10%, 5% to 10%, 5% to 15%, 5% to 20%, 10% to 15%, or 15%
  • a Therapeutic Agent (i) inhibits or reduces one or more of the signal transduction pathways induced by the binding of B7-H2 to CTLA-4 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H2 to CTLA-4 in the absence of the Therapeutic Agent; and (ii) does not inhibit or reduce, or inhibits or reduces one or more of the signal transduction pathways induced by the binding of CTLA-4 to one or more other ligands (e.g., B7-1 and/or B7-2) by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 2% to 5%, 2% to 10%, 5% to 10%, 5% to 15%, 5% to
  • a Therapeutic Agent modulates the B7-H2 polypeptide and CTLA-4 polypeptide interaction.
  • the Therapeutic Agent selectively modulates the B7-H2 and CTLA-4 interaction.
  • a Therapeutic Agent inhibits or reduces the binding of B7-H2 to CTLA-4 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the binding of B7-H2 to CTLA-4 in the absence of the Therapeutic Agent.
  • a Therapeutic Agent (i) inhibits or reduces the binding of B7-H2 to CTLA-4 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the binding of B7-H2 to CTLA-4 in the absence of the Therapeutic Agent, and (ii) does not inhibit or reduce, or inhibits or reduces the binding of B7-H2 to one or more other receptors (e.g., ICOS or CD28) by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 2% to 5%, 2% to 10%, 5% to 10%, 5% to 15%, 5% to 20%, 10% to 15%, or 15% to 20% relative to the binding of B7-H2 to such one or more other receptors in the absence of the Therapeutic Agent.
  • one or more other receptors e.g
  • a Therapeutic Agent (i) inhibits or reduces the binding of B7-H2 to CTLA-4 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the binding of B7- H2 to CTLA-4 in the absence of the Therapeutic Agent, and (ii) does not inhibit or reduce, or inhibits or reduces the binding of CTLA-4 to one or more other ligands (e.g., B7-1 and/or B7- 2) by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 2% to 5%, 2% to 10%, 5% to 10%, 5% to 15%, 5% to 20%, 10% to 15%, or 15% to 20% relative to the binding of CTLA-4 to such one or more other ligands in the absence of the Therapeutic Agent.
  • a Therapeutic Agent modulates one or more of the signal transduction pathways induced by B7-H2 binding to CD28 and CTLA-4. In some embodiments, a Therapeutic Agent activates or enhances one or more of the signal transduction pathways induced by the binding of B7-H2 to CD28 and CTLA-4.
  • a Therapeutic Agent activates or enhances one or more of the signal transduction pathways induced by the binding of B7-H2 to CD28 and CTLA-4 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H2 to CD28 and CTLA-4 in the absence of the Therapeutic Agent.
  • a Therapeutic Agent activates or enhances one or more of the signal transduction pathways induced by the binding of B7-H2 to CD28 and CTLA-4 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H2 to CD28 and CTLA-4 in the absence of the Therapeutic Agent; and (ii) does not activate or enhance, or activates or enhances one or more of the signal transduction pathways induced by the binding of B7-H2 to ICOS by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 2% to 5%, 2% to 10%, 5% to 10%, 5% to 15%, 5% to 20%, 10% to 15%, or 15% to 20% relative to the one or more signal trans
  • a Therapeutic Agent induces one or more of the signal transduction pathways induced by the binding of B7-H2 to CD28 and CTLA-4.
  • a Therapeutic Agent induces one or more of the signal transduction pathways induced by the binding of B7-H2 to CD28 and CTLA-4 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H2 to CD28 and CTLA-4 in the absence of the Therapeutic Agent.
  • a Therapeutic Agent induces one or more of the signal transduction pathways induced by the binding of B7-H2 to CD28 and CTLA-4 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H2 to CD28 and CTLA-4 in the absence of the Therapeutic Agent; and (ii) does not induce, or induces one or more of the signal transduction pathways induced by the binding of B7-H2 to ICOS by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 2% to 5%, 2% to 10%, 5% to 10%, 5% to 15%, 5% to 20%, 10% to 15%, or 15% to 20% relative to the one or more signal transduction pathways induced by the binding of
  • a Therapeutic Agent inhibits or reduces one or more of the signal transduction pathways induced by the binding of B7-H2 to CD28 and CTLA-4.
  • a Therapeutic Agent inhibits or reduces one or more of the signal transduction pathways induced by the binding of B7-H2 to CD28 and CTLA-4 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H2 to CD28 and CTLA-4 in the absence of the Therapeutic Agent.
  • a Therapeutic Agent (i) inhibits or reduces one or more of the signal transduction pathways induced by the binding of B7-H2 to CD28 and CTLA-4 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H2 to CD28 and CTLA-4 in the absence of the Therapeutic Agent; and (ii) does not inhibit or reduce, or inhibits or reduces one or more of the signal transduction pathways induced by the binding of B7-H2 to ICOS by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 2% to 5%, 2% to 10%, 5% to 10%, 5% to 15%, 5% to 20%, 10% to 15%, or 15% to 20% relative to the one or more signal trans
  • a Therapeutic Agent modulates the interactions between B7-H2 and CD28 and B7-H2 and CTLA-4.
  • a Therapeutic Agent inhibits or reduces the binding of B7-H2 to CD28 and CTLA-4 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the binding of B7-H2 to CD28 and CTLA-4 in the absence of the Therapeutic Agent.
  • a Therapeutic Agent (i) inhibits or reduces the binding of B7-H2 to CD28 and CTLA-4 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the binding of B7-H2 to CD28 and CTLA-4 in the absence of the Therapeutic Agent, and (ii) does not inhibit or reduce, or inhibits or reduces the binding of B7-H2 to ICOS by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 2% to 5%, 2% to 10%, 5% to 10%, 5% to 15%, 5% to 20%, 10% to 15%, or 15% to 20% relative to the binding of B7-H2 to ICOS in the absence of the Therapeutic Agent.
  • a Therapeutic Agent modulates one or more of the signal transduction pathways induced by B7-H2 binding to CD28 and ICOS. In some embodiments, a Therapeutic Agent activates or enhances one or more of the signal transduction pathways induced by the binding of B7-H2 to CD28 and ICOS.
  • a Therapeutic Agent activates or enhances one or more of the signal transduction pathways induced by the binding of B7-H2 to CD28 and ICOS by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H2 to CD28 and ICOS in the absence of the Therapeutic Agent.
  • a Therapeutic Agent activates or enhances one or more of the signal transduction pathways induced by the binding of B7-H2 to CD28 and ICOS by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H2 to CD28 and ICOS in the absence of the Therapeutic Agent; and (ii) does not activate or enhance, or activates or enhances one or more of the signal transduction pathways induced by the binding of B7-H2 to CTLA-4 by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 2% to 5%, 2% to 10%, 5% to 10%, 5% to 15%, 5% to 20%, 10% to 15%, or 15% to 20% relative to the one or more signal trans
  • a Therapeutic Agent induces one or more of the signal transduction pathways induced by the binding of B7-H2 to CD28 and ICOS.
  • a Therapeutic Agent induces one or more of the signal transduction pathways induced by the binding of B7-H2 to CD28 and ICOS by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H2 to CD28 and ICOS in the absence of the Therapeutic Agent.
  • a Therapeutic Agent induces one or more of the signal transduction pathways induced by the binding of B7-H2 to CD28 and ICOS by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H2 to CD28 and ICOS in the absence of the Therapeutic Agent; and (ii) does not induce, or induces one or more of the signal transduction pathways induced by the binding of B7-H2 to CTLA-4 by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 2% to 5%, 2% to 10%, 5% to 10%, 5% to 15%, 5% to 20%, 10% to 15%, or 15% to 20% relative to the one or more signal transduction pathways induced by the binding of
  • a Therapeutic Agent inhibits or reduces one or more of the signal transduction pathways induced by the binding of B7-H2 to CD28 and ICOS.
  • a Therapeutic Agent inhibits or reduces one or more of the signal transduction pathways induced by the binding of B7-H2 to CD28 and ICOS by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H2 to CD28 and ICOS in the absence of the Therapeutic Agent.
  • a Therapeutic Agent (i) inhibits or reduces one or more of the signal transduction pathways induced by the binding of B7-H2 to CD28 and ICOS by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H2 to CD28 and ICOS in the absence of the Therapeutic Agent; and (ii) does not inhibit or reduce, or inhibits or reduces one or more of the signal transduction pathways induced by the binding of B7-H2 to CTLA-4 by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 2% to 5%, 2% to 10%, 5% to 10%, 5% to 15%, 5% to 20%, 10% to 15%, or 15% to 20% relative to the one or more signal trans
  • a Therapeutic Agent modulates the interactions between B7-H2 and CD28 and B7-H2 and ICOS.
  • a Therapeutic Agent inhibits or reduces the binding of B7-H2 to CD28 and ICOS by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the binding of B7-H2 to CD28 and ICOS in the absence of the Therapeutic Agent.
  • a Therapeutic Agent (i) inhibits or reduces the binding of B7-H2 to CD28 and ICOS by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the binding of B7-H2 to CD28 and ICOS in the absence of the Therapeutic Agent, and (ii) does not inhibit or reduce, or inhibits or reduces the binding of B7-H2 to CTLA-4 by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 2% to 5%, 2% to 10%, 5% to 10%, 5% to 15%, 5% to 20%, 10% to 15%, or 15% to 20% relative to the binding of B7-H2 to CTLA-4 in the absence of the Therapeutic Agent.
  • a Therapeutic Agent modulates one or more of the signal transduction pathways induced by B7-H2 binding to ICOS and CTLA-4. In some embodiments, a Therapeutic Agent activates or enhances one or more of the signal transduction pathways induced by the binding of B7-H2 to ICOS and CTLA-4.
  • a Therapeutic Agent activates or enhances one or more of the signal transduction pathways induced by the binding of B7-H2 to ICOS and CTLA-4 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H2 to ICOS and CTLA-4 in the absence of the Therapeutic Agent.
  • a Therapeutic Agent activates or enhances one or more of the signal transduction pathways induced by the binding of B7-H2 to ICOS and CTLA-4 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H2 to ICOS and CTLA-4 in the absence of the Therapeutic Agent; and (ii) does not activate or enhance, or activates or enhances one or more of the signal transduction pathways induced by the binding of B7-H2 to CD28 by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 2% to 5%, 2% to 10%, 5% to 10%, 5% to 15%, 5% to 20%, 10% to 15%, or 15% to 20% relative to the one or more signal
  • a Therapeutic Agent induces one or more of the signal transduction pathways induced by the binding of B7-H2 to ICOS and CTLA-4.
  • a Therapeutic Agent induces one or more of the signal transduction pathways induced by the binding of B7-H2 to ICOS and CTLA-4 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H2 to ICOS and CTLA-4 in the absence of the Therapeutic Agent.
  • a Therapeutic Agent induces one or more of the signal transduction pathways induced by the binding of B7-H2 to ICOS and CTLA-4 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H2 to ICOS and CTLA-4 in the absence of the Therapeutic Agent; and (ii) does not induce, or induces one or more of the signal transduction pathways induced by the binding of B7-H2 to CD28 by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 2% to 5%, 2% to 10%, 5% to 10%, 5% to 15%, 5% to 20%, 10% to 15%, or 15% to 20% relative to the one or more signal transduction pathways induced by the binding
  • a Therapeutic Agent inhibits or reduces one or more of the signal transduction pathways induced by the binding of B7-H2 to ICOS and CTLA-4.
  • a Therapeutic Agent inhibits or reduces one or more of the signal transduction pathways induced by the binding of B7-H2 to ICOS and CTLA-4 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H2 to ICOS and CTLA-4 in the absence of the Therapeutic Agent.
  • a Therapeutic Agent (i) inhibits or reduces one or more of the signal transduction pathways induced by the binding of B7-H2 to ICOS and CTLA-4 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H2 to ICOS and CTLA-4 in the absence of the Therapeutic Agent; and (ii) does not inhibit or reduce, or inhibits or reduces one or more of the signal transduction pathways induced by the binding of B7-H2 to CD28 by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 2% to 5%, 2% to 10%, 5% to 10%, 5% to 15%, 5% to 20%, 10% to 15%, or 15% to 20% relative to the one or more signal
  • a Therapeutic Agent modulates the interactions between B7-H2 and ICOS and B7-H2 and CTLA-4.
  • a Therapeutic Agent inhibits or reduces the binding of B7-H2 to ICOS and CTLA-4 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the binding of B7-H2 to ICOS and CTLA-4 in the absence of the Therapeutic Agent.
  • a Therapeutic Agent (i) inhibits or reduces the binding of B7-H2 to ICOS and CTLA-4 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the binding of B7-H2 to ICOS and CTLA-4 in the absence of the Therapeutic Agent, and (ii) does not inhibit or reduce, or inhibits or reduces the binding of B7-H2 to CD28 by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 2% to 5%, 2% to 10%, 5% to 10%, 5% to 15%, 5% to 20%, 10% to 15%, or 15% to 20% relative to the binding of B7-H2 to CD28 in the absence of the Therapeutic Agent.
  • a Therapeutic Agent modulates one or more of the signal transduction pathways induced by B7-H2 binding to CD28, CTLA-4 and ICOS.
  • a Therapeutic Agent activates or enhances one or more of the signal transduction pathways induced by the binding of B7-H2 to CD28, CTLA-4 and ICOS.
  • a Therapeutic Agent induces one or more of the signal transduction pathways induced by the binding of B7-H2 to CD28, CTLA-4 and ICOS.
  • a Therapeutic Agent inhibits or reduces one or more of the signal transduction pathways induced by the binding of B7-H2 to CD28, CTLA-4 and ICOS.
  • a Therapeutic Agent modulates the interactions between B7-H2 and CD28, B7-H2 and CTLA-4, and B7-H2 and ICOS.
  • the Therapeutic Agents are agonists. In other embodiments, the Therapeutic Agents are antagonists. [00334] In certain embodiments, the Therapeutic Agents induce, activate or enhance one or more immune functions or responses (i.e, the agents are Immunostimulating Therapeutic Agents). In other embodiments, the Therapeutic Agents suppress or reduce one or more immune functions or responses (i.e.., the agents are Inhibitory Therapeutic Agents).
  • the modulation of one or more immune functions or responses can be in the form of, e.g., an antibody response (humoral response) or a cellular immune response, e.g., cytokine secretion (e.g., interferon-gamma), helper activity or cellular cytotoxicity.
  • cytokine secretion, antibody production, effector function, T cell proliferation, and/or NK cell proliferation is modulated following contact with a Therapeutic Agent.
  • one or more immune functions or responses is modulated by contacting an immune cell or a population of immune cells with a Therapeutic Agent.
  • the antibodies described in this section are commercially or publicly available. In other embodiments, the antibodies described in this section can produced by any method well known in the art, e.g., as described in U.S. Patent Nos.
  • a Therapeutic Agent is an antibody that specifically binds to B7-H2 and modulates one or more of the signal transduction pathways induced by B7-H2 binding to one or more of the following receptors: ICOS, CD28, or CTLA-4.
  • the modulation of one or more signal transduction pathways can be measured by assessing the phosphorylation of certain subunits, the kinase activity of certain molecules (e.g., MAP kinase), the activity of certain transcription factors, or the translocation of certain transcription factors from the cytoplasm to the nucleus, cytokine production (e.g., IL-2, IL-4, IL-5, IL-10, IFN-alpha, IFN- beta, or IFN-gamma), antibody production, cellular proliferation (e.g., lymphocyte proliferation) using techniques known to those skilled in the art or described herein, e.g., ELISAs, Western Blots, electromobility shift assays or other immunoassays.
  • cytokine production e.g., IL-2, IL-4, IL-5, IL-10, IFN-alpha, IFN- beta, or IFN-gamma
  • cellular proliferation e.g., lymphocyte proliferation
  • the Therapeutic Agent modulates the interaction between B7-H2 and one or more of the following receptors: ICOS, CD28 or CTLA-4.
  • Methods well known in the art or described herin e.g., ELISA, cell-based assays including flow cytometry, KinEx A assay, and plasmon surface resonance assay (e.g., BIAcore" assay), may be used to assess binding of B7-H2 to one or more of the following receptors: ICOS, CD28 or CTLA-4.
  • Antibodies that modulate the interaction between B7-H2 and ICOS, CD28 or CTLA-4 may do so sterically or non-sterically.
  • the mouse anti-human B7-H2 monoclonal antibody 9F.8A4 (BioLegend; San Diego, CA) abrogates binding of B7-H2 to CD28, CTLA-4 and ICOS.
  • the Therapeutic Agent is 9F.8A4 or a fragment thereof (e.g., an antigen-binding fragment thereof).
  • the Therapeutic Agent is a chimeric or humanized form of 9F.8A4.
  • the Therapeutic Agent is not 9F.8A4, or a fragment thereof, or a chimeric or humanized form thereof.
  • the Therapeutic Agent is an antibody that specifically binds to B7-H2 and competes with 9F.8A4 for binding to B7-H2.
  • the Therapeutic Agent is an antibody that specifically binds to B7-H2 and selectively modulates one or more of the signal transduction pathways induced by the binding of B7-H2 to ICOS.
  • the Therapeutic Agent is an antibody that specifically binds to B7-H2 and selectively activates or enhances one or more of the signal transduction pathways induced by the binding of B7-H2 to ICOS.
  • the Therapeutic Agent is an antibody that specifically binds to B7-H2 and activates or enhances one or more of the signal transduction pathways induced by the binding of B7-H2 to ICOS by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H2 to ICOS in the absence of the antibody.
  • the Therapeutic Agent is an antibody that specifically binds to B7-H2 and the antibody: (i) activates or enhances one or more of the signal transduction pathways induced by the binding of B7-H2 to ICOS by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H2 to ICOS in the absence of the antibody; and (ii) does not activate or enhance, or activates or enhances one or more of the signal transduction pathways induced by the binding of B7-H2 to either CD28, CTLA-4 or both by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 2% to 5%, 2% to 10%, 5% to 10%, 5% to 15%, 5% to 20%, 10%
  • the Therapeutic Agent is an antibody that specifically binds to B7-H2 and selectively inhibits or reduces one or more of the signal transduction pathways induced by the binding of B7-H2 to ICOS.
  • the Therapeutic Agent is an antibody that specifically binds to B7-H2 and selectively inhibits or reduces one or more of the signal transduction pathways induced by the binding of B7-H2 to ICOS.
  • Therapeutic Agent is an antibody that specifically binds to B7-H2 and inhibits or reduces one or more of the signal transduction pathways induced by the binding of B7-H2 to ICOS by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7- H2 to ICOS in the absence of the antibody.
  • the Therapeutic Agent is an antibody that specifically binds to B7-H2 and the antibody: (i) inhibits or reduces one or more of the signal transduction pathways induced by the binding of B7-H2 to ICOS by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7- H2 to ICOS in the absence of the antibody; and (ii) does not inhibit or reduce, or inhibits or reduces one or more of the signal transduction pathways induced by the binding of B7-H2 to either CD28, CTLA-4 or both by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 2% to 5%, 2% to 10%, 5% to 10%, 5% to 15%, 5% to 20%, 10%
  • the Therapeutic Agent is an antibody that specifically binds to B7-H2 and selectively inhibits or reduces the binding of B7-H2 to ICOS.
  • the Therapeutic Agent is an antibody that specifically binds to B7-H2 and inhibits or reduces the binding of B7-H2 to ICOS by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the binding of B7- H2 to ICOS in the absence of the antibody.
  • the Therapeutic Agent is an antibody that specifically binds to B7-H2 and the antibody: (i) inhibits or reduces the binding of B7-H2 to ICOS by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the binding of B7-H2 to ICOS in the absence of the antibody, and (ii) does not inhibit or reduce, or inhibits or reduces the binding of B7-H2 to either CD28, CTLA-4 or both by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 2% to 5%, 2% to 10%, 5% to 10%, 5% to 15%, 5% to 20%, 10% to 15%, or 15% to 20% relative to the binding of B7-H2 to either CD28, CTLA-4 or both in the absence of the antibody.
  • the Therapeutic Agent is an antibody that specifically binds to B7-H2 and selectively modulates one or more of the signal transduction pathways induced by the binding of B7-H2 to either CD28, CTLA-4 or both.
  • the Therapeutic Agent is an antibody that specifically binds to B7-H2 and selectively activates or enhances one or more of the signal transduction pathways induced by the binding of B7-H2 to either CD28, CTLA-4 or both.
  • the Therapeutic Agent is an antibody that specifically binds to B7-H2 and modulates one or more of the signal transduction pathways induced by the binding of B7-H2 to CD28 as well as one or more of the signal transduction pathways induced by the binding of B7-H2 to CTLA-4.
  • the Therapeutic Agent is an antibody that specifically binds to B7-H2 and selectively activates or enhances: (i) one or more of the signal transduction pathways induced by the binding of B7-H2 to CD28, and (ii) one or more of the signal transduction pathways induced by the binding of B7-H2 to CTLA-4.
  • the Therapeutic Agent is an antibody that specifically binds to B7-H2 and the antibody: (i) activates or enhances one or more of the signal transduction pathways induced by the binding of B7-H2 to CD28 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H2 to CD28 in the absence of the antibody; and (ii) activates or enhances, or activates or enhances one or more of the signal transduction pathways induced by the binding of B7-H2 to CTLA-4 or both by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to
  • the Therapeutic Agent is an antibody that specifically binds to B7-H2 and the antibody: (i) activates or enhances one or more of the signal transduction pathways induced by the binding of B7-H2 to CD28 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H2 to CD28 in the absence of the antibody; (ii) activates or enhances one or more of the signal transduction pathways induced by the binding of B7-H2 to CD28 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to
  • the Therapeutic Agent is an antibody that specifically binds to B7-H2 and inhibits or reduces one or more of the signal transduction pathways induced by the binding of B7-H2 to CD28 as well one or more of the signal transduction pathways induced by the binding of B7-H2 to CTLA-4.
  • the Therapeutic Agent is an antibody that specifically binds to B7-H2 and the antibody: (i) inhibits or reduces one or more of the signal transduction pathways induced by the binding of B7-H2 to CD28 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H2 to CD28 in the absence of the antibody; and (ii) inhibits or reduces one or more of the signal transduction pathways induced by the binding of B7-H2 to CTLA-4 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%,
  • the Therapeutic Agent is an antibody that specifically binds to B7-H2 and the antibody: (i) inhibits or reduces one or more of the signal transduction pathways induced by the binding of B7-H2 to CD28 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H2 to CD28 in the absence of the antibody; (ii) inhibits or reduces one or more of the signal transduction pathways induced by the binding of B7-H2 to CTLA-4 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75%
  • the Therapeutic Agent is an antibody that specifically binds to B7-H2 and inhibits or reduces the binding of B7-H2 to CD28 as well as the binding of B7-H2 to CTLA-4.
  • the Therapeutic Agent is an antibody that specifically binds to B7-H2 and the antibody: (i) inhibits or reduces the binding of B7-H2 to CD28 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the binding of B7-H2 to CD28 in the absence of the antibody; and (ii) inhibits or reduces the binding of B7-H2 to CTLA-4 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 100%, or in the range of between 25%, 30%, 40%, 50%, 60%, 75%,
  • the Therapeutic Agent is an antibody that specifically binds to B7-H2 and the antibody: (i) inhibits or reduces the binding of B7-H2 to CD28 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the binding of B7-H2 to CD28 in the absence of the antibody; (ii) inhibits or reduces the binding of B7-H2 to CTLA-4 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the binding of B7-H2 to CTLA-4 in the absence of the antibody; and (iii)
  • the mouse anti-human B7-H2 monoclonal antibody MIH12 selectively blocks binding of B7- H2 to CD28 and CTLA-4. In other words, the antibody blocks binding of B7-H2 to CD28 and CTLA-4 without blocking binding to ICOS.
  • the Therapeutic Agent is MIH 12 or a fragment thereof.
  • the Therapeutic Agent is a chimeric or humanized form of MIH 12.
  • the Therapeutic Agent is not MIH12, or a fragment thereof, or a chimeric or humanized form thereof.
  • the Therapeutic Agent is an antibody that specifically binds to B7-H2 and competes with MIH12 for binding to B7-H2.
  • the Therapeutic Agent is an antibody that specifically binds to B7-H2 and selectively activates or enhances one or more of the signal transduction pathways induced by the binding of B7-H2 to CD28.
  • the Therapeutic Agent is an antibody that specifically binds to B7-H2 and selectively activates or enhances one or more of the signal transduction pathways induced by the binding of B7-H2 to CD28.
  • Therapeutic Agent is an antibody that specifically binds to B7-H2 and activates or enhances one or more of the signal transduction pathways induced by the binding of B7-H2 to CD28 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H2 to CD28 in the absence of the antibody.
  • the Therapeutic Agent is an antibody that specifically binds to B7-H2 and the antibody: (i) activates or enhances one or more of the signal transduction pathways induced by the binding of B7-H2 to CD28 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H2 to CD28 in the absence of the antibody; and (ii) does not activate or enhance, or activates or enhances one or more of the signal transduction pathways induced by the binding of B7-H2 to ICOS by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 2% to 5%, 2% to 10%, 5% to 10%, 5% to 15%, 5% to 20%, 10% to 15%, or 15% to 20% relative
  • the Therapeutic Agent is an antibody that specifically binds to B7-H2 and the antibody: (i) activates or enhances one or more of the signal transduction pathways induced by the binding of B7-H2 to CD28 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H2 to CD28 in the absence of the antibody; and (ii) does not activate or enhance, or activates or enhances one or more of the signal transduction pathways induced by the binding of B7-H2 to CTLA-4 by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 2% to 5%, 2% to 10%, 5% to 10%, 5% to 15%, 5% to 20%, 10% to 15%,
  • the Therapeutic Agent is an antibody that specifically binds to B7-H2 and the antibody: (i) activates or enhances one or more of the signal transduction pathways induced by the binding of B7-H2 to CD28 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H2 to CD28 in the absence of the antibody; and (ii) does not activate or enhance, or activates or enhances one or more of the signal transduction pathways induced by the binding of B7-H2 to ICOS or CTLA-4 by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 2% to 5%, 2% to 10%, 5% to 10%, 5% to 15%, 5% to 20%, 10% to 15%, or
  • the Therapeutic Agent is an antibody that specifically binds to B7-H2 and selectively inhibits or reduces one or more of the signal transduction pathways induced by the binding of B7-H2 to CD28.
  • the Therapeutic Agent is an antibody that specifically binds to B7-H2 and selectively inhibits or reduces one or more of the signal transduction pathways induced by the binding of B7-H2 to CD28.
  • Therapeutic Agent is an antibody that specifically binds to B7-H2 and inhibits or reduces one or more of the signal transduction pathways induced by the binding of B7-H2 to CD28 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7- H2 to CD28 in the absence of the antibody.
  • the Therapeutic Agent is an antibody that specifically binds to B7-H2 and the antibody: (i) inhibits or reduces one or more of the signal transduction pathways induced by the binding of B7-H2 to CD28 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7- H2 to CD28 in the absence of the antibody; and (ii) does not inhibit or reduce, or inhibits or reduces one or more of the signal transduction pathways induced by the binding of B7-H2 to ICOS by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 2% to 5%, 2% to 10%, 5% to 10%, 5% to 15%, 5% to 20%, 10% to 15%, or 15% to 20% relative
  • the Therapeutic Agent is an antibody that specifically binds to B7-H2 and the antibody: (i) inhibits or reduces one or more of the signal transduction pathways induced by the binding of B7-H2 to CD28 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H2 to CD28 in the absence of the antibody; and (ii) does not inhibit or reduce, or inhibits or reduces one or more of the signal transduction pathways induced by the binding of B7-H2 to CTLA-4 by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 2% to 5%, 2% to 10%, 5% to 10%, 5% to 15%, 5% to 20%, 10% to 15%,
  • the Therapeutic Agent is an antibody that specifically binds to B7-H2 and the antibody: (i) inhibits or reduces one or more of the signal transduction pathways induced by the binding of B7-H2 to CD28 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H2 to CD28 in the absence of the antibody; and (ii) does not inhibit or reduce, or inhibits or reduces one or more of the signal transduction pathways induced by the binding of B7-H2 to ICOS or CTLA-4 by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 2% to 5%, 2% to 10%, 5% to 10%, 5% to 15%, 5% to 20%, 10% to 15%, or
  • the Therapeutic Agent is an antibody that specifically binds to B7-H2 and selectively inhibits or reduces the binding of B7-H2 to CD28.
  • the Therapeutic Agent is an antibody that specifically binds to B7-H2 and inhibits or reduces the binding of B7-H2 to CD28 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the binding of B7- H2 to CD28 in the absence of the antibody.
  • the Therapeutic Agent is an antibody that specifically binds to B7-H2 and the antibody: (i) inhibits or reduces the binding of B7-H2 to CD28 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the binding of B7-H2 to CD28 in the absence of the antibody, and (ii) does not inhibit or reduce, or inhibits or reduces the binding of B7-H2 to ICOS by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 2% to 5%, 2% to 10%, 5% to 10%, 5% to 15%, 5% to 20%, 10% to 15%, or 15% to 20% relative to the binding of B7-H2 to ICOS in the absence of the antibody.
  • the Therapeutic Agent is an antibody that specifically binds to B7-H2 and the antibody: (i) inhibits or reduces the binding of B7-H2 to CD28 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the binding of B7- H2 to CD28 in the absence of the antibody, and (ii) does not inhibit or reduce, or inhibits or reduces the binding of B7-H2 to CTLA-4 by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 2% to 5%, 2% to 10%, 5% to 10%, 5% to 15%, 5% to 20%, 10% to 15%, or 15% to 20% relative to the binding of B7-H2 to CTLA-4 in the absence of the antibody.
  • the Therapeutic Agent is an antibody that specifically binds to B7- H2 and the antibody: (i) inhibits or reduces the binding of B7-H2 to CD28 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the binding of B7-H2 to CD28 in the absence of the antibody, and (ii) does not inhibit or reduce, or inhibits or reduces the binding of B7-H2 to ICOS or CTLA-4 by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 2% to 5%, 2% to 10%, 5% to 10%, 5% to 15%, 5% to 20%, 10% to 15%, or 15% to 20% relative to the binding of B7-H2 to ICOS or CTLA-4 in the absence of the antibody.
  • the Therapeutic Agent is an antibody that specifically binds to B7-H2 and slectively activates or enhances one or more of the signal transduction pathways induced by the binding of B7-H2 to CTLA-4.
  • the Therapeutic Agent is an antibody that specifically binds to B7-H2 and activates or enhances one or more of the signal transduction pathways induced by the binding of B7-H2 to CTLA-4 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H2 to CTLA-4 in the absence of the antibody.
  • the Therapeutic Agent is an antibody that specifically binds to B7-H2 and the antibody: (i) activates or enhances one or more of the signal transduction pathways induced by the binding of B7-H2 to CTLA-4 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H2 to CTLA-4 in the absence of the antibody; and (ii) does not activate or enhance, or activates or enhances one or more of the signal transduction pathways induced by the binding of B7-H2 to ICOS by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 2% to 5%, 2% to 10%, 5% to 10%, 5% to 15%, 5% to 20%, 10% to 15%, or 15% to
  • the Therapeutic Agent is an antibody that specifically binds to B7-H2 and the antibody: (i) activates or enhances one or more of the signal transduction pathways induced by the binding of B7-H2 to CTLA-4 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H2 to CTLA-4 in the absence of the antibody; and (ii) does not activate or enhance, or activates or enhances one or more of the signal transduction pathways induced by the binding of B7-H2 to CD28 by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 2% to 5%, 2% to 10%, 5% to 10%, 5% to 15%, 5% to 20%, 10% to 15%
  • the Therapeutic Agent is an antibody that specifically binds to B7-H2 and the antibody: (i) activates or enhances one or more of the signal transduction pathways induced by the binding of B7-H2 to CTLA-4 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H2 to CTLA-4 in the absence of the antibody; and (ii) does not activate or enhance, or activates or enhances one or more of the signal transduction pathways induced by the binding of B7-H2 to ICOS by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 2% to 5%, 2% to 10%, 5% to 10%, 5% to 15%, 5% to 20%, 10% to
  • the Therapeutic Agent is an antibody that specifically binds to B7-H2 and the antibody: (i) activates or enhances one or more of the signal transduction pathways induced by the binding of B7-H2 to CTLA-4 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H2 to CTLA-4 in the absence of the antibody; and (ii) does not activate or enhance, or activates or enhances one or more of the signal transduction pathways induced by the binding of B7-H2 to ICOS or CD28 by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 2% to 5%, 2% to 10%, 5% to 10%, 5% to 15%, 5% to 20%
  • the Therapeutic Agent is an antibody that specifically binds to B7-H2 and selectively inhibits or reduces one or more of the signal transduction pathways induced by the binding of B7-H2 to CTLA-4.
  • the Therapeutic Agent is an antibody that specifically binds to B7-H2 and inhibits or reduces one or more of the signal transduction pathways induced by the binding of B7-H2 to CTLA-4 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H2 to CTLA-4 in the absence of the antibody.
  • the Therapeutic Agent is an antibody that specifically binds to B7-H2 and the antibody: (i) inhibits or reduces one or more of the signal transduction pathways induced by the binding of B7-H2 to CTLA-4 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H2 to CTLA-4 in the absence of the antibody; and (ii) does not inhibit or reduce, or inhibits or reduces one or more of the signal transduction pathways induced by the binding of B7-H2 to ICOS by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 2% to 5%, 2% to 10%, 5% to 10%, 5% to 15%, 5% to 20%, 10% to 15%, or 15% to
  • the Therapeutic Agent is an antibody that specifically binds to B7-H2 and the antibody: (i) inhibits or reduces one or more of the signal transduction pathways induced by the binding of B7-H2 to CTLA-4 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H2 to CTLA-4 in the absence of the antibody; and (ii) does not inhibit or reduce, or inhibits or reduces one or more of the signal transduction pathways induced by the binding of B7-H2 to CD28 by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 2% to 5%, 2% to 10%, 5% to 10%, 5% to 15%, 5% to 20%, 10% to 15%,
  • the Therapeutic Agent is an antibody that specifically binds to B7-H2 and the antibody: (i) inhibits or reduces one or more of the signal transduction pathways induced by the binding of B7-H2 to CTLA-4 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H2 to CTLA-4 in the absence of the antibody; and (ii) does not inhibit or reduce, or inhibits or reduces one or more of the signal transduction pathways induced by the binding of B7-H2 to ICOS or CD28 by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 2% to 5%, 2% to 10%, 5% to 10%, 5% to 15%, 5% to 20%
  • the Therapeutic Agent is an antibody that specifically binds to B7-H2 and selectively inhibits or reduces the binding of B7-H2 to CTLA-4.
  • the Therapeutic Agent is an antibody that specifically binds to B7-H2 and inhibits or reduces the binding of B7-H2 to CTLA-4 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the binding of B7-H2 to CD28 in the absence of the antibody.
  • the Therapeutic Agent is an antibody that specifically binds to B7-H2 and the antibody: (i) inhibits or reduces the binding of B7-H2 to CTLA-4 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the binding of B7-H2 to CTLA-4 in the absence of the antibody, and (ii) does not inhibit or reduce, or inhibits or reduces the binding of B7-H2 to ICOS by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 2% to 5%, 2% to 10%, 5% to 10%, 5% to 15%, 5% to 20%, 10% to 15%, or 15% to 20% relative to the binding of B7-H2 to ICOS in the absence of the antibody.
  • the Therapeutic Agent is an antibody that specifically binds to B7-H2 and the antibody: (i) inhibits or reduces the binding of B7-H2 to CTLA-4 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the binding of B7-H2 to CTLA-4 in the absence of the antibody, and (ii) does not inhibit or reduce, or inhibits or reduces the binding of B7-H2 to CD28 by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 2% to 5%, 2% to 10%, 5% to 10%, 5% to 15%, 5% to 20%, 10% to 15%, or 15% to 20% relative to the binding of B7-H2 to CD28 in the absence of the antibody.
  • the Therapeutic Agent is an antibody that specifically binds to B7-H2 and the antibody: (i) inhibits or reduces the binding of B7-H2 to CTLA-4 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the binding of B7-H2 to CTLA-4 in the absence of the antibody, and (ii) does not inhibit or reduce, or inhibits or reduces the binding of B7-H2 to ICOS or CD28 by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 2% to 5%, 2% to 10%, 5% to 10%, 5% to 15%, 5% to 20%, 10% to 15%, or 15% to 20% relative to the binding of B7- H2 to ICOS or CD28 in the absence of the antibody.
  • an antibody specifically binds to an epitope comprising amino acid residues 116 to 122 of native human B7-H2. In some embodiments, an antibody specifically binds to an epitope comprising one or more of amino acid residues 51, 53, 116, and 122 of native human B7-H2.
  • an antibody described in this section comprises a modified Fc domain.
  • Exemplary Fc domain modifications are described in Mueller et al., 1997, Molecular Immunology 34(6):441-452; Swann et al., 2008, Current Opinion in Immunology 20:493-499; and Presta, 2008, Current Opinion in Immunology 20:460-470.
  • antibodies that specifically bind to a complex of either B7-H2 and ICOS, B7-H2 and CD28 or B7-H2 and CTLA-4 modulate one or more of the signal transduction pathways induced by B7-H2 binding to one or more of the following receptors: ICOS, CD28 or CTLA- 4.
  • such antibodies modulate the interaction between B7-H2 and one or more of the following receptors: ICOS, CD28 or CTLA-4.
  • Antibodies that modulate the interaction between B7-H2 and ICOS, CD28 or CTLA-4 may do so sterically or non- sterically.
  • a Therapeutic Agent is an antibody that specifically binds to a a B7-H2/ICOS complex.
  • a Therapeutic Agent is an antibody that specifically binds to a B7-H2/ICOS complex and modulates one or more of the signal transduction pathways induced by B7-H2 binding to ICOS.
  • a Therapeutic Agent is an antibody that specifically binds to a B7-H2/ICOS complex and modulates the interaction between B7-H2 and ICOS.
  • a Therapeutic Agent is an antibody that specifically binds to a B7-H2/CD28 complex.
  • a Therapeutic Agent is an antibody that specifically binds to a B7-H2/CD28 complex and modulates one or more of the signal transduction pathways induced by B7-H2 binding to CD28.
  • a Therapeutic Agent is an antibody that specifically binds to a B7-H2/CD28 complex and modulates the interaction between B7-H2 and CD28.
  • a Therapeutic Agent is an antibody that specifically binds to a B7-H7/CTLA-4 complex.
  • a Therapeutic Agent is an antibody that specifically binds to a B7-H2/CTLA-4 complex and modulates one or more of the signal transduction pathways induced by B7-H2 binding to CTLA-4.
  • a Therapeutic Agent is an antibody that specifically binds to a B7-H2/CTLA-4 complex and modulates the interaction between B7-H2 and CTLA-4.
  • an antibody that specifically binds to a complex of either B7-H2 and ICOS, B7-H2 and CD28 or B7-H2 and CTLA-4 induces one or more signal transduction pathways induced by the binding of B7-H2 to ICOS, B7-H2 to CD28, or B7-H2 to CTLA-4.
  • an antibody that specifically binds to a complex of either B7-H2 and ICOS, B7-H2 and CD28 or B7-H2 and CTLA-4 induces at least 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 25% to 98%, 50% to 75%, or 50% to 98% of one or more of the signal transduction pathways induced when a native B7-H2 polypeptide (e.g., a native mammalian B7-H2 polypeptide) binds to a native receptor of B7-H2 polypeptide (e.g., CD28, ICOS, or CTLA-4), as measured by assays well-known in the art.
  • a native B7-H2 polypeptide e.g., a native mammalian B7-H2 polypeptide
  • an antibody that specifically binds to a complex of either B7-H2 and ICOS, B7-H2 and CD28, or B7-H2 and CTLA-4 inhibits or reduces at least 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 25% to 98%, 50% to 75%, or 50% to 98% of one or more of the signal transduction pathways induced when a native B7-H2 polypeptide binds to a native receptor of B7-H2 as measured by assays well-known in the art.
  • an antibody described in this section comprises a modified Fc domain.
  • Exemplary Fc domain modifications are described in Mueller et al, 1997, Molecular Immunology 34(6):441-452; Swann et al., 2008, Current Opinion in Immunology 20:493-499; and Presta, 2008, Current Opinion in Immunology 20:460-470.
  • antibodies that specifically bind to an ICOS, CD28 or CTLA-4 modulate one or more of the signal transduction pathways induced by B7-H2 binding to one or more of the following receptors: ICOS, CD28 or CTLA-4. In some embodiments, such antibodies modulate the interaction between B7-H2 and one or more of the following receptors: ICOS, CD28 or CTLA-4. Antibodies that modulate the interaction between B7-H2 and ICOS, CD28 or CTLA-4 may do so sterically or non-sterically.
  • a Therapeutic Agent is an antibody that specifically binds to ICOS and modulates one or more of the signal transduction pathways induced by B7-H2 binding to ICOS.
  • a Therapeutic Agent is an antibody that specifically binds to ICOS and modulates the interaction between B7-H2 and ICOS.
  • a Therapeutic Agent is an antibody that specifically binds to ICOS and inhibits or reduces one or more signal transduction pathways induced by the binding of B7-H2 to ICOS without inhibiting or reducing one or more signal transduction pathways induced by the binding of ICOS to other ligands.
  • a Therapeutic Agent is an antibody that specifically binds to ICOS and the antibody inhibits or reduces one or more signal transduction pathways induced by the binding of B7-H2 to ICOS by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, or 75% to 100% relative to the one or more signal transduction induced by the binding of ICOS to B7-H2 in the absence of the antibody.
  • a Therapeutic Agent is an antibody that specifically binds to ICOS and the antibody: (i) inhibits or reduces one or more signal transduction pathways induced by the binding of B7-H2 to ICOS by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, or 75% to 100% relative to one or more signal transduction pathways induced by the binding of B7-H2 to ICOS in the absence of the antibody; and (ii) does not inhibit or reduce, or inhibits or reduces one or more signal transduction pathways induced by the binding of one or more other ligands of ICOS by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 5% to 20%, 5% to 15%, 5% to 10% or 2% to 5% relative to one or more signal transduction pathways induced by the binding of such one or more other
  • a Therapeutic Agent is an antibody that specifically binds to ICOS and activates or enhances one or more signal transduction pathways induced by the binding of B7-H2 to ICOS without inhibiting or reducing one or more signal transduction pathways induced by the binding of ICOS to other ligands.
  • a Therapeutic Agent is an antibody that specifically binds to ICOS and the antibody activates or enhances one or more signal transduction pathways induced by the binding of B7-H2 to ICOS by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, or 75% to 100% relative to the one or more signal transduction induced by the binding of ICOS to B7-H2 in the absence of the antibody.
  • a Therapeutic Agent is an antibody that specifically binds to ICOS and the antibody: (i) activates or enhances one or more signal transduction pathways induced by the binding of B7-H2 to ICOS by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, or 75% to 100% relative to one or more signal transduction pathways induced by the binding of B7-H2 to ICOS in the absence of the antibody; and (ii) does not activate or enhance, or activates or enhances one or more signal transduction pathways induced by the binding of one or more other ligands of ICOS by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 5% to 20%, 5% to 15%, 5% to 10% or 2% to 5% relative to one or more signal transduction pathways induced by the binding of such one or more other
  • a Therapeutic Agent is an antibody that specifically binds to ICOS and selectively modulates the interaction between B7-H2 and ICOS.
  • a Therapeutic Agent is an antibody that specifically binds to ICOS and inhibits or reduces the binding of B7-H2 to ICOS without inhibiting or reducing the binding of ICOS to other ligands.
  • a Therapeutic Agent is an antibody that specifically binds to ICOS and antibody inhibits or reduces the binding of B7-H2 to ICOS by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, or 75% to 100% relative to the binding of B7-H2 to ICOS in the absence of the antibody.
  • a Therapeutic Agent is an antibody that specifically binds to ICOS and the antibody: (i) inhibits or reduces the binding of B7-H2 to ICOS by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, or 75% to 100% relative to the binding of B7-H2 to ICOS in the absence of the antibody; and (ii) does not inhibit or reduce, or inhibits or reduces the binding of one or more other ligands of ICOS by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 5% to 20%, 5% to 15%, 5% to 10% or 2% to 5% relative to the binding of such one or more other ligands to ICOS in the absence of antibody.
  • a Therapeutic Agent is the mouse anti-human ICOS monoclonal antibody C398.4 (BioLegend; San Diego, CA) or a fragment thereof.
  • a Therapeutic Agent is a chimeric or humanized form of the mouse anti-ICOS monoclonal antibody C398.4.
  • a Therapeutic Agent is not the mouse anti-ICOS monoclonal antibody C398.4, or a fragment thereof, or a humanized or chimeric form thereof.
  • a Therapeutic Agent is an antibody that specifically binds to CD28 and modulates one or more of the signal transduction pathways induced by B7-H2 binding to CD28.
  • a Therapeutic Agent is an antibody that specifically binds to CD28 and inhibits or reduces one or more signal transduction pathways induced by the binding of B7-H2 to CD28 without inhibiting or reducing one or more signal transduction pathways induced by the binding of CD28 to other ligands (e.g., B7-1 or B7-2).
  • a Therapeutic Agent is an antibody that specifically binds to CD28 and the antibody inhibits or reduces one or more signal transduction pathways induced by the binding of B7-H2 to CD28 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, or 75% to 100% relative to the one or more signal transduction induced by the binding of CD28 to B7-H2 in the absence of the antibody.
  • a Therapeutic Agent is an antibody that specifically binds to CD28 and the antibody: (i) inhibits or reduces one or more signal transduction pathways induced by the binding of B7- H2 to CD28 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, or 75% to 100% relative to one or more signal transduction pathways induced by the binding of B7-H2 to CD28 in the absence of the antibody; and (ii) does not inhibit or reduce, or inhibits or reduces one or more signal transduction pathways induced by the binding of one or more other ligands of CD28 (e.g., B7-1 or B7-2) by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 5% to 20%, 5% to 15%, 5% to 10% or 2% to 5% relative to one or more signal transduction pathways induced
  • CD28
  • a Therapeutic Agent is an antibody that specifically binds to CD28 and activates or enhances one or more signal transduction pathways induced by the binding of B7-H2 to CD28 without inhibiting or reducing one or more signal transduction pathways induced by the binding of CD28 to other ligands (e.g., B7-1 or B7-2).
  • a Therapeutic Agent is an antibody that specifically binds to CD28 and antibody activates or enhances one or more signal transduction pathways induced by the binding of B7-H2 to CD28 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, or 75% to 100% relative to the one or more signal transduction induced by the binding of CD28 to B7-H2 in the absence of the antibody.
  • a Therapeutic Agent is an antibody that specifically binds to CD28 and the antibody: (i) activates or enhances one or more signal transduction pathways induced by the binding of B7-H2 to CD28 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, or 75% to 100% relative to one or more signal transduction pathways induced by the binding of B7-H2 to CD28 in the absence of the antibody; and (ii) does not activate or enhance, or activates or enhances one or more signal transduction pathways induced by the binding of one or more other ligands of CD28 (e.g., B7-1 or B7-2) by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 5% to 20%, 5% to 15%, 5% to 10% or 2% to 5% relative to one or more signal transduction pathways induced
  • CD28
  • a Therapeutic Agent is an antibody that specifically binds to CD28 and modulates the interaction between B7-H2 and CD28.
  • a Therapeutic Agent is an antibody that specifically binds to CD28 and selectively modulates the interaction between B7-H2 and CD28.
  • a Therapeutic Agent is an antibody that specifically binds to CD28 and inhibits or reduces the binding of B7-H2 to CD28 without inhibiting or reducing the binding of CD28 to other ligands (e.g., Bl-I or B7- 2).
  • a Therapeutic Agent is an antibody that specifically binds to CD28 and the antibody inhibits or reduces the binding of B7-H2 to CD28 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, or 75% to 100% relative to the binding of B7-H2 to CD28 in the absence of the antibody.
  • a Therapeutic Agent is an antibody that specifically binds to CD28 and the antibody inhibits or reduces the binding of B7-H2 to CD28 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, or 75% to 100% relative to the binding of B7-H2 to CD28 in the absence of the antibody.
  • a Therapeutic Agent is an antibody that specifically binds to CD28 and
  • Therapeutic Agent is an antibody that specifically binds to CD28 and the antibody: (i) inhibits or reduces the binding of B7-H2 to CD28 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, or 75% to 100% relative to the binding of B7-H2 to CD28 in the absence of the antibody; and (ii) does not inhibit or reduce, or inhibits or reduces the binding of one or more other ligands of CD28 (e.g., B7-1 or B7-2) by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 5% to 20%, 5% to 15%, 5% to 10% or 2% to 5% relative to the binding of such one or more other ligands to CD28 in the absence of the antibody.
  • one or more other ligands of CD28 e.g., B7-1 or B
  • a Therapeutic Agent is the mouse anti-human CD28 monoclonal antibody CD28.6 (blocking) or CD28.2 (costimulatory) (eBioscience; San Diego, CA) or a fragment thereof.
  • a Therapeutic Agent is a chimeric or humanized form of the mouse anti-CD28 monoclonal antibody CD28.6 or CD28.2.
  • a Therapeutic Agent is not the mouse anti-CD28 monoclonal antibody CD28.2, or a fragment thereof, or a humanized or chimeric form thereof.
  • a Therapeutic Agent is not the mouse anti-CD28 monoclonal antibody CD28.6, or a fragment thereof, or a humanized or chimeric form thereof.
  • a Therapeutic Agent is an antibody that specifically binds to CTLA-4 and modulates one or more of the signal transduction pathways induced by B7- H2 binding to CTLA-4.
  • a Therapeutic Agent is an antibody that specifically binds to CTLA-4 and inhibits or reduces one or more signal transduction pathways induced by the binding of B7-H2 to CTLA-4 without inhibiting or reducing one or more signal transduction pathways induced by the binding of CTLA-4 to other ligands (e.g., B7-1 or B7-2).
  • a Therapeutic Agent is an antibody that specifically binds to CTLA-4 and the antibody inhibits or reduces one or more signal transduction pathways induced by the binding of B7-H2 to CTLA-4 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, or 75% to 100% relative to the one or more signal transduction induced by the binding of CTLA-4 to B7-H2 in the absence of the antibody.
  • a Therapeutic Agent is an antibody that specifically binds to CTLA-4 and the antibody: (i) inhibits or reduces one or more signal transduction pathways induced by the binding of B7-H2 to CTLA-4 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, or 75% to 100% relative to one or more signal transduction pathways induced by the binding of B7-H2 to CTLA-4 in the absence of the antibody; and (ii) does not inhibit or reduce, or inhibits or reduces one or more signal transduction pathways induced by the binding of one or more other ligands of CTLA-4 (e.g., B7- 1 or B7-2) by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 5% to 20%, 5% to 15%, 5% to 10% or 2% to 5% relative to one or more signal
  • a Therapeutic Agent is an antibody that specifically binds to CTLA-4 and activates or enhances one or more signal transduction pathways induced by the binding of B7-H2 to CTLA-4 without inhibiting or reducing one or more signal transduction pathways induced by the binding of CTLA-4 to other ligands (e.g., B7-1 or B7-2).
  • a Therapeutic Agent is an antibody that specifically binds to CTLA-4 and the antibody activates or enhances one or more signal transduction pathways induced by the binding of B7-H2 to CTLA-4 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, or 75% to 100% relative to the one or more signal transduction induced by the binding of CTLA-4 to B7-H2 in the absence of the antibody.
  • a Therapeutic Agent is an antibody that specifically binds to CTLA-4 and the antibody: (i) activates or enhances one or more signal transduction pathways induced by the binding of B7-H2 to CTLA-4 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, or 75% to 100% relative to one or more signal transduction pathways induced by the binding of B7-H2 to CTLA-4 in the absence of the antibody; and (ii) does not activate or enhance, or activates or enhances one or more signal transduction pathways induced by the binding of one or more other ligands of CTLA-4 (e.g., B7-1 or B7-2) by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 5% to 20%, 5% to 15%, 5% to 10% or 2% to 5% relative to one or more signal trans
  • CTLA-4
  • Therapeutic Agent is an antibody that specifically binds to CTLA-4 and selectively modulates the interaction between B7-H2 and CTLA-4.
  • a Therapeutic Agent is an antibody that specifically binds to CTLA-4 and selectively modulates the interaction between B7-H2 and CTLA-4.
  • Therapeutic Agent is an antibody that specifically binds to CTLA-4 and inhibits or reduces the binding of B7-H2 to CTLA-4 without inhibiting or reducing the binding of CTLA-4 to other ligands (e.g., B7-1 or B7-2).
  • a Therapeutic Agent is an antibody that specifically binds to CTLA-4 and the antibody inhibits or reduces the binding of B7-H2 to CTLA-4 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, or 75% to 100% relative to the binding of B7-H2 to CTLA-4 in the absence of the antibody.
  • a Therapeutic Agent is an antibody that specifically binds to CTLA-4 and antibody: (i) inhibits or reduces the binding of B7-H2 to CTLA-4 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, or 75% to 100% relative to the binding of B7-H2 to CTLA-4 in the absence of the antibody; and (ii) does not inhibit or reduce, or inhibits or reduces the binding of one or more other ligands of CTLA-4 (e.g., B7-1 or B7-2) by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 5% to 20%, 5% to 15%, 5% to 10% or 2% to 5% relative to the binding of such one or more other ligands to CTLA-4 in the absence of antibody.
  • CTLA-4 e.g., B7-1 or B7-2
  • a Therapeutic Agent is the mouse anti-human CTLA-4 monoclonal antibody 14D3 (eBioscience; San Diego, CA) or a fragment thereof.
  • a Therapeutic Agent is a chimeric or humanized form of the mouse anti- CTLA-4 monoclonal antibody 14D3.
  • a Therapeutic Agent is not the mouse anti-CTLA-4 monoclonal antibody 14D3, or a fragment thereof, or a humanized or chimeric form thereof.
  • an antibody that specifically binds to ICOS, CD28 or CTLA-4 induces one or more signal transduction pathways induced by the binding of B7-H2 to ICOS, B7-H2 to CD28, or B7-H2 to CTLA-4.
  • an antibody that specifically binds to ICOS, CD28 or CTLA-4 induces at least 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 25% to 98%, 50% to 75%, or 50% to 98% of one or more of the signal transduction pathways induced when a native B7-H2 polypeptide (e.g., a native mammalian B7-H2 polypeptide) binds to a native receptor of B7-H2 polypeptide (e.g., CD28, CTLA-4, or ICOS), as measured by assays well-known in the art.
  • a native B7-H2 polypeptide e.g., a native mammalian B7-H2 polypeptide
  • a native receptor of B7-H2 polypeptide e.g., CD28, CTLA-4, or
  • an antibody that specifically binds to ICOS, CD28, or CTLA-4 inhibits or reduces by at least 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 25% to 98%, 50% to 75%, or 50% to 98% one or more of the signal transduction pathways induced when a native B7-H2 polypeptide binds to a native receptor of B7-H2 polypeptide (e.g., CD28, ICOS, or CTLA-4), as measured by assays well-known in the art.
  • a native B7-H2 polypeptide binds to a native receptor of B7-H2 polypeptide (e.g., CD28, ICOS, or CTLA-4), as measured by assays well-known in the art.
  • an antibody that specifically binds to an epitope comprising amino acid residues 116 to 122 of native human B7-H2 can be used to generate an anti-idiotypic antibody.
  • an anti-idiotypic antibody can be used to disrupt binding of B7-H2 to either CD28, CTLA-4 or both.
  • an antibody described in this section comprises a modified Fc domain.
  • Exemplary Fc domain modifications are described in Mueller et al, 1997, Molecular Immunology 34(6):441-452; Swann et al., 2008, Current Opinion in Immunology 20:493-499; and Presta, 2008, Current Opinion in Immunology 20:460-470.
  • the antibodies described in this Section 5.3.1 et seq. are conjugated or recombinantly fused to a diagnostic, detectable or therapeutic agent or any other molecule. See Section 5.1.2 for a description of antibody conjugates.
  • a Therapeutic Agent is a B7-H2 polypeptide.
  • such a Therapeutic Agent modulates one or more of the signal transduction pathways induced by B7-H2 binding to one or more of the following receptors: ICOS, CD28 or CTLA-4.
  • such a Therapeutic Agent modulates the interaction between B7-H2 polypeptide and one or more of the following receptors: ICOS, CD28 or CTLA-4.
  • such Therapeutic Agents are Immunostimulating Therapeutic Agents.
  • such Therapeutic Agents are Inhibitory
  • a Therapeutic Agent is a B7-H2 derivative.
  • such a Therapeutic Agent modulates one or more of the signal transduction pathways induced by B7-H2 binding to one one or more of the following receptors: ICOS, CD28 or CTLA-4.
  • such a Therapeutic Agent modulates the interaction between B7-H2 polypeptide and one or more of the following receptors: ICOS, CD28 or CTLA-4.
  • a B7-H2 derivative is an Immunostimulating Therapeutic Agent.
  • a B7-H2 derivative is an Inhibitory Therapeutic Agent.
  • a B7-H2 derivative modulates one or more of the signal transduction pathways induced by B7-H2 binding to ICOS. In certain embodiments, a B7-H2 derivative modulates one or more of the signal transduction pathways induced by B7-H2 binding to ICOS without modulating one or more signal transduction pathways induced by B7-H2 binding to either CD28, CTLA-4 or both. In certain embodiments, a B7-H2 derivative selectively modulates one or more signal transduction pathways induced by B7-H2 binding to ICOS.
  • a B7-H2 derivative selectively activates or enhances one or more of the signal transduction pathways induced by the binding of B7-H2 to ICOS.
  • a B7-H2 derivative activates or enhances one or more of the signal transduction pathways induced by the binding of B7-H2 to ICOS by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H2 to ICOS in the absence of the derivative.
  • a B7-H2 derivative (i) activates or enhances one or more of the signal transduction pathways induced by the binding of B7-H2 to ICOS by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H2 to ICOS in the absence of the derivative; and (ii) does not activate or enhance, or activates or enhances one or more of the signal transduction pathways induced by the binding of B7-H2 to one or more other receptors (e.g., CTLA-4 or CD28) by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 2% to 5%, 2% to 10%, 5% to 10%, 5% to 15%, 5% to 20%, 10% to 15%
  • a B7-H2 derivative binds to native ICOS and induces a higher level of activity than native B7-H2 binding to native ICOS as assessed by, e.g., the induction of one or more signal transduction molecules.
  • a B7-H2 derivative binds to native ICOS and induces at least 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 25% to 98%, 50% to 75%, 50% to 98%, or 75% to 90% higher level of activity than native B7-H2 binding to native ICOS as assessed by, e.g., the induction of one or more signal transduction molecules.
  • a B7-H2 derivative selectively inhibits or reduces one or more of the signal transduction pathways induced by the binding of B7-H2 to ICOS.
  • a B7-H2 derivative inhibits or reduces one or more of the signal transduction pathways induced by the binding of B7-H2 to ICOS by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H2 to ICOS in the absence of the derivative.
  • a B7-H2 derivative (i) inhibits or reduces one or more of the signal transduction pathways induced by the binding of B7-H2 to ICOS by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 98%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H2 to ICOS in the absence of the derivative; and (ii) does not inhibit or reduce, or inhibits or reduces one or more of the signal transduction pathways induced by the binding of B7-H2 to one or more other receptors (e.g., CTLA-4 or CD28) by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 2% to 5%, 2% to 10%, 5% to 10%, 5% to 15%, 5% to 20%, 10% to 15%
  • a B7-H2 derivative modulates the B7-H2 polypeptide and ICOS polypeptide interaction.
  • a B7-H2 derivative modulates the B7- H2 polypeptide and ICOS polypeptide interaction, but does not modulate the interaction between B7-H2 polypeptide and either CD28, CTLA-4 or both.
  • the B7-H2 derivative selectively modulates the B7-H2 and ICOS interaction.
  • a B7-H2 derivative inhibits or reduces the binding of B7-H2 to ICOS by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the binding of B7-H2 to ICOS in the absence of the derivative.
  • a B7-H2 derivative (i) inhibits or reduces the binding of B7-H2 to ICOS by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the binding of B7-H2 to ICOS in the absence of the derivative, and (ii) does not inhibit or reduce or inhibits or reduces the binding of B7-H2 to one or more other receptors (e.g., CTLA-4 or CD28) by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 2% to 5%, 2% to 10%, 5% to 10%, 5% to 15%, 5% to 20%, 10% to 15%, or 15% to 20% relative to the binding of B7-H2 to such one or more other receptors in the absence of the derivative.
  • one or more other receptors e.
  • a B7-H2 derivative binds to a native ICOS with a higher affinity than native B7-H2 binds to native ICOS, as measured by assays/techniques well known in the art, e.g., ELISA, Biacore, or co-immunoprecipitation.
  • a B7-H2 derivative binds to a native ICOS with a 50%, 75%, 80%, 85%, 90%, 95%, or 98%, or 25% to 50%, 25% to 75%, 50% to 95%, or 75% to 95% higher affinity than the native B7-H2 binds to native ICOS, as measured by techniques well-known in the art.
  • a B7-H2 derivative binds to a native ICOS with 0.5 logs, 1 log, 1.5 logs, 2 logs, 2.5 logs, or 3 logs higher affinity than the native B7-H2 binds to native ICOS, as measured by assays/techniques well known in the art, e.g., ELISA, Biacore, or co-immunoprecipitation.
  • a B7-H2 derivative binds to native ICOS with a lower affinity than the native B7-H2 binds to native ICOS, as measured by well-known
  • a B7-H2 derivative binds to a native ICOS with 25%, 50%, 75%, 80%, 85%, 90%, 95%, or 98%, or 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, or 75% to 95% lower affinity than the native B7-H2 binds to the native ICOS, as measured by well-known assays/techniques.
  • a B7-H2 derivative binds to a native ICOS with 0.5 logs, 1 log, 1.5 logs, 2 logs, 2.5 logs, or 3 logs lower affinity than the native B7-H2 binds to the native ICOS, as measured by well-known
  • a B7-H2 derivative modulates one or more of the signal transduction pathways induced by B7-H2 binding to CD28. In certain embodiments, a B7- H2 derivative selectively modulates one or more signal transduction pathways induced by B7-H2 binding to CD28. In certain embodiments, a B7-H2 derivative selectively activates or enhances one or more of the signal transduction pathways induced by the binding of B7-H2 to CD28.
  • a B7-H2 derivative activates or enhances one or more of the signal transduction pathways induced by the binding of B7-H2 to CD28 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H2 to CD28 in the absence of the derivative.
  • a B7-H2 derivative (i) activates or enhances one or more of the signal transduction pathways induced by the binding of B7-H2 to CD28 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H2 to CD28 in the absence of the derivative; and (ii) does not activate or enhance, or activates or enhances one or more of the signal transduction pathways induced by the binding of B7-H2 to one or more other receptors (e.g., ICOS or CTLA-4) by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 2% to 5%, 2% to 10%, 5% to 10%, 5% to 15%, 5% to 20%, 10% to 15%,
  • a B7-H2 derivative binds to native CD28 and induces a higher level of activity than native B7-H2 binding to native CD28 as assessed by, e.g., the activation or induction of one or more signal transduction molecules.
  • a B7-H2 derivative binds to native CD28 and induces at least 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 25% to 98%, 50% to 75%, 50% to 98%, or 75% to 90% higher level of activity than native B7-H2 binding to native CD28 as assessed by, e.g., the activation or induction of one or more signal transduction molecules.
  • a B7-H2 derivative selectively inhibits or reduces one or more of the signal transduction pathways induced by the binding of B7-H2 to CD28.
  • a B7-H2 derivative inhibits or reduces one or more of the signal transduction pathways induced by the binding of B7-H2 to CD28 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H2 to CD28 in the absence of the derivative.
  • a B7-H2 derivative (i) inhibits or reduces one or more of the signal transduction pathways induced by the binding of B7-H2 to CD28 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H2 to CD28 in the absence of the derivative; and (ii) does not inhibit or reduce, or inhibits or reduces one or more of the signal transduction pathways induced by the binding of B7-H2 to one or more other receptors (e.g., ICOS or CTLA-4) by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 2% to 5%, 2% to 10%, 5% to 10%, 5% to 15%, 5% to 20%, 10% to 15%,
  • a B7-H2 derivative modulates the B7-H2 polypeptide and CD28 polypeptide interaction.
  • the B7-H2 derivative selectively modulates the B7-H2 and CD28 interaction.
  • a B7-H2 derivative inhibits or reduces the binding of B7-H2 to CD28 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the binding of B7- H2 to CD28 in the absence of the derivative.
  • a B7-H2 derivative (i) inhibits or reduces the binding of B7-H2 to CD28 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the binding of B7- H2 to CD28 in the absence of the derivative, and (ii) does not inhibit or reduce or inhibits or reduces the binding of B7-H2 to one or more other receptors (e.g., ICOS or CTLA-4) by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 2% to 5%, 2% to 10%, 5% to 10%, 5% to 15%, 5% to 20%, 10% to 15%, or 15% to 20% relative to the binding of B7-H2 to such one or more other receptors in the absence of the derivative.
  • other receptors e.g.,
  • a B7-H2 derivative binds to a native CD28 with a higher affinity than native B7-H2 binds to native CD28, as measured by assays/techniques well known in the art, e.g., ELISA, Biacore, or co-immunoprecipitation.
  • a B7-H2 derivative binds to a native CD28 with a 50%, 75%, 80%, 85%, 90%, 95%, or 98%, or 25% to 50%, 25% to 75%, 50% to 95%, or 75% to 95% higher affinity than the native B7- H2 binds to native CD28, as measured by techniques well-known in the art.
  • a B7-H2 derivative binds to a native CD28 with 0.5 logs, 1 log, 1.5 logs, 2 logs, 2.5 logs, or 3 logs higher affinity than the native B7-H2 binds to native CD28, as measured by assays/techniques well known in the art, e.g., ELISA, Biacore, or co-immunoprecipitation.
  • a B7-H2 derivative binds to native CD28 with a lower affinity than the native B7-H2 binds to native CD28, as measured by well-known
  • a B7-H2 derivative binds to a native CD28 with 25%, 50%, 75%, 80%, 85%, 90%, 95%, or 98%, or 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, or 75% to 95% lower affinity than the native B7-H2 binds to the native CD28, as measured by well-known assays/techniques.
  • a B7-H2 derivative binds to a native ICOS with 0.5 logs, 1 log, 1.5 logs, 2 logs, 2.5 logs, or 3 logs lower affinity than the native B7-H2 binds to the native CD28, as measured by well-known
  • a B7-H2 derivative modulates one or more of the signal transduction pathways induced by B7-H2 binding to CTLA-4. In certain embodiments, a B7- H2 derivative selectively modulates one or more signal transduction pathways induced by B7-H2 binding to CTLA-4. In certain embodiments, a B7-H2 derivative selectively activates or enhances one or more of the signal transduction pathways induced by the binding of B7- H2 to CTLA-4.
  • a B7-H2 derivative activates or enhances one or more of the signal transduction pathways induced by the binding of B7-H2 to CTLA-4 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7- H2 to CTLA-4 in the absence of the derivative.
  • a B7-H2 derivative (i) activates or enhances one or more of the signal transduction pathways induced by the binding of B7-H2 to CTLA-4 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H2 to CTLA-4 in the absence of the derivative; and (ii) does not activate or enhance, or activates or enhances one or more of the signal transduction pathways induced by the binding of B7-H2 to one or more other receptors (e.g., ICOS or CD28) by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 2% to 5%, 2% to 10%, 5% to 10%, 5% to 15%, 5% to 20%, 10% to 15%
  • a B7-H2 derivative binds to native CTLA-4 and induces a higher level of activity than native B7-H2 binding to native CTLA-4 as assessed by, e.g., the activation or induction of one or more signal transduction molecules.
  • a B7-H2 derivative binds to native CTLA-4 and induces at least 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 25% to 98%, 50% to 75%, 50% to 98%, or 75% to 90% higher level of activity than native B7-H2 binding to native CTLA-4 as assessed by, e.g., the activation or induction of one or more signal transduction molecules.
  • a B7-H2 derivative selectively inhibits or reduces one or more of the signal transduction pathways induced by the binding of B7-H2 to CTLA-4.
  • a B7-H2 derivative inhibits or reduces one or more of the signal transduction pathways induced by the binding of B7-H2 to CTLA-4 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H2 to CTLA-4 in the absence of the derivative.
  • a B7-H2 derivative (i) inhibits or reduces one or more of the signal transduction pathways induced by the binding of B7-H2 to CTLA-4 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H2 to CTLA-4 in the absence of the derivative; and (ii) does not inhibit or reduce, or inhibits or reduces one or more of the signal transduction pathways induced by the binding of B7-H2 to one or more other receptors (e.g., ICOS or CD28) by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 2% to 5%, 2% to 10%, 5% to 10%, 5% to 15%, 5% to 20%, 10% to 15%
  • a B7-H2 derivative modulates the B7-H2 polypeptide and CTLA-4 polypeptide interaction.
  • the B7-H2 derivative selectively modulates the B7-H2 and CTLA-4 interaction.
  • a B7-H2 derivative inhibits or reduces the binding of B7-H2 to CTLA-4 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the binding of B7- H2 to CTLA-4 in the absence of the derivative.
  • a B7-H2 derivative (i) inhibits or reduces the binding of B7-H2 to CTLA-4 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the binding of B7-H2 to CTLA-4 in the absence of the derivative, and (ii) does not inhibit or reduce or inhibits or reduces the binding of B7-H2 to one or more other receptors (e.g., ICOS or CD28) by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 2% to 5%, 2% to 10%, 5% to 10%, 5% to 15%, 5% to 20%, 10% to 15%, or 15% to 20% relative to the binding of B7-H2 to such one or more other receptors in the absence of the derivative.
  • other receptors e.g.,
  • a B7-H2 derivative binds to a native CTLA-4 with a higher affinity than native B7-H2 binds to native CTLA-4, as measured by assays/techniques well known in the art, e.g., ELISA, Biacore, or co-immunoprecipitation.
  • a B7-H2 derivative binds to a native CTLA-4 with 25%, 50%, 75%, 80%, 85%, 90%, 95%, or 98%, or 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, or 75% to 95% lower affinity than the native B7-H2 binds to the native CTLA-4, as measured by well-known assays/techniques.
  • a B7-H2 derivative binds to a native CTLA-4 with 0.5 logs, 1 log, 1.5 logs, 2 logs, 2.5 logs, or 3 logs higher affinity than native B7-H2 binds to native CTLA-4, as measured by assays/techniques well known in the art, e.g., ELISA, Biacore, or co-immunoprecipitation.
  • a B7-H2 derivative binds to native CTLA-4 with a lower affinity than the native B7-H2 binds to native CTLA-4, as measured by well-known assays/techniques.
  • a B7-H2 derivative binds to a native CTLA-4 with 25%, 50%, 75%, 80%, 85%, 90%, 95%, or 98% or 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, or 75% to 95% lower affinity than the native B7-H2 binds to the native CTLA- 4, as measured by well-known assays/techniques.
  • a B7-H2 derivative binds to a native CTLA-4 with 0.5 logs, 1 log, 1.5 logs, 2 logs, 2.5 logs, or 3 logs lower affinity than the native B7-H2 binds to the native CTLA-4, as measured by well-known assays/techniques.
  • a B7-H2 derivative modulates one or more of the signal transduction pathways induced by B7-H2 binding to CD28 and CTLA-4. In some embodiments, a B7-H2 derivative activates or enhances one or more of the signal transduction pathways induced by the binding of B7-H2 to CD28 and CTLA-4.
  • a B7-H2 derivative activates or enhances one or more of the signal transduction pathways induced by the binding of B7-H2 to CD28 and CTLA-4 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H2 to CD28 and CTLA-4 in the absence of the derivative.
  • a B7-H2 derivative (i) activates or enhances one or more of the signal transduction pathways induced by the binding of B7-H2 to CD28 and CTLA-4 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H2 to CD28 and CTLA-4 in the absence of the derivative; and (ii) does not activate or enhance, or activates or enhances one or more of the signal transduction pathways induced by the binding of B7-H2 to ICOS by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 2% to 5%, 2% to 10%, 5% to 10%, 5% to 15%, 5% to 20%, 10% to 15%, or 15% to 20% relative to the one or
  • a B7-H2 derivative inhibits or reduces one or more of the signal transduction pathways induced by the binding of B7-H2 to CD28 and CTLA-4.
  • a B7-H2 derivative inhibits or reduces one or more of the signal transduction pathways induced by the binding of B7-H2 to CD28 and CTLA-4 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H2 to CD28 and CTLA-4 in the absence of the derivative.
  • a B7-H2 derivative (i) inhibits or reduces one or more of the signal transduction pathways induced by the binding of B7-H2 to CD28 and CTLA-4 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, or 98%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 98% relative to the one or more signal transduction pathways induced by the binding of B7-H2 to CD28 and CTLA-4 in the absence of the derivative; and (ii) does not inhibit or reduce, or inhibits or reduces one or more of the signal transduction pathways induced by the binding of B7-H2 to ICOS by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 2% to 5%, 2% to 10%, 5% to 10%, 5% to 15%, 5% to 20%, 10% to 15%, or 15% to 20% relative to the one or more
  • a B7-H2 derivative modulates the interactions between B7-H2 and CD28 and B7-H2 and CTLA-4 interactions.
  • a B7-H2 derivative inhibits or reduces the binding of B7-H2 to CD28 and CTLA-4 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the binding of B7-H2 to CD28 and CTLA-4 in the absence of the derivative.
  • a B7-H2 derivative (i) inhibits or reduces the binding of B7-H2 to CD28 and CTLA-4 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the binding of B7-H2 to CD28 and CTLA-4 in the absence of the derivative, and (ii) does not inhibit or reduce or inhibits or reduces the binding of B7- H2 to ICOS by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 2% to 5%, 2% to 10%, 5% to 10%, 5% to 15%, 5% to 20%, 10% to 15%, or 15% to 20% relative to the binding of B7-H2 to ICOS in the absence of the derivative.
  • a B7-H2 derivative modulates one or more of the signal transduction pathways induced by B7-H2 binding to ICOS and CD28.
  • a B7-H2 derivative activates or enhances one or more of the signal transduction pathways induced by the binding of B7-H2 to ICOS and CD28.
  • a B7-H2 derivative activates or enhances one or more of the signal transduction pathways induced by the binding of B7-H2 to ICOS and CD28 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H2 to ICOS and CD28 in the absence of the B7-H2 derivative.
  • a B7-H2 derivative (i) activates or enhances one or more of the signal transduction pathways induced by the binding of B7-H2 to ICOS and CD28 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H2 to ICOS and CD28 in the absence of the B7-H2 derivative; and (ii) does not activate or enhance, or activates or enhances one or more of the signal transduction pathways induced by the binding of B7-H2 to CTLA-4 by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 2% to 5%, 2% to 10%, 5% to 10%, 5% to 15%, 5% to 20%, 10% to 15%, or 15% to 20%
  • a B7-H2 derivative induces one or more of the signal transduction pathways induced by the binding of B7-H2 to ICOS and CD28.
  • a B7-H2 derivative induces one or more of the signal transduction pathways induced by the binding of B7-H2 to ICOS and CD28 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H2 to ICOS and CD28 in the absence of the B7-H2 derivative.
  • a B7-H2 derivative (i) induces one or more of the signal transduction pathways induced by the binding of B7-H2 to ICOS and CD28 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H2 to ICOS and CD28 in the absence of the B7-H2 derivative; and (ii) does not induce, or induces one or more of the signal transduction pathways induced by the binding of B7-H2 to CD28 by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 2% to 5%, 2% to 10%, 5% to 10%, 5% to 15%, 5% to 20%, 10% to 15%, or 15% to 20% relative to the one or more signal transduction
  • a B7-H2 derivative inhibits or reduces one or more of the signal transduction pathways induced by the binding of B7-H2 to ICOS and CD28.
  • a B7-H2 derivative inhibits or reduces one or more of the signal transduction pathways induced by the binding of B7-H2 to ICOS and CD28 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H2 to ICOS and CD28 in the absence of the B7-H2 derivative.
  • a B7-H2 derivative (i) inhibits or reduces one or more of the signal transduction pathways induced by the binding of B7-H2 to ICOS and CD28 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H2 to ICOS and CD28 in the absence of the B7-H2 derivative; and (ii) does not inhibit or reduce, or inhibits or reduces one or more of the signal transduction pathways induced by the binding of B7-H2 to CTLA-4 by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 2% to 5%, 2% to 10%, 5% to 10%, 5% to 15%, 5% to 20%, 10% to 15%, or 15% to 20%
  • a B7-H2 derivative modulates the interactions between B7-H2 and ICOS and B7-H2 and CD28.
  • a B7-H2 derivative inhibits or reduces the binding of B7-H2 to ICOS and CD28 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the binding of B7- H2 to ICOS and CTLA-4 in the absence of the B7-H2 derivative.
  • a B7-H2 derivative (i) inhibits or reduces the binding of B7-H2 to ICOS and CD28 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the binding of B7-H2 to ICOS and CD28 in the absence of the B7-H2 derivative, and (ii) does not inhibit or reduce, or inhibits or reduces the binding of B7-H2 to CTLA-4 by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 2% to 5%, 2% to 10%, 5% to 10%, 5% to 15%, 5% to 20%, 10% to 15%, or 15% to 20% relative to the binding of B7- H2 to CTLA-4 in the absence of the B7-H2 derivative.
  • a B7-H2 derivative modulates one or more of the signal transduction pathways induced by B7-H2 binding to ICOS and CTLA-4. In some embodiments, a B7-H2 derivative activates or enhances one or more of the signal transduction pathways induced by the binding of B7-H2 to ICOS and CTLA-4.
  • a B7-H2 derivative activates or enhances one or more of the signal transduction pathways induced by the binding of B7-H2 to ICOS and CTLA-4 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H2 to ICOS and CTLA-4 in the absence of the B7-H2 derivative.
  • a B7- H2 derivative (i) activates or enhances one or more of the signal transduction pathways induced by the binding of B7-H2 to ICOS and CTLA-4 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H2 to ICOS and CTLA-4 in the absence of the B7-H2 derivative; and (ii) does not activate or enhance, or activates or enhances one or more of the signal transduction pathways induced by the binding of B7-H2 to CD28 by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 2% to 5%, 2% to 10%, 5% to 10%, 5% to 15%, 5% to 20%, 10% to 15%, or 15% to
  • a B7-H2 derivative induces one or more of the signal transduction pathways induced by the binding of B7-H2 to ICOS and CTLA-4.
  • a B7-H2 derivative induces one or more of the signal transduction pathways induced by the binding of B7-H2 to ICOS and CTLA-4 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H2 to ICOS and CTLA-4 in the absence of the B7-H2 derivative.
  • a B7-H2 derivative (i) induces one or more of the signal transduction pathways induced by the binding of B7-H2 to ICOS and CTLA-4 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H2 to ICOS and CTLA-4 in the absence of the B7-H2 derivative; and (ii) does not induce, or induces one or more of the signal transduction pathways induced by the binding of B7-H2 to CD28 by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 2% to 5%, 2% to 10%, 5% to 10%, 5% to 15%, 5% to 20%, 10% to 15%, or 15% to 20% relative to the one or more signal
  • a B7-H2 derivative inhibits or reduces one or more of the signal transduction pathways induced by the binding of B7-H2 to ICOS and CTLA-4.
  • a B7-H2 derivative inhibits or reduces one or more of the signal transduction pathways induced by the binding of B7-H2 to ICOS and CTLA-4 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H2 to ICOS and CTLA-4 in the absence of the B7-H2 derivative.
  • a B7- H2 derivative (i) inhibits or reduces one or more of the signal transduction pathways induced by the binding of B7-H2 to ICOS and CTLA-4 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the one or more signal transduction pathways induced by the binding of B7-H2 to ICOS and CTLA-4 in the absence of the B7-H2 derivative; and (ii) does not inhibit or reduce, or inhibits or reduces one or more of the signal transduction pathways induced by the binding of B7-H2 to CD28 by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 2% to 5%, 2% to 10%, 5% to 10%, 5% to 15%, 5% to 20%, 10% to 15%, or 15% to
  • a B7-H2 derivative modulates the interactions between B7-H2 and ICOS and B7-H2 and CTLA-4.
  • a B7-H2 derivative inhibits or reduces the binding of B7-H2 to ICOS and CTLA-4 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the binding of B7-H2 to ICOS and CTLA-4 in the absence of the B7-H2 derivative.
  • a B7-H2 derivative (i) inhibits or reduces the binding of B7-H2 to ICOS and CTLA-4 by at least 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, 75% to 95%, or 75% to 100% relative to the binding of B7-H2 to ICOS and CTLA-4 in the absence of the B7-H2 derivative, and (ii) does not inhibit or reduce, or inhibits or reduces the binding of B7-H2 to CD28 by less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 2% to 5%, 2% to 10%, 5% to 10%, 5% to 15%, 5% to 20%, 10% to 15%, or 15% to 20% relative to the binding of B7-H2 to CD28 in the absence of the B7-H2 derivative.
  • a B7-H2 derivative is: (a) a polypeptide that is at least 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 99% or is 40% to 65%, 50% to 90%, 65% to 90%, 70% to 90%, 75% to 95%, 80% to 95%, or 85% to 99% identical to a native B7-H2 polypeptide; (b) a polypeptide encoded by a nucleic acid sequence that is at least 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 99% or is 40% to 65%, 50% to 90%, 65% to 90%, 70% to 90%, 75% to 95%, 80% to 95%, or 85% to 99% identical a nucleic acid sequence encoding a native B7-H2 polypeptide; (c) a polypeptide that contains 1, 2, 3, 4, 5,
  • a B7-H2 derivative is a derivative of a native human B7-H2 polypeptide.
  • a B7-H2 derivative is a derivative of an immature or precursor form of naturally occurring human B7-H2 polypeptide.
  • a B7-H2 derivative is a derivative of a mature form of naturally occurring human B7-H2 polypeptide.
  • a B7-H2 derivative is isolated or purified.
  • a B7-H2 derivative comprises (or consists) of the amino acid sequence ofnative B7-H2 with 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20 or more, or in the range of 1 to 5, 1 to 10, 2 to 15, 5 to 20, 5 to 30, 10 to 50, 25 to 75 mutations (e.g., amino acid substitutions, insertions and/or deletions).
  • mutations e.g., amino acid substitutions, insertions and/or deletions.
  • a B7-H2 derivative comprises one or more mutations that increase the affinity of B7-H2 for one or more of the following receptors: ICOS, CD28 or CTLA-4.
  • a B7-H2 derivative comprises one or more mutations that selectively increase the affinity of B7-H2 for ICOS.
  • a B7-H2 derivative comprises one or more mutations that selectively increase the affinity of B7-H2 for CD28.
  • a B7-H2 derivative comprises one or more mutations that selectively increase the affinity of B7-H2 for CTLA-4.
  • Mutations can be introduced at specific positions with native B7-H2 using, e.g., site-directed mutagenesis techniques and/or PCR-mediated mutagenesis techniques. Mutations can also be introduced randomly along all or part of the coding sequence using, e.g., saturation mutagenesis techniques.
  • a B7-H2 derivative comprises one or more mutations that decrease the affinity of B7-H2 for one or more of the following receptors: ICOS, CD28, or CTLA-4.
  • a B7-H2 derivative comprises one or more mutations that selectively decrease the affinity of B7-H2 for ICOS.
  • a B7-H2 derivative comprises one or more mutations that selectively decrease the affinity of B7-H2 for CD28.
  • a B7-H2 derivative comprises one or more mutations that selectively decrease the affinity of B7-H2 for CTLA-4.
  • a B7-H2 derivative comprises (or consists) of the amino acid sequence ofnative B7-H2 with 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20 or more, or in the range of 1 to 5, 1 to 10, 2 to 15, 5 to 20, 5 to 30, 10 to 50, or 25 to 75 amino acid substitutions.
  • amino acid substitutions can be either conservative, non- conservative, or a combination of both.
  • the amino acid substitutions are conservative amino acid substitutions, and in certain embodiments, introduced at one or more predicted non-essential amino acid residues.
  • a conservative amino acid substitution is one in which the amino acid residue is replaced with an amino acid residue having a side chain with a similar charge.
  • a B7-H2 derivative comprises an amino acid substitution at either position 116, position 122 or both. In some embodiments, a B7-H2 derivative comprises an amino acid substitution at positions 116 to 122 and/or 53. In accordance with such embodiments, the B7-H2 derivative retains the ability to bind to ICOS but does not bind to CD28 or CTLA-4. In other embodiments, a B7-H2 derivative does not comprise an amino acid substitution at either position 116, position 122 or both. In some embodiments, a B7-H2 derivative does not comprise an amino acid substitution at positions 116 to 122 and/or 53.
  • the B7-H2 derivative is the B7-H2 (Ll 16A) mutant or B7-H2 (F 122A) mutant described in Examples 6 and 7, infra. In certain embodiments, the B7-H2 derivative is not the B7-H2 (Ll 16A) mutant or B7-H2 (F122A) mutant described in
  • a B7-H2 derivative comprises an amino acid substitution at either position 51, position 53 or both. In other embodiments, a B7-H2 derivative does not comprise an amino acid substitution at either position 51, position 53 or both.
  • the B7-H2 derivative is the B7-H2 (Y51A) mutant or B7-H2 (Y53A) mutant described in Examples 6 and 7, infra. In certain embodiments, the B7-H2 derivative is not the B7-H2 (Y51A) mutant or B7-H2 (Y53A) mutant described in Examples 6 and 7, infra
  • a B7-H2 derivative comprises an amino acid substitution at two, three or all of the following positions: position 51, position 53, position 116, or position 122. In other embodiments, a B7-H2 derivative does not comprise an amino acid substitution at two, three or all of the following positions: position 51, position 53, position 116, or position 122. In certain embodiments, a B7-H2 derivative comprises an amino acid substitution at one, two, or three or all of positions: 51, 53, and 116 to 122. In other embodiments, a B7-H2 derivative does not comprise an amino acid substitution at one, two, or three or all of positions: 51, 53, and 116 to 122.
  • a B7-H2 derivative comprises 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 15, 20 or more, or 2 to 5, 2 to 10, 5 to 10, 5 to 15, 5 to 20, 10 to 15, or 15 to 20 mutations (e.g., amino acid substitutions, deletions, and/or additions) in the Ig-like V-type domain of B7-H2.
  • a B7-H2 derivative comprises (or consists of) native B7-H2 or a fragment thereof containing 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 15, 20 or more, or 2 to 5, 2 to 10, 5 to 10, 5 to 15, 5 to 20, 10 to 15, or 15 to 20 mutations (e.g., amino acid substitutions, deletions, and/or additions) in the Ig-like V-type domain.
  • a B7-H2 derivative comprises (or consists of) the extracellular domain of native B7-H2 containing 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 15, 20 or more mutations (e.g., amino acid substitutions, deletions, and/or additions) in the Ig-like V-type domain.
  • a B7-H2 derivative comprises a fragment of native B7- H2.
  • a B7-H72 derivative comprises (or consists of) amino acid residues 19 to 300, 19 to 300, 19 to 275, 19 to 256, 19 to 250, 19 to 225, 19 to 200, 19 to 175, 19 to 150, 19 to 129, 19 to 125, 19 to 100, 19 to 95, 19 to 75, 19 to 70, 19 to 65, 19 to 60, 19 to 50, 15 to 30 or 5 to 25, or 141 to 227 of native B7-H2 of the sequence found at Accession No. 075144-1 (UniParc).
  • a B7-H2 derivative is a soluble form of B7-H2.
  • a B7-H2 derivative comprises (or consists of) the extracellular domain of native B7-H2, or the extracellular domain of native B7-H2 containing 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 15, 20 or more, or 2 to 5, 2 to 10, 5 to 10, 5 to 15, 5 to 20, 10 to 15, or 15 to 20 mutations (e.g., amino acid substitutions, deletions, and/or additions).
  • a B7- H2 derivative comprises (or consists of) amino acid residues 19 to 256 of the sequence found at Accession No. 075144-1 (UniParc).
  • a B7-H2 derivative comprises (or consists of) a fragment of the extracellular domain of native B7-H2, or a fragment of the extracellular domain of native B7-H2 containing 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 15, 20 or more, or 2 to 5, 2 to 10, 5 to 10, 5 to 15, 5 to 20, 10 to 15, or 15 to 20 mutations (e.g., amino acid substitutions, deletions, and/or additions).
  • a B7- H2 derivative comprises (or consists of) at least 25, 50, 75, 100, 125, 150, 175, 200, 225, or 240 amino acids of the extracellular domain of native B7-H2.
  • a B7- H2 derivative comprises (or consists of) amino acid residues 19 to 240, 19 to 225, 19 to 200, 19 to 175, 19to 150, 19 to 125, 19 to 100, 19 to 75, 19 to 50, or 19 to 25 of native B7-H2.
  • a B7-H2 derivative comprises (or consists of) amino acid residues 19 to 240, 19 to 225, 19 to 200, 19 to 175, 19 to 150, 19 to 125, 19 to 100, 19 to 75, 19 to 50, or
  • a B7-H2 derivative comprises (or consists of) the Ig-like V-type domain of native B7-H2.
  • a B7-H2 derivative comprises (or consists of) amino acid residues 19 to 129 of the sequence found at Accession No. 075144-1 (UniParc).
  • a B7-H2 derivative comprises (or consists of) the Ig-like C-2 type domain of native B7-H2.
  • a B7-H2 derivative comprises (or consists of) amino acid residues 141 to 227 of the sequence found at Accession No.
  • a B7-H2 derivative comprises (or consists of) the Ig-like V-type and Ig-like C-2 type domains of native B7-H7.
  • a B7-H2 derivative comprises (or consists of) amino acid residues 19 to 141 of the sequence found at Accession No. 075144-1 (UniParc).
  • a B7-H2 derivative comprises (or consists of) the extracellular and cytoplasmic domains of native B7-H2 or fragments thereof.
  • a B7-H2 derivative comprises (or consists of) the extracellular and cytoplasmic domains of native B7-H2 or fragments thereof containing 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 15,
  • a B7-H2 derivative comprises (or consists) a fragment of the extracellular domain of native B7-H2 and the cytoplasmic domain of native B7-H2 or a fragment thereof.
  • a B7-H2 derivative comprises (or consists of) the extracellular domain of native B7-H2 and a fragment of the cytoplasmic domain of native B7-H2.
  • a B7-H2 derivative lacks the transmembrane domain of native B7-H2 or a fragment thereof.
  • a B7-H2 derivative comprises a heterologous transmembrane domain in place of the transmembrane domain of native B7-H2.
  • a B7-H2 derivative comprises (or consists of) the extracellular domain of native B7-H2 or a fragment thereof and the transmembrane domain of native B7-H2 or a fragment thereof.
  • a B7-H2 derivative comprises (or consists of) the IgV region of native human B7-H2.
  • a B7-H2 derivative comprises (or consists of) the human IgV region described in Example 7, infra.
  • a B7-H2 derivative comprises (or consists of) the cysteine-cysteine region of native B7-H2.
  • B7-H2 derivatives can be assessed using techniques known to those skilled in the art, or described herein.
  • the ability of a B7-H2 derivative to bind to one or more receptors may be assessed using techniques described herein, or known to those skilled in the art. More specifically, the ability of a B7-H2 derivative to bind to one or more of the following receptors - ICOS, CD28 or CTLA-4 - may be assessed.
  • the ability of a B7-H2 derivative to bind to one or more receptors and induce one or more of the signal transduction pathways induced by native B7-H2 binding to the one or more receptors may be assessed using techniques described herein, or known to those skilled in the art.
  • a B7-H2 derivative to bind to one or more of the following receptors - ICOS, CD28 or CTLA-4 - and induce one or more of the signal transduction pathways induced by native B7-H2 binding to native ICOS, native CD28, native CTLA-4 may be assessed.
  • a B7-H2 derivative retains at least 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 25% to 98%, 50% to 75%, or 75% to 100% of the function of a native B7-H2 polypeptide to bind to a native receptor of B7-H2 (e.g. , ICOS, CD28 or CTLA-4), as measured by assays/techniques well known in the art, e.g., ELISA, Biacore, or co-immunoprecipitation.
  • B7-H2 e.g., ICOS, CD28 or CTLA-4
  • a B7-H2 derivative retains at least 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 25% to 98%, 50% to 75%, or 75% to 100% of the function of a native B7-H2 polypeptide to bind to ICOS.
  • a B7-H2 derivative retains at least 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 25% to 98%, 50% to 75%, or 75% to 100% of the function of a native B7-H2 polypeptide to bind to either CD28, CTLA-4 or both.
  • a B7-H2 derivative retains at least 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 25% to 98%, 50% to 75%, or 75% to 100% of the function of a native B7-H2 polypeptide to bind to either CD28, ICOS or both.
  • a B7-H2 derivative retains at least 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 25% to 98%, 50% to 75%, or 75% to 100% of the function of a native B7-H2 polypeptide to bind to either ICOS, CTLA-4, or both.
  • a B7-H2 derivative retains at least 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 25% to 98%, 50% to 75%, or 75% to 100% of the function of a native B7-H2 polypeptide to bind to CD28, ICOS and CTLA-4.
  • a B7-H2 derivative retains at least 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 25% to 98%, 50% to 75%, or 75% to 100% of the function of a native B7-H2 polypeptide to bind to ICOS, but the B7-H2 derivative does not retain the function of a native B7-H2 polypeptide to bind to either CD28, CTLA-4 or both, or retains less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 2% to 20%, 2% to 15%, 2% to 10% or 2% to 5% of the function of a native B7-H2 polypeptide to bind to either CD28, CTLA-4 or both.
  • a B7- H2 derivative retains at least 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 25% to 98%, 50% to 75%, or 75% to 100% of the function of a native B7-H2 polypeptide to bind to CD28, but the B7-H2 derivative does not retain the function of a native B7-H2 polypeptide to bind to either ICOS, CTLA-4 or both, or retains less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 2% to 20%, 2% to 15%, 2% to 10% or 2% to 5% of the function of a native B7-H2 polypeptide to bind to either ICOS, CTLA-4 or both.
  • a B7-H2 derivative retains at least 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 25% to 98%, 50% to 75%, or 75% to 100% of the function of a native B7-H2 polypeptide to bind to CD28 and CTLA-4, but the B7-H2 derivative does not retain the function of a native B7-H2 polypeptide to bind to ICOS, or retains less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 2% to 20%, 2% to 15%, 2% to 10% or 2% to 5% of the function of a native B7-H2 polypeptide to bind to ICOS.
  • a B7-H2 derivative retains at least 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 25% to 98%, 50% to 75%, or 75% to 100% of the function of a native B7-H2 polypeptide to bind to CD28 and ICOS, but the B7-H2 derivative does not retain the function of a native B7-H2 polypeptide to bind to CTLA-4, or retains less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 2% to 20%, 2% to 15%, 2% to 10% or 2% to 5% of the function of a native mammalian B7-H2 polypeptide to bind to CTLA-4.
  • a B7-H2 derivative retains at least 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 25% to 98%, 50% to 75%, or 75% to 100% of the function of native B7-H2 polypeptide to bind to ICOS and CTLA-4, but the B7-H2 derivative does not retain the function of a native B7-H2 polypeptide to bind to CD28, or retains less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 2% to 20%, 2% to 15%, 2% to 10% or 2% to 5% of the function of a native mammalian B7-H2 polypeptide to bind to CD28.
  • a B7-H2 derivative retains less than 20%, 15%, 10%, 5% or 2%, or in the range of between 2% to 20%, 2% to 15%, 2% to 10%, or 2% to 5% of the function of a native B7-H2 polypeptide to bind to a native receptor of B7-H2 (e.g., ICOS, CD28 or CTLA-4), as measured by assays/techniques well known in the art, e.g., ELISA, Biacore, or co-immunoprecipitation.
  • B7-H2 e.g., ICOS, CD28 or CTLA-4
  • a B7-H2 derivative retains less than 20%, 15%, 10%, 5% or 2%, or in the range of between 2% to 20%, 2% to 15%, 2% to 10%, or 2% to 5% of the function of a native B7-H2 polypeptide to bind to ICOS. In another specific embodiment, a B7-H2 derivative retains less than 20%, 15%, 10%, 5% or 2%, or in the range of between 2% to 20%, 2% to 15%, 2% to 10%, or 2% to 5% of the function of a native B7-H2 polypeptide to bind to either CD28, CTLA-4 or both.
  • a B7-H2 derivative retains less than 20%, 15%, 10%, 5% or 2%, or in the range of between 2% to 20%, 2% to 15%, 2% to 10%, or 2% to 5% of the function of a native B7-H2 polypeptide to bind to either CD28, ICOS or both.
  • a B7-H2 derivative retains less than 20%, 15%, 10%, 5%, or 2%, or in the range of between 2% to 20%, 2% to 15%, 2% to 10% or 2% to 5% of the function of a native mammalian B7-H2 polypeptide to bind to ICOS and CTLA-4.
  • a B7-H2 derivative retains less than 20%, 15%, 10%, 5% or 2%, or in the range of between 2% to 20%, 2% to 15%, 2% to 10%, or 2% to 5% of the function of a native B7- H2 polypeptide to bind to CD28, ICOS and CTLA-4.
  • a B7-H2 derivative with a higher affinity for a native receptor of B7-H2 than native B7-H2 binds to the same receptor, as measured by well-known assays/techniques.
  • a B7-H2 derivative with a 25%, 50%, 75%, 80%, 85%, 90%, 95%, 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, or 75% to 95% higher affinity for a native receptor of B7-H2 than the native B7-H2 binds to the same receptor, as measured by well-known assays/techniques.
  • a B7-H2 derivative with a lower affinity for a native receptor of B7-H2 than native B7-H2 binds to the same receptor, as measured by well-known assays/techniques.
  • a B7-H2 derivative with a 25%, 50%, 75%, 80%, 85%, 90%, 95%, 25% to 50%, 25% to 75%, 50% to 75%, 50% to 95%, or 75% to 95% lower affinity for a native receptor of B7-H2 than the native B7-H2 binds to the same receptor, as measured by well-known assays/techniques.
  • a B7-H2 derivative retains at least 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 25% to 98%, 50% to 75%, or 75% to 100% of the ability to activate or induce one or more of the signal transduction pathways induced when a native B7-H2 polypeptide binds to a native receptor of B7-H2 (e.g., ICOS, CD28 or CTLA- 4), as measured by assays well-known in the art.
  • B7-H2 e.g., ICOS, CD28 or CTLA- 4
  • the one or more signal transduction pathways induced by the binding of a native receptor of B7-H2 to a B7-H2 polypeptide can be measured by, e.g., assessing the activation of a signal transduction moiety (e.g., Jun kinase activation, MAP kinase activation, PKC activation), the translocation of a transcription factor (e.g., NF-kappa B or Statl), and cytokine production (e.g., IL-2, IL-4, IL-5, IL-10, IL- 17, interferon-gamma, or tumor necrosis factor-alpha) using techniques such as ELISAs, Western blots, electromobility shift assays, and other immunoassays.
  • a signal transduction moiety e.g., Jun kinase activation, MAP kinase activation, PKC activation
  • a transcription factor e.g., NF-kappa B or Stat
  • a B7-H2 derivative retains at least 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 25% to 98%, 50% to 75%, or 75% to 100% of the ability to activate or induce one or more of the signal transduction pathways induced by the binding of a native B7-H2 polypeptide to ICOS.
  • a B7- H2 derivative retains at least 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 25% to 98%, 50% to 75%, or 75% to 100% of the ability to activate or induce one or more of the signal transduction pathways induced by the binding of a native B7-H2 polypeptide to CD28.
  • a B7-H2 derivative retains at least 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99%, or in the range of between 25% to 50%, 25% to 75%, 25% to 98%, 50% to 75%, or 75% to 100% of the ability to activate or induce one or more of the signal transduction pathways induced by the binding of a native B7-H2 polypeptide to CTLA-4.
  • a B7-H2 derivative retains less than 20%, 15%, 10%, 5% or 2%, or in the range of between 2% to 20%, 2% to 15%, 2% to 10%, or 2% to 5% of one or more of the ability to activate or induce the signal transduction pathways induced when a native B7-H2 polypeptide binds to a receptor of B7-H2 (e.g., ICOS, CD28 or CTLA- 4), as measured by assays well-known in the art.
  • B7-H2 e.g., ICOS, CD28 or CTLA- 4
  • a B7-H2 derivative retains less than 20%, 15%, 10%, 5% or 2%, or in the range of between 2% to 20%, 2% to 15%, 2% to 10%, or 2% to 5% of the ability to active or induce one or more of the signal transduction pathways induced by the binding of a native B7-H2 polypeptide to ICOS.
  • a B7-H2 derivative retains less than 20%, 15%, 10%, 5% or 2%, or in the range of between 2% to 20%, 2% to 15%, 2% to 10%, or 2% to 5% of one or more of the signal transduction pathways induced by the binding of a native B7-H2 polypeptide to either CD28, CTLA-4 or both.
  • a B7-H2 derivative retains less than 20%, 15%, 10%, 5% or 2%, or in the range of between 2% to 20%, 2% to 15%, 2% to 10%, or 2% to 5% of the ability to activate or induce one or more of the signal transduction pathways induced by the binding of a native B7-H2 polypeptide to either CD28, ICOS or both.
  • a B7-H2 derivative retains less than 20%, 15%, 10%, 5% or 2%, or in the range of between 2% to 20%, 2% to 15%, 2% to 10%, or 2% to 5% of the ability to activate or induce one or more of the signal transduction pathways induced by the binding of a native B7-H2 polypeptide to ICOS and CTLA-4.
  • a B7-H2 derivative retains less than 20%, 15%, 10%, 5% or 2%, or in the range of between 2% to 20%, 2% to 15%, 2% to 10%, or 2% to 5% of the ability to activate or induce one or more of the signal transduction pathways induced by the binding of a native B7-H2 polypeptide to CD28, ICOS, and CTLA-4.
  • a Therapeutic Agent is an ICOS polypeptide.
  • such a Therapeutic Agent modulates one or more of the signal transduction pathways induced by B7-H2 binding to ICOS.
  • such a Therapeutic Agent modulates the B7-H2 polypeptide and ICOS polypeptide interaction.
  • such Therapeutic Agents are Immunostimulatory Therapeutic Agents.
  • such Therapeutic Agents are Inhibitory Therapeutic Agents.
  • a Therapeutic Agent is an ICOS derivative.
  • the B7-H2 derivative is an Immunostimulating Therapeutic Agent.
  • the B7-H2 derivative is an Inhibitory Therapeutic Agent.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Immunology (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Engineering & Computer Science (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Molecular Biology (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Biochemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Cell Biology (AREA)
  • Toxicology (AREA)
  • Zoology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Epidemiology (AREA)
  • Biomedical Technology (AREA)
  • Mycology (AREA)
  • Endocrinology (AREA)
  • Radiology & Medical Imaging (AREA)
  • Pathology (AREA)
  • Microbiology (AREA)
  • Rheumatology (AREA)
  • Transplantation (AREA)
  • Pulmonology (AREA)
  • Pain & Pain Management (AREA)
  • Communicable Diseases (AREA)
  • Oncology (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
PCT/US2010/045479 2009-08-13 2010-08-13 Methods of modulating immune function Ceased WO2011020024A2 (en)

Priority Applications (9)

Application Number Priority Date Filing Date Title
AU2010282340A AU2010282340B2 (en) 2009-08-13 2010-08-13 Methods of modulating immune function
EP18151970.3A EP3381937A3 (en) 2009-08-13 2010-08-13 Methods of modulating immune function
CA2769822A CA2769822C (en) 2009-08-13 2010-08-13 Methods of modulating immune function
US13/390,054 US8840889B2 (en) 2009-08-13 2010-08-13 Methods of modulating immune function
EP10744821.9A EP2464661B1 (en) 2009-08-13 2010-08-13 Methods of modulating immune function with anti-b7-h7cr antibodies
ES10744821.9T ES2666152T3 (es) 2009-08-13 2010-08-13 Métodos de modulación de la función inmunitaria con anticuerpos anti-B7-H7CR
JP2012524903A JP5883384B2 (ja) 2009-08-13 2010-08-13 免疫機能を調節する方法
US14/456,457 US9676856B2 (en) 2009-08-13 2014-08-11 Methods of modulating immune function
US14/456,501 US20160002336A1 (en) 2009-08-13 2014-12-22 Methods of Modulating Immune Function

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US23365009P 2009-08-13 2009-08-13
US61/233,650 2009-08-13
US28995109P 2009-12-23 2009-12-23
US61/289,951 2009-12-23

Related Child Applications (3)

Application Number Title Priority Date Filing Date
US13/390,054 A-371-Of-International US8840889B2 (en) 2009-08-13 2010-08-13 Methods of modulating immune function
US14/456,457 Division US9676856B2 (en) 2009-08-13 2014-08-11 Methods of modulating immune function
US14/456,501 Continuation US20160002336A1 (en) 2009-08-13 2014-12-22 Methods of Modulating Immune Function

Publications (2)

Publication Number Publication Date
WO2011020024A2 true WO2011020024A2 (en) 2011-02-17
WO2011020024A3 WO2011020024A3 (en) 2011-06-23

Family

ID=43297014

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2010/045479 Ceased WO2011020024A2 (en) 2009-08-13 2010-08-13 Methods of modulating immune function

Country Status (7)

Country Link
US (3) US8840889B2 (enExample)
EP (2) EP3381937A3 (enExample)
JP (1) JP5883384B2 (enExample)
AU (2) AU2010282340B2 (enExample)
CA (1) CA2769822C (enExample)
ES (1) ES2666152T3 (enExample)
WO (1) WO2011020024A2 (enExample)

Cited By (43)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2014100823A1 (en) 2012-12-21 2014-06-26 Amplimmune, Inc. Anti-h7cr antibodies
WO2014190356A2 (en) 2013-05-24 2014-11-27 Amplimmune, Inc. Anti-b7-h5 antibodies and their uses
WO2015167948A1 (en) * 2014-04-30 2015-11-05 Albert Einstein College Of Medicine Of Yeshiva University Tmigd2 and its derivatives as blockers or binders of cancer-expressed hhla2 for immunotherapies
US20160002337A1 (en) * 2013-03-01 2016-01-07 Albert Einstein College Of Medicine Of Yeshiva University Hhla2 as a novel inhibitor of human immune system and uses thereof
TWI556194B (zh) * 2012-06-29 2016-11-01 希科母股份有限公司 對象檢出裝置、對象檢出方法及對象檢出用電腦程式
WO2016168771A3 (en) * 2015-04-17 2016-12-01 Alpine Immune Sciences, Inc. Immunomodulatory proteins with tunable affinities
EP3152222A4 (en) * 2014-06-04 2017-11-01 NGM Biopharmaceuticals, Inc. Compositions and methods for targeting a pathway
WO2017220989A1 (en) 2016-06-20 2017-12-28 Kymab Limited Anti-pd-l1 and il-2 cytokines
CN107530428A (zh) * 2015-03-23 2018-01-02 震动疗法股份有限公司 Icos的抗体
WO2018029474A2 (en) 2016-08-09 2018-02-15 Kymab Limited Anti-icos antibodies
US9957323B2 (en) 2016-06-20 2018-05-01 Kymab Limited Anti-ICOS antibodies
US10144779B2 (en) 2015-05-29 2018-12-04 Agenus Inc. Anti-CTLA-4 antibodies and methods of use thereof
WO2019079520A3 (en) * 2017-10-18 2019-05-23 Alpine Immune Sciences, Inc. Variant icos ligand immunomodulatory proteins and related compositions and methods
WO2019122884A1 (en) 2017-12-19 2019-06-27 Kymab Limited Antibodies to icos
WO2020041300A1 (en) * 2018-08-21 2020-02-27 Ngm Biopharmaceuticals, Inc. B7-h7-binding agents and methods of use thereof
US10882914B2 (en) 2016-04-15 2021-01-05 Alpine Immune Sciences, Inc. ICOS ligand variant immunomodulatory proteins and uses thereof
US10912831B1 (en) 2016-12-07 2021-02-09 Agenus Inc. Anti-CTLA-4 antibodies and methods of use thereof
US10968277B2 (en) 2015-10-22 2021-04-06 Jounce Therapeutics, Inc. Gene signatures for determining ICOS expression
US11078282B2 (en) 2016-04-15 2021-08-03 Alpine Immune Sciences, Inc. CD80 variant immunomodulatory proteins and uses thereof
WO2021229032A1 (en) 2020-05-14 2021-11-18 Kymab Limited Tumour biomarkers for immunotherapy
US11230587B2 (en) 2015-05-27 2022-01-25 Università Degli Studi del Piemonte Orientale “Amedeo Avogadro” Ligands of B7H receptor in the treatment of osteopenia and osteoporosis
US11306144B2 (en) 2017-08-25 2022-04-19 Five Prime Therapeutics, Inc. B7-H4 antibodies and methods of use thereof
EP3773658A4 (en) * 2018-04-06 2022-04-27 Dana-Farber Cancer Institute, Inc. KIR3DL3 AS HLA2 RECEPTOR, ANTI-HHLA2 ANTIBODY AND ITS USES
US11440960B2 (en) 2017-06-20 2022-09-13 Kymab Limited TIGIT antibodies, encoding nucleic acids and methods of using said antibodies in vivo
US11471488B2 (en) 2016-07-28 2022-10-18 Alpine Immune Sciences, Inc. CD155 variant immunomodulatory proteins and uses thereof
WO2022243378A1 (en) 2021-05-18 2022-11-24 Kymab Limited Uses of anti-icos antibodies
WO2022254227A1 (en) 2021-06-04 2022-12-08 Kymab Limited Treatment of pd-l1 negative or low expressing cancer with anti-icos antibodies
US11629189B2 (en) 2017-12-19 2023-04-18 Kymab Limited Bispecific antibody for ICOS and PD-L1
US11732022B2 (en) 2017-03-16 2023-08-22 Alpine Immune Sciences, Inc. PD-L2 variant immunomodulatory proteins and uses thereof
US11753458B2 (en) 2017-10-10 2023-09-12 Alpine Immune Sciences, Inc. CTLA-4 variant immunomodulatory proteins and uses thereof
US11753479B2 (en) 2014-03-04 2023-09-12 Kymab Limited Nucleic acids encoding anti-OX40L antibodies
US11779604B2 (en) 2016-11-03 2023-10-10 Kymab Limited Antibodies, combinations comprising antibodies, biomarkers, uses and methods
US11834490B2 (en) 2016-07-28 2023-12-05 Alpine Immune Sciences, Inc. CD112 variant immunomodulatory proteins and uses thereof
US11858996B2 (en) 2016-08-09 2024-01-02 Kymab Limited Anti-ICOS antibodies
US11939383B2 (en) 2018-03-02 2024-03-26 Five Prime Therapeutics, Inc. B7-H4 antibodies and methods and use thereof
US12065476B2 (en) 2018-06-15 2024-08-20 Alpine Immune Sciences, Inc. PD-1 variant immunomodulatory proteins and uses thereof
US12297253B2 (en) 2018-01-03 2025-05-13 Alpine Immune Sciences, Inc. Multi-domain immunomodulatory proteins and methods of use thereof
US12435145B2 (en) 2018-02-21 2025-10-07 Five Prime Therapeutics, Inc. B7-H4 antibody formulations
US12552853B2 (en) 2018-11-30 2026-02-17 Alpine Immune Sciences, Inc. CD86 variant immunomodulatory proteins and uses thereof
US12612447B2 (en) 2020-05-08 2026-04-28 Alpine Immune Sciences, Inc. April and BAFF inhibitory immunomodulatory proteins and methods of use thereof
USRE50880E1 (en) 2015-04-30 2026-05-05 Kymab Limited Anti-human OX40L antibodies and methods of treatment
US12624087B2 (en) 2016-07-28 2026-05-12 Alpine Immune Sciences, Inc. CD155 variant immunomodulatory proteins and uses thereof
JP7863589B2 (ja) 2017-10-18 2026-05-21 アルパイン イミューン サイエンシズ インコーポレイテッド バリアントicosリガンド免疫調節タンパク質ならびに関連する組成物および方法

Families Citing this family (32)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20100266495A1 (en) * 2004-05-21 2010-10-21 Brigham Young University Anti-Cancer Activity of an Anti-Thymidine Kinase Monoclonal Antibody
US7520860B2 (en) 2005-04-13 2009-04-21 Marie G. Johnson Detection of coronary artery disease using an electronic stethoscope
EP2190469B1 (en) 2007-09-04 2015-02-25 Compugen Ltd. Polypeptides and polynucleotides, and uses thereof as a drug target for producing drugs and biologics
AU2010282340B2 (en) * 2009-08-13 2016-12-22 The Johns Hopkins University Methods of modulating immune function
WO2011146313A1 (en) 2010-05-19 2011-11-24 The University Of North Carolina At Chapel Hill Pyrazolopyrimidine compounds for the treatment of cancer
WO2013001517A1 (en) 2011-06-30 2013-01-03 Compugen Ltd. Polypeptides and uses thereof for treatment of autoimmune disorders and infection
US9273056B2 (en) 2011-10-03 2016-03-01 The University Of North Carolina At Chapel Hill Pyrrolopyrimidine compounds for the treatment of cancer
SG2014008304A (en) 2012-02-01 2014-06-27 Compugen Ltd C10rf32 antibodies, and uses thereof for treatment of cancer
US9428813B2 (en) 2012-03-26 2016-08-30 The United States Of America, As Represented By The Secretary, Dept. Of Health & Human Services DNA methylation analysis for the diagnosis, prognosis and treatment of adrenal neoplasms
HK1206338A1 (en) 2012-05-22 2016-01-08 北卡罗来纳大学教堂山分校 Pyrimidine compounds for the treatment of cancer
EP2909211A4 (en) 2012-10-17 2016-06-22 Univ North Carolina PYRAZOLOPYRIMIDINE COMPOUNDS FOR CANCER TREATMENT
WO2014085225A1 (en) 2012-11-27 2014-06-05 The University Of North Carolina At Chapel Hill Pyrimidine compounds for the treatment of cancer
US20140205609A1 (en) * 2013-01-24 2014-07-24 Fred T. Valentine Methods for inducing systemic immune responses to cancer
CN105209054A (zh) 2013-04-18 2015-12-30 阿尔莫生物科技股份有限公司 使用白细胞介素-10治疗疾病和病症的方法
US11413332B2 (en) * 2013-11-11 2022-08-16 Armo Biosciences, Inc. Methods of using interleukin-10 for treating diseases and disorders
CN106459063A (zh) 2014-04-11 2017-02-22 北卡罗来纳-查佩尔山大学 Mertk‑特异性嘧啶化合物
DK3148579T3 (da) 2014-05-28 2021-03-08 Agenus Inc Anti-gitr antistoffer og fremgangsmåder til anvendelse deraf
CN107208138A (zh) * 2014-12-30 2017-09-26 豪夫迈·罗氏有限公司 用于癌症预后和治疗的方法和组合物
MA41414A (fr) 2015-01-28 2017-12-05 Centre Nat Rech Scient Protéines de liaison agonistes d' icos
KR20170109582A (ko) * 2015-02-06 2017-09-29 히트 바이오로직스, 인코퍼레이티드 벡터 공동 발현 백신 및 공동 자극 분자
PT3282835T (pt) * 2015-04-13 2023-07-25 Univ Yale Ratinhos knockin de sirpa-il15 humanizadas e métodos de utilização dos mesmos
SG10201912984WA (en) 2015-12-02 2020-03-30 Agenus Inc Antibodies and methods of use thereof
WO2017106784A1 (en) * 2015-12-16 2017-06-22 La Jolla Institute For Allergy And Immunology Peptides and methods related to icos signaling
US10709708B2 (en) 2016-03-17 2020-07-14 The University Of North Carolina At Chapel Hill Method of treating cancer with a combination of MER tyrosine kinase inhibitor and an epidermal growth factor receptor (EGFR) inhibitor
CN106755372B (zh) * 2016-12-12 2020-03-31 青岛泱深生物医药有限公司 一种分子标志物在口腔鳞状细胞癌诊断和治疗中的应用
CN110290798B (zh) * 2017-02-27 2024-04-05 沙塔克实验室有限公司 基于vsig8的嵌合蛋白
WO2019005817A2 (en) * 2017-06-26 2019-01-03 Bio-Techne Corporation HYBRIDOMIC CLONES, MONOCLONAL ANTIBODIES DIRECTED AGAINST VSIG-4, AND METHODS OF MAKING AND USING SAME
JP7054955B2 (ja) * 2018-01-12 2022-04-15 ゲノム アンド カンパニー Kirrel2及びkirrel2抑制剤の新規用途
CN108872588B (zh) * 2018-06-14 2021-05-28 华南农业大学 一种与种公猪繁殖性能密切相关的精子蛋白标记spaca4及其应用
US12331320B2 (en) 2018-10-10 2025-06-17 The Research Foundation For The State University Of New York Genome edited cancer cell vaccines
CN113631576A (zh) * 2019-03-26 2021-11-09 四十七公司 用于治疗癌症的多特异性药剂
CN119040454B (zh) * 2024-09-27 2026-04-21 华南农业大学 Slc26a2基因作为肉鸡胫骨软骨发育不良标志物的应用

Citations (67)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4675187A (en) 1983-05-16 1987-06-23 Bristol-Myers Company BBM-1675, a new antibiotic complex
US4676980A (en) 1985-09-23 1987-06-30 The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services Target specific cross-linked heteroantibodies
EP0239400A2 (en) 1986-03-27 1987-09-30 Medical Research Council Recombinant antibodies and methods for their production
EP0307434A1 (en) 1987-03-18 1989-03-22 Medical Res Council CHANGED ANTIBODIES.
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
US4816397A (en) 1983-03-25 1989-03-28 Celltech, Limited Multichain polypeptides or proteins and processes for their production
US4889803A (en) 1984-04-27 1989-12-26 Yeda Research & Development Co., Ltd. Production of interferon gamma
EP0367166A1 (en) 1988-10-31 1990-05-09 Takeda Chemical Industries, Ltd. Modified interleukin-2 and production thereof
EP0394827A1 (en) 1989-04-26 1990-10-31 F. Hoffmann-La Roche Ag Chimaeric CD4-immunoglobulin polypeptides
US4987071A (en) 1986-12-03 1991-01-22 University Patents, Inc. RNA ribozyme polymerases, dephosphorylases, restriction endoribonucleases and methods
EP0413622A1 (en) 1989-08-03 1991-02-20 Rhone-Poulenc Sante Albumin derivatives with therapeutic functions
WO1991006570A1 (en) 1989-10-25 1991-05-16 The University Of Melbourne HYBRID Fc RECEPTOR MOLECULES
WO1991009967A1 (en) 1989-12-21 1991-07-11 Celltech Limited Humanised antibodies
US5112946A (en) 1989-07-06 1992-05-12 Repligen Corporation Modified pf4 compositions and methods of use
US5116742A (en) 1986-12-03 1992-05-26 University Patents, Inc. RNA ribozyme restriction endoribonucleases and methods
EP0519596A1 (en) 1991-05-17 1992-12-23 Merck & Co. Inc. A method for reducing the immunogenicity of antibody variable domains
US5190929A (en) 1988-05-25 1993-03-02 Research Corporation Technologies, Inc. Cyclophosphamide analogs useful as anti-tumor agents
WO1993008656A1 (de) 1991-10-24 1993-04-29 Institut für Rundfunktechnik GmbH Verfahren zum übertragen oder speichern eines aus einer folge von informationsblöcken bestehenden digitalisierten, encodierten tonsignals über störbehaftete kanäle
US5225539A (en) 1986-03-27 1993-07-06 Medical Research Council Recombinant altered antibodies and methods of making altered antibodies
WO1993015199A1 (fr) 1992-01-31 1993-08-05 Rhone-Poulenc Rorer S.A. Nouveaux polypeptides biologiquement actifs, leur preparation et composition pharmaceutique les contenant
WO1993015200A1 (fr) 1992-01-31 1993-08-05 Rhone-Poulenc Rorer S.A. Polypeptides antithrombotiques, antagonistes de la liaison du vwf aux plaquettes et/ou au sous-endothelium
WO1993017105A1 (en) 1992-02-19 1993-09-02 Scotgen Limited Altered antibodies, products and processes relating thereto
EP0592106A1 (en) 1992-09-09 1994-04-13 Immunogen Inc Resurfacing of rodent antibodies
WO1994012650A2 (en) 1992-12-03 1994-06-09 Transkaryotic Therapies, Inc. Activating expression of an amplifying endogenous gene by homologous recombination
US5336603A (en) 1987-10-02 1994-08-09 Genentech, Inc. CD4 adheson variants
US5349053A (en) 1990-06-01 1994-09-20 Protein Design Labs, Inc. Chimeric ligand/immunoglobulin molecules and their uses
US5359046A (en) 1990-12-14 1994-10-25 Cell Genesys, Inc. Chimeric chains for receptor-associated signal transduction pathways
US5447851A (en) 1992-04-02 1995-09-05 Board Of Regents, The University Of Texas System DNA encoding a chimeric polypeptide comprising the extracellular domain of TNF receptor fused to IgG, vectors, and host cells
WO1996004388A1 (en) 1994-07-29 1996-02-15 Smithkline Beecham Plc Novel compounds
US5530101A (en) 1988-12-28 1996-06-25 Protein Design Labs, Inc. Humanized immunoglobulins
WO1996022024A1 (en) 1995-01-17 1996-07-25 Brigham And Women's Hospital, Inc. Receptor specific transepithelial transport of immunogens
US5565332A (en) 1991-09-23 1996-10-15 Medical Research Council Production of chimeric antibodies - a combinatorial approach
US5605793A (en) 1994-02-17 1997-02-25 Affymax Technologies N.V. Methods for in vitro recombination
US5622929A (en) 1992-01-23 1997-04-22 Bristol-Myers Squibb Company Thioether conjugates
WO1997034631A1 (en) 1996-03-18 1997-09-25 Board Of Regents, The University Of Texas System Immunoglobin-like domains with increased half lives
US5723125A (en) 1995-12-28 1998-03-03 Tanox Biosystems, Inc. Hybrid with interferon-alpha and an immunoglobulin Fc linked through a non-immunogenic peptide
WO1998023289A1 (en) 1996-11-27 1998-06-04 The General Hospital Corporation MODULATION OF IgG BINDING TO FcRn
US5766886A (en) 1991-12-13 1998-06-16 Xoma Corporation Modified antibody variable domains
US5783181A (en) 1994-07-29 1998-07-21 Smithkline Beecham Corporation Therapeutic uses of fusion proteins between mutant IL 4/IL13 antagonists and immunoglobulins
US5807715A (en) 1984-08-27 1998-09-15 The Board Of Trustees Of The Leland Stanford Junior University Methods and transformed mammalian lymphocyte cells for producing functional antigen-binding protein including chimeric immunoglobulin
US5824307A (en) 1991-12-23 1998-10-20 Medimmune, Inc. Human-murine chimeric antibodies against respiratory syncytial virus
US5834252A (en) 1995-04-18 1998-11-10 Glaxo Group Limited End-complementary polymerase reaction
US5837458A (en) 1994-02-17 1998-11-17 Maxygen, Inc. Methods and compositions for cellular and metabolic engineering
US5844095A (en) 1991-06-27 1998-12-01 Bristol-Myers Squibb Company CTLA4 Ig fusion proteins
WO1999004813A1 (en) 1997-07-24 1999-02-04 Brigham & Women's Hospital, Inc. Receptor specific transepithelial transport of therapeutics
US6162432A (en) 1991-10-07 2000-12-19 Biogen, Inc. Method of prophylaxis or treatment of antigen presenting cell driven skin conditions using inhibitors of the CD2/LFA-3 interaction
US6277375B1 (en) 1997-03-03 2001-08-21 Board Of Regents, The University Of Texas System Immunoglobulin-like domains with increased half-lives
WO2001068882A2 (en) 2000-03-14 2001-09-20 Transkaryotic Therapies, Inc. Methods for homologous recombination
WO2001077137A1 (en) 2000-04-12 2001-10-18 Human Genome Sciences, Inc. Albumin fusion proteins
WO2002046237A2 (en) 2000-12-06 2002-06-13 Neuralab Limited Humanized antibodies that recognize beta amyloid peptide
US6407213B1 (en) 1991-06-14 2002-06-18 Genentech, Inc. Method for making humanized antibodies
US20020098189A1 (en) 2000-03-01 2002-07-25 Young James F. High potency recombinant antibodies and method for producing them
WO2002060919A2 (en) 2000-12-12 2002-08-08 Medimmune, Inc. Molecules with extended half-lives, compositions and uses thereof
WO2002069904A2 (en) 2001-03-02 2002-09-12 Medimmune, Inc. Cd2 antagonists for treatment of autoimmune or inflammatory disease
WO2004010935A2 (en) 2002-07-25 2004-02-05 Medimmune, Inc. Methods of treating and preventing rsv, hmpv, and piv using anti-rsv, anti-hmpv, and anti-piv antibodies
US20040028685A1 (en) 2002-05-10 2004-02-12 Kinch Michael S. EphA2 monoclonal antibodies and methods of use thereof
US6818216B2 (en) 2000-11-28 2004-11-16 Medimmune, Inc. Anti-RSV antibodies
US20050019330A1 (en) 1997-12-02 2005-01-27 Neuralab Limited Prevention and treatment of amyloidogenic disease
US20050042664A1 (en) 2003-08-22 2005-02-24 Medimmune, Inc. Humanization of antibodies
US20050048549A1 (en) 2003-01-21 2005-03-03 Liangxian Cao Methods and agents for screening for compounds capable of modulating gene expression
US20060115485A1 (en) 2004-10-29 2006-06-01 Medimmune, Inc. Methods of preventing and treating RSV infections and related conditions
US7056704B2 (en) 2000-12-01 2006-06-06 Max-Planck-Gesellschaft Zur Foerderung Der Wissenschaften E.V. RNA interference mediating small RNA molecules
US20070086943A1 (en) 2002-05-10 2007-04-19 Purdue Research Foundation And Medimmune, Inc. EphA2 agonistic monoclonal antibodies and methods of use thereof
WO2007070488A2 (en) 2005-12-12 2007-06-21 The Cbr Institute For Biomedical Research, Inc. Integrin alpha l i domain mutants with increased binding affinity
US20070202077A1 (en) 2005-12-02 2007-08-30 Brodsky Robert A Use of High-Dose Oxazaphosphorine Drugs for Treating Immune Disorders
US7608707B2 (en) 2002-11-14 2009-10-27 Dharmacon, Inc. siRNA targeting survivin
US7651541B2 (en) 2001-01-10 2010-01-26 State Line Holdings, LLC Chemical change agent

Family Cites Families (51)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6054561A (en) 1984-02-08 2000-04-25 Chiron Corporation Antigen-binding sites of antibody molecules specific for cancer antigens
US5552391A (en) 1990-01-16 1996-09-03 La Jolla Pharmaceutical Company Chemically-defined non-polymeric valency platform molecules and conjugates thereof
US6641809B1 (en) * 1990-03-26 2003-11-04 Bristol-Myers Squibb Company Method of regulating cellular processes mediated by B7 and CD28
US5427908A (en) 1990-05-01 1995-06-27 Affymax Technologies N.V. Recombinant library screening methods
WO1994004679A1 (en) 1991-06-14 1994-03-03 Genentech, Inc. Method for making humanized antibodies
EP0606217B2 (en) * 1991-06-27 2008-12-03 Bristol-Myers Squibb Company Ctl4a receptor, fusion proteins containing it and uses thereof
GB9115364D0 (en) 1991-07-16 1991-08-28 Wellcome Found Antibody
CA2078539C (en) 1991-09-18 2005-08-02 Kenya Shitara Process for producing humanized chimera antibody
US5733743A (en) 1992-03-24 1998-03-31 Cambridge Antibody Technology Limited Methods for producing members of specific binding pairs
US6180377B1 (en) 1993-06-16 2001-01-30 Celltech Therapeutics Limited Humanized antibodies
US5532159A (en) 1994-04-01 1996-07-02 The Ohio State University Monoclonal antibody to canine placental oncofetal protein for detecting cancer
US6265150B1 (en) 1995-06-07 2001-07-24 Becton Dickinson & Company Phage antibodies
WO1999046281A2 (en) 1998-03-10 1999-09-16 Genentech, Inc. Novel polypeptides and nucleic acids encoding the same
US7411051B2 (en) * 1997-03-07 2008-08-12 Human Genome Sciences, Inc. Antibodies to HDPPA04 polypeptide
AU4640600A (en) 1999-05-11 2000-11-21 Eli Lilly And Company Amyloid precursor protein protease and related nucleic acid compounds
EP1067182A3 (en) 1999-07-08 2001-11-21 Helix Research Institute Secretory protein or membrane protein
PT1210428E (pt) 1999-08-23 2015-07-21 Genetics Inst Llc Pd-1, um recetor para b7-4 e suas utilizações
US6429303B1 (en) 1999-09-03 2002-08-06 Curagen Corporation Nucleic acids encoding members of the human B lymphocyte activation antigen B7 family and methods of using the same
WO2001018021A1 (en) 1999-09-03 2001-03-15 Human Genome Sciences, Inc. B7-like polynucleotides, polypeptides, and antibodies
PT1218504E (pt) * 1999-09-21 2007-10-22 Genetics Inst Llc Novas moléculas gl50 e suas utilizações
US6416999B1 (en) 2000-04-07 2002-07-09 Raven Biotechnologies, Inc. Human Müllerian duct-derived epithelial cells and methods of isolation and uses thereof
US6987024B1 (en) 2000-04-10 2006-01-17 Raven Biotechnologies, Inc. Human ovarian mesothelial cells and methods of isolation and uses thereof
US6436704B1 (en) 2000-04-10 2002-08-20 Raven Biotechnologies, Inc. Human pancreatic epithelial progenitor cells and methods of isolation and use thereof
US20060154313A1 (en) 2000-04-13 2006-07-13 Immunex Corporation Human B7 polypeptide B7-H3A
JP3597140B2 (ja) * 2000-05-18 2004-12-02 日本たばこ産業株式会社 副刺激伝達分子ailimに対するヒトモノクローナル抗体及びその医薬用途
AU2001264747A1 (en) 2000-05-22 2001-12-03 Idec Pharmaceuticals Corporation Identification of unique binding interactions between certain antibodies and thehuman b7.1 and b7.2 co-stimulatory antigens
EP1892251A3 (en) 2000-06-06 2008-12-31 Brystol-Myers Squibb Company B7-related nucleic acids and polypeptides and their uses for immunomodulation
US20030031675A1 (en) 2000-06-06 2003-02-13 Mikesell Glen E. B7-related nucleic acids and polypeptides useful for immunomodulation
WO2001094413A2 (en) 2000-06-06 2001-12-13 Bristol-Myers Squibb Company B7-related nucleic acids and polypeptides and their uses for immunomodulation
CA2412610A1 (en) * 2000-06-23 2002-01-03 Biogen, Inc. Gp286 nucleic acids and polypeptides
WO2002002587A1 (en) * 2000-06-30 2002-01-10 Human Genome Sciences, Inc. B7-like polynucleotides, polypeptides, and antibodies
US6635750B1 (en) 2000-07-20 2003-10-21 Millennium Pharmaceuticals, Inc. B7-H2 nucleic acids, members of the B7 family
AU2001283507A1 (en) 2000-07-27 2002-02-13 Mayo Foundation For Medical Education And Research B7-h3 and b7-h4, novel immunoregulatory molecules
EP1327638A4 (en) 2000-09-12 2004-09-29 Kirin Brewery NEW WALL MEMBRANE OF DENDRITIC CELLS AND THEIR USE
US20030134283A1 (en) 2000-10-03 2003-07-17 Peterson David P. Genes regulated in dendritic cell differentiation
CA2423843A1 (en) 2000-10-18 2002-04-25 Sloan-Kettering Institute For Cancer Research Uses of monoclonal antibody 8h9
JP4181032B2 (ja) 2001-05-25 2008-11-12 アムジェン インコーポレーテッド B7関連タンパク質−2分子およびその使用
US20070015144A9 (en) 2001-05-25 2007-01-18 Genset, S.A. Human cDNAs and proteins and uses thereof
AU2001286171B2 (en) 2001-05-25 2008-01-10 Serono Genetics Institute S.A. Human CDNAs and proteins and uses thereof
US6441163B1 (en) 2001-05-31 2002-08-27 Immunogen, Inc. Methods for preparation of cytotoxic conjugates of maytansinoids and cell binding agents
AU2002347761A1 (en) 2001-08-02 2003-02-24 Eli Lilly And Company Novel polypeptide analogs and fusions and their methods of use
CA2475356A1 (en) 2002-02-12 2003-08-21 Raven Biotechnologies, Inc. Human fetal bladder-derived epithelial cells
US20040162236A1 (en) 2002-04-01 2004-08-19 John Alsobrook Therapeutic polypeptides, nucleic acids encoding same, and methods of use
ATE488530T1 (de) 2002-06-19 2010-12-15 Raven Biotechnologies Inc Internalisierende antikörper spezifisch für das raag10 zelloberflächenziel
AU2003245615A1 (en) * 2002-06-20 2004-01-06 The Regents Of The University Of California Compositions and methods for modulating lymphocyte activity
EP2365004B1 (en) 2002-06-21 2016-01-06 Johns Hopkins University School of Medicine Membrane associated tumor endothelium markers
EP1951749A2 (en) * 2005-05-12 2008-08-06 Zymogenetics, Inc. Methods of using phhla2 to co-stimulate t-cells
US7931896B2 (en) * 2006-12-27 2011-04-26 The Johns Hopkins University Compositions and methods for treating inflammation and auto-immune diseases
WO2009089149A1 (en) 2008-01-03 2009-07-16 The Johns Hopkins University B7-h1 (cd274) antagonists induce apoptosis of tumor cells
AU2010282340B2 (en) * 2009-08-13 2016-12-22 The Johns Hopkins University Methods of modulating immune function
BR112015014621A2 (pt) * 2012-12-21 2017-10-03 Amplimmune Inc Anticorpos anti-h7cr

Patent Citations (74)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4816397A (en) 1983-03-25 1989-03-28 Celltech, Limited Multichain polypeptides or proteins and processes for their production
US6331415B1 (en) 1983-04-08 2001-12-18 Genentech, Inc. Methods of producing immunoglobulins, vectors and transformed host cells for use therein
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
US4675187A (en) 1983-05-16 1987-06-23 Bristol-Myers Company BBM-1675, a new antibiotic complex
US4889803A (en) 1984-04-27 1989-12-26 Yeda Research & Development Co., Ltd. Production of interferon gamma
US5807715A (en) 1984-08-27 1998-09-15 The Board Of Trustees Of The Leland Stanford Junior University Methods and transformed mammalian lymphocyte cells for producing functional antigen-binding protein including chimeric immunoglobulin
US4676980A (en) 1985-09-23 1987-06-30 The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services Target specific cross-linked heteroantibodies
US5225539A (en) 1986-03-27 1993-07-06 Medical Research Council Recombinant altered antibodies and methods of making altered antibodies
EP0239400A2 (en) 1986-03-27 1987-09-30 Medical Research Council Recombinant antibodies and methods for their production
US5116742A (en) 1986-12-03 1992-05-26 University Patents, Inc. RNA ribozyme restriction endoribonucleases and methods
US4987071A (en) 1986-12-03 1991-01-22 University Patents, Inc. RNA ribozyme polymerases, dephosphorylases, restriction endoribonucleases and methods
EP0307434A1 (en) 1987-03-18 1989-03-22 Medical Res Council CHANGED ANTIBODIES.
US5336603A (en) 1987-10-02 1994-08-09 Genentech, Inc. CD4 adheson variants
US5190929A (en) 1988-05-25 1993-03-02 Research Corporation Technologies, Inc. Cyclophosphamide analogs useful as anti-tumor agents
EP0367166A1 (en) 1988-10-31 1990-05-09 Takeda Chemical Industries, Ltd. Modified interleukin-2 and production thereof
US5585089A (en) 1988-12-28 1996-12-17 Protein Design Labs, Inc. Humanized immunoglobulins
US5530101A (en) 1988-12-28 1996-06-25 Protein Design Labs, Inc. Humanized immunoglobulins
EP0394827A1 (en) 1989-04-26 1990-10-31 F. Hoffmann-La Roche Ag Chimaeric CD4-immunoglobulin polypeptides
US5112946A (en) 1989-07-06 1992-05-12 Repligen Corporation Modified pf4 compositions and methods of use
EP0413622A1 (en) 1989-08-03 1991-02-20 Rhone-Poulenc Sante Albumin derivatives with therapeutic functions
WO1991006570A1 (en) 1989-10-25 1991-05-16 The University Of Melbourne HYBRID Fc RECEPTOR MOLECULES
WO1991009967A1 (en) 1989-12-21 1991-07-11 Celltech Limited Humanised antibodies
US5349053A (en) 1990-06-01 1994-09-20 Protein Design Labs, Inc. Chimeric ligand/immunoglobulin molecules and their uses
US5359046A (en) 1990-12-14 1994-10-25 Cell Genesys, Inc. Chimeric chains for receptor-associated signal transduction pathways
EP0519596A1 (en) 1991-05-17 1992-12-23 Merck & Co. Inc. A method for reducing the immunogenicity of antibody variable domains
US6407213B1 (en) 1991-06-14 2002-06-18 Genentech, Inc. Method for making humanized antibodies
US5844095A (en) 1991-06-27 1998-12-01 Bristol-Myers Squibb Company CTLA4 Ig fusion proteins
US5565332A (en) 1991-09-23 1996-10-15 Medical Research Council Production of chimeric antibodies - a combinatorial approach
US6162432A (en) 1991-10-07 2000-12-19 Biogen, Inc. Method of prophylaxis or treatment of antigen presenting cell driven skin conditions using inhibitors of the CD2/LFA-3 interaction
WO1993008656A1 (de) 1991-10-24 1993-04-29 Institut für Rundfunktechnik GmbH Verfahren zum übertragen oder speichern eines aus einer folge von informationsblöcken bestehenden digitalisierten, encodierten tonsignals über störbehaftete kanäle
US5766886A (en) 1991-12-13 1998-06-16 Xoma Corporation Modified antibody variable domains
US5824307A (en) 1991-12-23 1998-10-20 Medimmune, Inc. Human-murine chimeric antibodies against respiratory syncytial virus
US5622929A (en) 1992-01-23 1997-04-22 Bristol-Myers Squibb Company Thioether conjugates
WO1993015199A1 (fr) 1992-01-31 1993-08-05 Rhone-Poulenc Rorer S.A. Nouveaux polypeptides biologiquement actifs, leur preparation et composition pharmaceutique les contenant
WO1993015200A1 (fr) 1992-01-31 1993-08-05 Rhone-Poulenc Rorer S.A. Polypeptides antithrombotiques, antagonistes de la liaison du vwf aux plaquettes et/ou au sous-endothelium
WO1993017105A1 (en) 1992-02-19 1993-09-02 Scotgen Limited Altered antibodies, products and processes relating thereto
US5447851B1 (en) 1992-04-02 1999-07-06 Univ Texas System Board Of Dna encoding a chimeric polypeptide comprising the extracellular domain of tnf receptor fused to igg vectors and host cells
US5447851A (en) 1992-04-02 1995-09-05 Board Of Regents, The University Of Texas System DNA encoding a chimeric polypeptide comprising the extracellular domain of TNF receptor fused to IgG, vectors, and host cells
EP0592106A1 (en) 1992-09-09 1994-04-13 Immunogen Inc Resurfacing of rodent antibodies
WO1994012650A2 (en) 1992-12-03 1994-06-09 Transkaryotic Therapies, Inc. Activating expression of an amplifying endogenous gene by homologous recombination
US5837458A (en) 1994-02-17 1998-11-17 Maxygen, Inc. Methods and compositions for cellular and metabolic engineering
US5605793A (en) 1994-02-17 1997-02-25 Affymax Technologies N.V. Methods for in vitro recombination
US5811238A (en) 1994-02-17 1998-09-22 Affymax Technologies N.V. Methods for generating polynucleotides having desired characteristics by iterative selection and recombination
US5830721A (en) 1994-02-17 1998-11-03 Affymax Technologies N.V. DNA mutagenesis by random fragmentation and reassembly
US5783181A (en) 1994-07-29 1998-07-21 Smithkline Beecham Corporation Therapeutic uses of fusion proteins between mutant IL 4/IL13 antagonists and immunoglobulins
WO1996004388A1 (en) 1994-07-29 1996-02-15 Smithkline Beecham Plc Novel compounds
WO1996022024A1 (en) 1995-01-17 1996-07-25 Brigham And Women's Hospital, Inc. Receptor specific transepithelial transport of immunogens
US5834252A (en) 1995-04-18 1998-11-10 Glaxo Group Limited End-complementary polymerase reaction
US5723125A (en) 1995-12-28 1998-03-03 Tanox Biosystems, Inc. Hybrid with interferon-alpha and an immunoglobulin Fc linked through a non-immunogenic peptide
US5908626A (en) 1995-12-28 1999-06-01 Tanox, Inc. Hybrid with interferon-β and an immunoglobulin Fc joined by a peptide linker
WO1997034631A1 (en) 1996-03-18 1997-09-25 Board Of Regents, The University Of Texas System Immunoglobin-like domains with increased half lives
WO1998023289A1 (en) 1996-11-27 1998-06-04 The General Hospital Corporation MODULATION OF IgG BINDING TO FcRn
US6277375B1 (en) 1997-03-03 2001-08-21 Board Of Regents, The University Of Texas System Immunoglobulin-like domains with increased half-lives
WO1999004813A1 (en) 1997-07-24 1999-02-04 Brigham & Women's Hospital, Inc. Receptor specific transepithelial transport of therapeutics
US20050019330A1 (en) 1997-12-02 2005-01-27 Neuralab Limited Prevention and treatment of amyloidogenic disease
US20020098189A1 (en) 2000-03-01 2002-07-25 Young James F. High potency recombinant antibodies and method for producing them
WO2001068882A2 (en) 2000-03-14 2001-09-20 Transkaryotic Therapies, Inc. Methods for homologous recombination
WO2001077137A1 (en) 2000-04-12 2001-10-18 Human Genome Sciences, Inc. Albumin fusion proteins
US6818216B2 (en) 2000-11-28 2004-11-16 Medimmune, Inc. Anti-RSV antibodies
US7056704B2 (en) 2000-12-01 2006-06-06 Max-Planck-Gesellschaft Zur Foerderung Der Wissenschaften E.V. RNA interference mediating small RNA molecules
WO2002046237A2 (en) 2000-12-06 2002-06-13 Neuralab Limited Humanized antibodies that recognize beta amyloid peptide
WO2002060919A2 (en) 2000-12-12 2002-08-08 Medimmune, Inc. Molecules with extended half-lives, compositions and uses thereof
US7651541B2 (en) 2001-01-10 2010-01-26 State Line Holdings, LLC Chemical change agent
WO2002098370A2 (en) 2001-03-02 2002-12-12 Medimmune, Inc. Methods of administering/dosing cd2 antagonists for the prevention and treatment of autoimmune disorders or inflammatory disorders
WO2002069904A2 (en) 2001-03-02 2002-09-12 Medimmune, Inc. Cd2 antagonists for treatment of autoimmune or inflammatory disease
US20040028685A1 (en) 2002-05-10 2004-02-12 Kinch Michael S. EphA2 monoclonal antibodies and methods of use thereof
US20070086943A1 (en) 2002-05-10 2007-04-19 Purdue Research Foundation And Medimmune, Inc. EphA2 agonistic monoclonal antibodies and methods of use thereof
WO2004010935A2 (en) 2002-07-25 2004-02-05 Medimmune, Inc. Methods of treating and preventing rsv, hmpv, and piv using anti-rsv, anti-hmpv, and anti-piv antibodies
US7608707B2 (en) 2002-11-14 2009-10-27 Dharmacon, Inc. siRNA targeting survivin
US20050048549A1 (en) 2003-01-21 2005-03-03 Liangxian Cao Methods and agents for screening for compounds capable of modulating gene expression
US20050042664A1 (en) 2003-08-22 2005-02-24 Medimmune, Inc. Humanization of antibodies
US20060115485A1 (en) 2004-10-29 2006-06-01 Medimmune, Inc. Methods of preventing and treating RSV infections and related conditions
US20070202077A1 (en) 2005-12-02 2007-08-30 Brodsky Robert A Use of High-Dose Oxazaphosphorine Drugs for Treating Immune Disorders
WO2007070488A2 (en) 2005-12-12 2007-06-21 The Cbr Institute For Biomedical Research, Inc. Integrin alpha l i domain mutants with increased binding affinity

Non-Patent Citations (304)

* Cited by examiner, † Cited by third party
Title
"Cecil Textbook of Medicine,20th Ed.", 1996, W.B. SAUNDERS
"Current Protocols in Immunology", 1997, JOHN WILEY AND SONS, INC.
"Gene Transfer Vectors for Mammalian Cells", 1987, COLD SPRING HARBOR LABORATORY
"Goodman and Gilman's: The Pharmacological Basis of Therapeutics, 10th ed.,", 2001, MCGRAW-HILL
"Immobilized Cells and Enzymes", 1986, IRL PRESS
"Immunochemical Methods in Cell and Molecular Biology", 1987, ACADEMIC PRESS
"Landes Bioscience/Eurekah.com", KLUWER ACADEMIC/PLENUM., pages: 141
"Medical Applications of Controlled Release", 1974, CRC PRES.
"Methods in Enzymology", vol. 154, 155, 1987
"Monoclonal Antibodies For Cancer Detection And Therapy", 1985, ACADEMIC PRESS, article "Analysis, Results, And Future Prospective Of The Therapeutic Use Of Radiolabeled Antibody In Cancer Therapy", pages: 303 - 16
"Physician's Desk Reference", 2009, THOMSON REUTERS
"The Merck Manual of Diagnosis and Therapy, 17th Ed.,", 1999, MERCK SHARP & DOHME RESEARCH LABORATORIES
"Useful proteins from recombinant bacteria", SCIENTIFIC AMERICAN, vol. 242, 1980, pages 74 - 94
ADAMES ET AL., NATURE, vol. 318, 1985, pages 533 - 538
AHMAD ET AL., AM J KIDNEY DIS., vol. 7, no. 2, 1986, pages 153 - 6
ALEXANDER ET AL., MOL. CELL. BIOL., vol. 7, 1987, pages 1436 - 1444
ALEXANDRAKIS ET AL., BR J OPHTHALMOL., vol. 82, no. 3, 1998, pages 306 - 11
ALTMAN ET AL., SCIENCE, vol. 274, 1996, pages 94 - 96
ALTURE-WERBER E; EDBERG SC, MYCOPATHOLOGIA, vol. 89, no. 2, 1985, pages 69 - 73
ANDRUTIS ET AL., J CLIN MICROBIOL., vol. 38, no. 6, 2000, pages 2317 - 23
ARATANI ET AL., MED MYCOL, vol. 40, no. 6, 2002, pages 557 - 563
ARDLEY, N. Y., SCIENTIFIC TABLES, GEIGY PHARMACEUTICALS, 1970, pages 537
ARENDRUP ET AL., INFECTION, vol. 30, no. 5, 2002, pages 286 - 91
ARICO ET AL., J INTERFERON CYTOKINE RES, vol. 22, no. 11, 2002, pages 1081 - 8
ARNON ET AL.: "Monoclonal Antibodies And Cancer Therapy", 1985, ALAN R. LISS, INC., article "Monoclonal Antibodies For Immunotargeting Of Drugs In Cancer Therapy", pages: 243 - 56
ASHKENAZI ET AL., PROC. NATL. ACAD. SCI. USA, vol. 88, 1991, pages 10535 - 10539
AUSUBEL ET AL.: "Current Protocols in Molecular Biology", 1995, JOHN WILEY AND SONS, INC.
AUSUBEL ET AL.: "Expression of Proteins in Mammalian Cells Using Vaccinia Viral Vectors in Current Protocols in Molecular Biology", vol. 2, 1991
AYASH-RASHKOVSKY ET AL., FASEB J., vol. 19, 2005, pages 1149 - 1151
BACA ET AL., J. BIOL. CHEM., vol. 272, no. 16, 1997, pages 10678 - 84
BALASUBRAMANIAN ET AL., IMMUNOBIOLOGY, vol. 191, no. 4-5, 1994, pages 395 - 401
BARBEE ET AL., AM J PATHOL., vol. 86, no. 1, 1977, pages 281 - 4
BARTEL; SZOSTAK, SCIENCE, vol. 261, 1993, pages 1411 - 1418
BAUQUET, A. T. ET AL.: "The costimulatory molecule ICOS regulates the expression of c-Maf and IL-21 in the development of follicular T helper cells and TH-17 cells", NAT IMMUNOL, vol. 10, 2009, pages 167 - 75
BEERS ET AL., J LAB CLIN MED., vol. 133, no. 5, 1999, pages 423 - 33
BERNOIST; CHAMBON, NATURE, vol. 290, 1981, pages 304 - 310
BIOCHEMICA, no. 2, 1999, pages 34 37
BIRREN ET AL.: "Genome Analysis: A Laboratory Manual", vol. 1, 1997, COLD SPRING HARBOR PRESS
BOLGER ET AL., ANTIVIRAL RES., vol. 35, 1997, pages 157 - 165
BONYHADI ET AL., MOL. MED. TODAY, vol. 3, 1997, pages 246 - 253
BOURNE ET AL., ANTIVIRAL RES., vol. 47, 2000, pages 103 - 109
BOVEN AND WINOGRAD: "The Nude Mouse in Oncology Research", 1991
BOZZA ET AL., MICROBES INFECT, vol. 4, no. 13, 2002, pages 1281 - 1290
BRAVO ET AL., ANTIVIRAL RES., vol. 60, 2003, pages 41 - 49
BRAVO ET AL., J. INFECTIOUS DISEASES, vol. 193, 2006, pages 591 - 597
BRIELAND ET AL., IMMUNOPHARMACOLOGY, vol. 48, no. 3, 2000, pages 249 - 52
BRIGHT ET AL., NATURE, vol. 436, 2005, pages 973 - 978
BRINSTER ET AL., NATURE, vol. 296, 1982, pages 39 - 42
BROWN ET AL., AM J REPROD IMMUNOL., vol. 46, no. 3, 2001, pages 232 - 41
BROWNING ET AL., PROC. NATL. ACAD. SCI. USA, vol. 94, 1997, pages 14637 - 14641
BRYANT ET AL., LAB INVEST, vol. 80, no. 4, 2000, pages 553 - 73
BUCHWALD ET AL., SURGERY, vol. 88, 1980, pages 507
CACCIAPUOTI ET AL., ANTIMICROB AGENTS CHEMOTHER, vol. 44, no. 8, 2000, pages 2017 - 2022
CALDAS ET AL., PROTEIN ENG., vol. 13, no. 5, 2000, pages 353 - 60
CARBON ET AL., INT J BIOMED COMPUT., vol. 36, no. 1-2, 1994, pages 59 - 67
CARRENO, B.M.; COLLINS, M.: "The B7 family of ligands and its receptors: new pathways for costimulation and inhibition of immune responses", ANNU REV IMMUNOL, vol. 20, 2002, pages 29 - 53, XP009004805, DOI: doi:10.1146/annurev.immunol.20.091101.091806
CAVANAUGH ET AL., J. VIROL., vol. 71, 1997, pages 3236 - 3243
CHAKRABARTI ET AL., J MED VET MYCOL., vol. 35, no. 4, 1997, pages 295 - 7
CHATTOPADHYAY, K.; BHATIA, S.; FISER, A.; ALMO, S. C.; NATHENSON, S. G.: "Structural basis of inducible costimulator ligand costimulatory function: determination of the cell surface oligomeric state and functional mapping of the receptor binding site of the protein", J IMMUNOL, vol. 177, 2006, pages 3920 - 9
CHATTOPADHYAY, K.; BHATIA, S.; FISER, A.; ALMO, S.C.; NATHENSON, S.G.: "Structural basis of inducible costimulator ligand costimulatory function: determination of the cell surface oligomeric state and functional mapping of the receptor binding site of the protein", J IMMUNOL, vol. 177, 2006, pages 3920 - 3929
CHEN ET AL., VIROL. J, vol. 1, 23 November 2004 (2004-11-23), pages 11
CHEN, L., THE B7-CD28 FAMILY MOLECULES, 2003
CHEN, L.: "Co-inhibitory molecules of the B7-CD28 family in the control of T-cell immunity", NAT REV IMMUNOL, vol. 4, 2004, pages 336 - 347, XP055141186, DOI: doi:10.1038/nri1349
CHU ET AL., AVIAN DIS., vol. 40, no. 3, 1996, pages 715 - 9
COCK ET AL., REV INST MED TROP SAO PAULO, vol. 42, no. 2, 2000, pages 59 - 66
COHN ET AL., J. EXP. MED., 1997, pages 1861737 - 1747
COLE ET AL., FEMS MICROBIOL LETT., vol. 126, no. 2, 1995, pages 177 - 80
COUTO ET AL., CANCER RES., vol. 55, 1995, pages 5973S - 5977S
COUTO ET AL., CANCER RES., vol. 55, no. 8, 1995, pages 1717 - 22
CRUTE ET AL., NATURE MEDICINE, vol. 8, 2002, pages 386 - 391
CULLEY ET AL., J EXP MED, vol. 196, no. 10, 2002, pages 1381 - 1386
CURTIS ET AL., EXP BIOL MED, vol. 227, no. 9, 2002, pages 799 - 802
DAVIS; MATALON, NEWS PHYSIOL SCI, vol. 16, 2001, pages 185 - 90
DEBOER ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 80, 1983, pages 21 - 25
DONG ET AL., NATURE, vol. 409, 2001, pages 97 - 101
DONG, C. ET AL.: "ICOS co-stimulatory receptor is essential for T-cell activation and function", NATURE, vol. 409, 2001, pages 97 - 101
DONG, H.; ZHU, G.; TAMADA, K.; CHEN, L.: "B7-H1, a third member of the B7 family, co-stimulates T-cell proliferation and interleukin-10 secretion", NAT MED, vol. 5, 1999, pages 1365 - 1369, XP055204019, DOI: doi:10.1038/70932
DONG, H.; ZHU, G.; TAMADA, K.; CHEN: "L. B7-H1, a third member of the B7 family, co-stimulates T-cell proliferation and interleukin-10 secretion", NAT MED, vol. 5, 1999, pages 1365 - 9, XP055204019, DOI: doi:10.1038/70932
DURING ET AL., ANN. NEUROL., vol. 25, 1989, pages 351
EMSLIE; NADE, REV INFECT DIS., vol. 8, no. 6, 1986, pages 841 - 9
ENGLER ET AL., MOL IMMUNOL, vol. 38, no. 6, 2001, pages 457 - 65
EWART ET AL., J APPL PHYSIOL, vol. 79, no. 2, 1995, pages 560 - 566
FAHRER, A.M.; BAZAN, J.F.; PAPATHANASIOU, P.; NELMS, K.A.; GOODNOW, C.C.: "A genomic view of immunology", NATURE, vol. 409, 2001, pages 836 - 838, XP002265430, DOI: doi:10.1038/35057020
FIDEL ET AL., J INFECT DIS., vol. 173, no. 2, 1996, pages 425 - 31
FIEBIG AND BURGER: "Relevance of Tumor Models for Anticancer Drug Development", 1999
FISHMAN ET AL.: "Medicine, 2d Ed.", 1985, J.B. LIPPINCOTT CO.
FLANDERS ET AL., AUTOIMMUNITY, vol. 29, 1999, pages 235 - 246
FLANO ET AL., IMMUNOL RES, vol. 25, no. 3, 2002, pages 201 - 17
FODDE; SMITS, TRENDS MOL MED, vol. 7, no. 8, 2001, pages 369 - 73
FOSTER, SEMIN. NEPHROL., vol. 19, 1999, pages 12 - 24
FREEMAN, G.J.; GRIBBEN, J.G.; BOUSSIOTIS, V.A.; NG, J.W.; RESTIVO, V.A., JR.; LOMBARD, L.A.; GRAY, G.S.; NADLER, L.M.: "Cloning of B7-2: a CTLA-4 counter-receptor that costimulates human T cell proliferation", SCIENCE, vol. 262, 1993, pages 909 - 911, XP002069402, DOI: doi:10.1126/science.7694363
FREIREICH ET AL., CANCER CHEMOTHER. REP., vol. 50, 1966, pages 219 - 244
FRESHNEY,: "Animal Cell Culture", 1986
GAIT,: "Oligonucleotide Synthesis", 1984
GARDNER ET AL., NUCL. ACIDS RES., vol. 9, 1981, pages 2871
GENTZ ET AL., PROC. NATL. ACAD. SCI. USA, vol. 86, 1989, pages 821 - 824
GHANEH ET AL., GENE THER, vol. 8, no. 3, 2001, pages 199 - 208
GILLIES ET AL., J. IMMUNOL. METHODS, vol. 125, 1989, pages 191 - 202
GOKASLAN; ANAISSIE, INFECT IMMUN., vol. 60, no. 8, 1992, pages 3339 - 44
GOODSON: "Medical Applications of Controlled Release", vol. 2, 1984, pages: 115 - 138
GROSSCHEDL ET AL., CELL, vol. 38, 1984, pages 647 - 658
GUHAD ET AL., FEMS MICROBIOL LETT, vol. 192, no. 1, 2000, pages 27 - 31
GUIDOTTI ET AL., J. VIROL., vol. 69, 1995, pages 6158 - 6169
HABERBERGER ET AL., EXPERIENTIA., vol. 47, no. 5, 1991, pages 426 - 9
HAJERI ET AL., DRUG DISCOV TODAY, vol. 14, no. 17-18, 2009, pages 851 - 8
HAMES, HIGGINS,: "Transcription and Translation", 1984
HAMES, HIGGINS: "Nucleic Acid Hybridization", 1984
HAMMER ET AL., SCIENCE, vol. 235, pages 53 - 58
HAMMERLING ET AL.: "Monoclonal Antibodies and T-Cell Hybridomas", 1981, ELSEVIER, pages: 563 - 681
HANAHAN, NATURE, vol. 315, 1985, pages 115 - 122
HANSSON ET AL., J. MOL. BIOL., vol. 287, 1999, pages 265 - 76
HARAYAMA, TRENDS BIOTECHNOL., vol. 16, no. 2, 1998, pages 76 - 82
HARLOW ET AL.: "Antibodies. A Laboratory Manual, 2nd ed.", 1988, COLD SPRING HARBOR LABORATORY PRESS
HASELHOFF; GERLACH, NATURE, vol. 334, 1988, pages 585 - 591
HAYASHI ET AL., HISTOL HISTOPATHOL, vol. 17, no. 4, 2002, pages 1293 - 3 10
HELLSTROM ET AL.: "Controlled Drug Delivery(2nd Ed.)", 1987, MARCEL DEKKER, INC., article "Antibodies For Drug Delivery", pages: 623 - 53
HERBER ET AL., J VIROL, vol. 70, no. 3, 1996, pages 1873 - 81
HERRERA-ESTRELLA ET AL., NATURE, vol. 303, pages 209 - 213
HERRERA-ESTRELLA ET AL., NATURE, vol. 310, 1984, pages 115 - 120
HONDA ET AL., MYCOPATHOLOGIA, vol. 144, no. 3, 1998, pages 141 - 146
HORI ET AL., EUR J IMMUNO, vol. 32, no. 5, 2002, pages 1282 - 1291
HOSOKAWA ET AL., TRANSGENIC RES, vol. 10, no. 5, 2001, pages 471 - 8
HOUGH ET AL., PROC NATL ACAD SCI USA, vol. 95, no. 23, 1998, pages 13853 - 8
HOWARD ET AL., J. NEUROSURG., vol. 71, 1989, pages 105
HSIUNG ET AL., REV INFECT DIS., vol. 6, no. 1, 1984, pages 33 - 50
HSU ET AL., NAT. BIOTECHNOL., vol. 21, 2003, pages 519 - 525
HUTLOFF ET AL., NATURE, vol. 397, 1999, pages 263 - 266
HUTLOFF, A. ET AL.: "ICOS is an inducible T-cell co-stimulator structurally and functionally related to CD28", NATURE, vol. 397, 1999, pages 263 - 6, XP002156736, DOI: doi:10.1038/16717
HUTLOFF, A.; DITTRICH, A.M.; BEIER, K.C.; ELJASCHEWITSCH, B.; KRAFT, R.; ANAGNOSTOPOULOS, I.; KROCZEK, R.A.: "ICOS is an inducible T-cell co-stimulator structurally and functionally related to CD28", NATURE, vol. 397, 1999, pages 263 - 266, XP002156736, DOI: doi:10.1038/16717
ILAN ET AL., J. INFECT. DIS., vol. 185, 2002, pages 153 - 161
JENSEN; SCHONHEYDER, J EXP ANIM SCI., vol. 35, no. 4, 1993, pages 155 - 60
JOHNSON ET AL., J. INFECT. DIS., vol. 176, 1997, pages 1215 - 1224
JOLICOEUR ET AL., LEUKEMIA, vol. 13, 1999, pages S78 - S80
KADO ET AL., CANCER RES, vol. 61, no. 6, 2001, pages 2395 - 8
KAMEI, MYCOPATHOLOGIA, vol. 152, no. 1, 2001, pages 5 - 13
KANE ET AL., ANTIMICROB AGENTS CHEMOTHER., vol. 20, no. 5, 1981, pages 595 - 9
KARGER, CONTRIBUTIONS TO ONCOLOGY, 1999
KAZANJI, AIDS RES HUM RETROVIRUSES, vol. 16, no. 16, 2000, pages 1741 - 6
KELSEY ET AL., GENES AND DEVEL., vol. 1, 1987, pages 161 - 171
KENYON ET AL., TOXICOL APPL PHARMACOL, vol. 186, no. 2, 2003, pages 90 - 100
KERN ET AL., ANTIMICROB. AGENTS CHEMOTHER., vol. 48, 2004, pages 4745 - 4753
KLOSE, TRENDS MICROBIOL., vol. 8, no. 4, 2000, pages 189 - 91
KNETEMAN ET AL., HEPATOLOGY, vol. 43, 2006, pages 1346 - 1353
KOEDEL; PFISTER, INFECT DIS CLIN NORTH AM., vol. 13, no. 3, 1999, pages 549 - 77
KOLLIAS ET AL., CELL, vol. 46, 1986, pages 89 - 94
KOMAI ET AL., BR J PHARMACOL, vol. 138, no. 5, 2003, pages 912 - 920
KROGH ET AL., BIOCHIMIE, vol. 81, 1999, pages 511 - 515
KRUMLAUF ET AL., MOL. CELL. BIOL., vol. 5, 1985, pages 1639 - 1648
KRUMMEL ET AL., J. EXP. MED., vol. 182, 1995, pages 469 - 465
KRUMMEL, M. F.; ALLISON, J. P.: "CD28 and CTLA-4 have opposing effects on the response of T cells to stimulation", J EXP MED, vol. 182, 1995, pages 459 - 65, XP001031165, DOI: doi:10.1084/jem.182.2.459
KRUMMEL, M.F.; ALLISON, J.P.: "CD28 and CTLA-4 have opposing effects on the response of T cells to stimulation", J EXP MED, vol. 182, 1995, pages 459 - 465, XP001031165, DOI: doi:10.1084/jem.182.2.459
KURAGUCHI ET AL., ONCOGENE, vol. 19, no. 50, 2000, pages 5755 - 63
KURUP ET AL., INT ARCH ALLERGY IMMUNOL, vol. 129, no. 2, 2002, pages 129 - 137
KURUP ET AL., J IMMUNOL., vol. 148, no. 12, 1992, pages 3783 - 8
LANDER, E.S.; LINTON, L.M.; BIRREN, B.; NUSBAUM, C.; ZODY, M.C.; BALDWIN, J.; DEVON, K.; DEWAR, K.; DOYLE, M.; FITZHUGH, W. ET AL.: "Initial sequencing and analysis of the human genome.", NATURE, vol. 409, 2001, pages 860 - 921, XP001056473, DOI: doi:10.1038/35057062
LANGER, SCIENCE, vol. 249, 1990, pages 1527 - 1533
LANGER, SCIENCE, vol. 249, 1990, pages 1527 153
LARSEN ET AL., AM J. TRANSPLANT, vol. 5, 2005, pages 433 - 435
LEDER ET AL., CELL, vol. 45, 1986, pages 485 - 495
LEE, BAILLIERES BEST PRACT RES CLIN GASTROENTEROL., vol. 14, no. 1, 2000, pages 75 - 96
LENSCHOW, D. J.; WALUNAS, T. L.; BLUESTONE, J. A.: "CD28/B7 system of T cell costimulation", ANNU REV IMMUNOL, vol. 14, 1996, pages 233 - 58, XP000916005, DOI: doi:10.1146/annurev.immunol.14.1.233
LEVY ET AL., SCIENCE, vol. 228, 1985, pages 190
LI ET AL.: "Vascular endothelial growth factor blockade reduces intratumoral regulatory T cells and enhances the efficacy of a GM-CSF-secreting cancer immunotherapy", CLIN CANCER RES., vol. 12, no. 22, 15 November 2006 (2006-11-15), pages 6808 - 16, XP002550186, DOI: doi:10.1158/1078-0432.ccr-06-1558
LIANG J; HUANG M; DUAN W; YU XQ; ZHOU S.: "Design of new oxazaphosphorine anticancer drugs", CURR PHARM DES., vol. 13, no. 9, 2007, pages 963 - 78
LING ET AL., GENOMICS, vol. 78, 2001, pages 155 - 168
LING ET AL., J. IMMUNOL., vol. 164, 2000, pages 1653 - 1657
LING, V. ET AL.: "Assembly and annotation of human chromosome 2q33 sequence containing the CD28, CTLA4, and ICOS gene cluster: analysis by computational, comparative, and microarray approaches", GENOMICS, vol. 78, 2001, pages 155 - 68, XP004432162, DOI: doi:10.1006/geno.2001.6655
LINSLEY, P. S.; CLARK, E. A.; LEDBETTER, J.: "A. T-cell antigen CD28 mediates adhesion with B cells by interacting with activation antigen B7/BB-1", PROC NATL ACAD SCI U S A, vol. 87, 1990, pages 5031 - 5, XP002945122, DOI: doi:10.1073/pnas.87.13.5031
LINSLEY, P.S.; CLARK, E.A.; LEDBETTER, J.A.: "T-cell antigen CD28 mediates adhesion with B cells by interacting with activation antigen B7/BB- 1", PROC NATL ACAD SCI USA, vol. 87, 1990, pages 5031 - 5035, XP002945122, DOI: doi:10.1073/pnas.87.13.5031
LINTERMAN ET AL., IMMUNITY, vol. 30, 2009, pages 228 - 241
LINTERMAN, M. A. ET AL.: "Roquin differentiates the specialized functions of duplicated T cell costimulatory receptor genes CD28 and ICOS", IMMUNITY, vol. 30, 2009, pages 228 - 41
LOPEZ-FRAGA ET AL., BIODRUGS, vol. 23, no. 5, 2009, pages 305 - 332
LORENZO; BLASCO, BIOTECHNIQUES, vol. 24, no. 2, 1998, pages 308 - 313
MACDONALD, HEPATOLOGY, vol. 7, 1987, pages 425 - 515
MAEBASHI ET AL., J MED VET MYCOL., vol. 32, no. 5, 1994, pages 349 - 59
MAESTRONE ET AL., AM J VET RES., vol. 34, no. 6, 1973, pages 833 - 6
MARTIN ET AL., ANTIMICROB AGENTS CHEMOTHER., vol. 41, no. 1, 1997, pages 13 - 6
MARTINS ET AL., CRIT CARE MED, vol. 19, 1990, pages 515 - 519
MASON ET AL., SCIENCE, vol. 234, 1986, pages 1372 - 1378
MCADAM ET AL., NATURE, vol. 409, 2001, pages 102 - 105
MCADAM, A. J. ET AL.: "ICOS is critical for CD40-mediated antibody class switching", NATURE, vol. 409, 2001, pages 102 - 5
MCCAULEY ET AL., ANTIVIRAL RES., vol. 27, 1995, pages 179 - 186
MCLANE ET AL., PROC NATL ACAD SCI USA, vol. 19, 1998, pages 713 - 720
MERCER ET AL., NAT. MED., vol. 7, 2001, pages 927 - 933
MOGRAM ET AL., NATURE, vol. 315, 1985, pages 338 - 340
MOREA ET AL., METHODS, vol. 20, no. 3, 2000, pages 267 79
MORRIS ET AL., J LA STATE MED SOC, vol. 150, no. 4, 1998, pages 179 - 85
MORRISON, SCIENCE, vol. 229, 1985, pages 1202
MOSIER ET AL., SEMIN. IMMUNOL., vol. 8, 1996, pages 255 - 262
MOSIER ET AL.: "Hosp. Pract.", vol. 31, 1996, pages: 41 - 43,53-55
MOSMANN, J. IMMUNOL. METHODS, vol. 65, 1983, pages 55 63
MUELLER ET AL., MOLECULAR IMMUNOLOGY, vol. 34, no. 6, 1997, pages 441 - 452
MURPHY ET AL.: "Informed Decisions: The Complete Book of Cancer Diagnosis, Treatment, and Recovery", 1997, VIKING PENGUIN, PENGUIN BOOKS U.S.A., INC.
NAJVAR ET AL., ANTIMICROB AGENTS CHEMOTHER., vol. 43, no. 2, 1999, pages 413 - 4
NEDRUD, FEMS IMMUNOL MED MICROBIOL., vol. 24, no. 2, 1999, pages 243 - 50
NICOLAIDES ET AL., PROC NATL ACAD SCI USA, vol. 94, 1997, pages 13175 - 13180
OI ET AL., BIOTECHNIQUES, vol. 4, 1986, pages 214
ONDERDONK ET AL., REV INFECT DIS., vol. 1, no. 2, 1979, pages 291 - 301
ONDERDONK ET AL., REV INFECT DIS., vol. 12, no. 2, 1990, pages 169 - 77
ORNITZ ET AL., COLD SPRING HARBOR SYMP. QUANT. BIOL., vol. 50, 1986, pages 399 - 409
OTTOLINI ET AL., J INFECT DIS, vol. 186, no. 12, 2002, pages 1713 - 1717
PADLAN, MOLECULAR IMMUNOLOGY, vol. 28, no. 4/5, 1991, pages 489 - 498
PAGE ET AL., INTL. J. OF ONCOLOGY, vol. 3, 1993, pages 473 476
PALLADINO ET AL., CANCER RES., vol. 47, 1987, pages 5074 - 5079
PATH ET AL., AM J RESP & CRITICAL CARE MED, vol. 166, no. 6, 2002, pages 818 - 826
PATTEN ET AL., CURR. OPINION BIOTECHNOL., vol. 8, 1997, pages 724 - 33
PEDERSEN ET AL., J. MOL. BIOL., vol. 235, no. 3, 1994, pages 959 - 73
PERBAL, A: "Practical Guide to Molecular Cloning", 1984
PHILLIPS ET AL., J PSYCHOPHARMACOL., vol. 14, no. 3, 2000, pages 244 - 50
PIAZZA ET AL., CANCER RESEARCH, vol. 55, 1995, pages 3110 16
PINKERT ET AL., GENES AND DEVEL., vol. 1, 1987, pages 268 - 276
PLETNIKOV ET AL., FRONT BIOSCI, vol. 7, 2002, pages D593 - 607
POLLOCK ET AL., NAT GENET., vol. 9, no. 2, 1995, pages 202 - 9
PRELLNER ET AL., MICROB DRUG RESIST., vol. 5, no. 1, 1999, pages 73 - 82
PRESTA, CURRENT OPINION IN IMMUNOLOGY, vol. 20, 2008, pages 460 - 470
PROC. NATL. ACAD. SCI. USA, vol. 89, 1992, pages 11337 - 11341
QUIMBY; NGUYEN, CRIT REV MICROBIOL., vol. 12, no. 1, 1985, pages 1 - 44
RANGER; PEPPAS: "J. Macromol. Sci. Rev. Macromol. Chem.", vol. 23, 1983, pages: 61
READHEAD ET AL., CELL, vol. 48, 1987, pages 703 - 712
REICHMANN ET AL., NATURE, vol. 332, 1988, pages 323
RIDGWAY ET AL., LAB ANIM SCI., vol. 36, no. 5, 1986, pages 481 - 5
RILEY, J. L. ET AL.: "Modulation of TCR-induced transcriptional profiles by ligation of CD28, ICOS, and CTLA-4 receptors", PROC NATL ACAD SCI USA, vol. 99, 2002, pages 11790 - 5
RIVERA ET AL., J IMMUNO, vol. 168, no. 7, 2002, pages 3419 - 3427
ROGUSKA ET AL., PNAS, vol. 91, 1994, pages 969 - 973
ROGUSKA ET AL., PROTEIN ENG., vol. 9, no. 10, 1996, pages 895 904
SAIF ET AL., ARCH VIROL SUPPL., vol. 12, 1996, pages 153 - 61
SALKOWSKI; BALISH, INFECT IMMUN., vol. 58, no. 10, 1990, pages 3300 - 6
SAMBROOK ET AL.: "Molecular Cloning, A Laboratory Manual(2d ed.)", 1989, COLD SPRING HARBOR PRESS
SAMBROOK: "Molecular Cloning, A Laboratory Manual(2d ed.),", 1989, COLD SPRING HARBOR PRESS
SAMBROOK: "Molecular Cloning, A Laboratory Manual, Second Edition", vol. I, 1985
SANDHU JS, GENE, vol. 150, no. 2, 1994, pages 409 - 10
SANI, NATURE, vol. 314, 1985, pages 283 - 286
SAUDEK ET AL., N. ENGL. J. MED., vol. 321, 1989, pages 574
SAUERMANN, CURR MOL MED, vol. 1, no. 4, 2001, pages 515 - 22
SAWADA ET AL., J. EXP. MED., vol. 187, 1998, pages 1439 - 1449
SCHEIBENBOGEN ET AL., INT. J. CANCER, vol. 71, 1997, pages 932 - 936
SCHELD, J ANTIMICROB CHEMOTHER., vol. 20, 1987, pages 71 - 85
SCHITO ET AL., CURR. HIV RES., vol. 4, 2006, pages 379 - 386
SCHWARTZ, J. C.; ZHANG, X.; FEDOROV, A. A.; NATHENSON, S. G.; ALMO, S. C.: "Structural basis for co-stimulation by the human CTLA-4/B7-2 complex", NATURE, vol. 410, 2001, pages 604 - 8, XP002306812, DOI: doi:10.1038/35069112
SEFTON: "CRC Crit. Ref. Biomed. Eng.", vol. 14, pages: 201
SHARPE, A.H.; FREEMAN, G.J.: "The B7-CD28 superfamily", NAT REV IMMUNOL, vol. 2, 2002, pages 116 - 126, XP008018232, DOI: doi:10.1038/nri727
SHEPHARD ET AL., RES VET SCI, vol. 74, no. 2, 2003, pages 187 - 190
SHETTY; ANTIA, INDIAN J LEPR., vol. 68, no. 1, 1996, pages 95 - 104
SHIBUYA ET AL., MICROB PATHOG., vol. 27, no. 3, 1999, pages 123 - 31
SIDWELL ET AL., ANTIVIRAL RES., vol. 48, 2000, pages 1 - 16
SINGH ET AL., MYCOPATHOLOGIA, vol. 112, no. 3, 1990, pages 127 - 37
SKEHAN, J. NAT'1 CANCER INST., vol. 82, 1990, pages 1107 12
SMITH, CIBA FOUND SYMP., vol. 42, 1976, pages 45 - 72
SMOLEN AND BALL: "Controlled Drug Bioavailability, Drug Product Design and Performance", 1984, WILEY
STOTLAND ET AL., PEDIATR PULMONOL., vol. 30, no. 5, 2000, pages 413 - 24
STUDNICKA ET AL., PROTEIN ENGINEERING, vol. 7, no. 6, 1994, pages 805 - 814
SUGIYAMA ET AL., J GASTROENTEROL., vol. 37, no. 13, 2002, pages 6 - 9
SWALLOW ET AL., IMMUNITY, vol. 11, 1999, pages 423 - 432
SWALLOW, M. M.; WALLIN, J. J.; SHA, W. C.: "B7h, a novel costimulatory homolog of B7.1 and B7.2, is induced by TNFalpha", IMMUNITY, vol. 11, 1999, pages 423 - 32, XP000971265
SWANN ET AL., CURRENT OPINION IN IMMUNOLOGY, vol. 20, 2008, pages 493 - 499
SWIFT ET AL., CELL, vol. 38, 1984, pages 639 - 646
TAFURI ET AL., NATURE, vol. 409, 2001, pages 105 - 109
TAFURI, A. ET AL.: "ICOS is essential for effective T-helper-cell responses", NATURE, vol. 409, 2001, pages 105 - 9, XP002221370, DOI: doi:10.1038/35051113
TAMURA, H.; DONG, H.; ZHU, G.; SICA, G.L.; FLIES, D.B.; TAMADA, K.; CHEN, L.: "B7-H1 costimulation preferentially enhances CD28-independent T-helper cell function", BLOOD, vol. 97, 2001, pages 1809 - 1816, XP002958254, DOI: doi:10.1182/blood.V97.6.1809
TAN ET AL., J. IMMUNOL., vol. 169, 2002
TAYLOR-ROBINSON, INFECTION., vol. 4, no. 1, 1976, pages 4 - 8
TEICHER: "Anticancer Drug Development Guide", 1997
TEMANN ET AL., J EXP MED, vol. 188, no. 7, 1998, pages 1307 - 1320
TESCIUBA ET AL., J. IMMUNOL., vol. 167, 2001, pages 1996 - 2003
THORPE ET AL., IMMUNOL. REV., vol. 62, 1982, pages 119 - 58
THORPE ET AL.: "Monoclonal Antibodies 84: Biological And Clinical Applications", 1985, article "Antibody Carriers Of Cytotoxic Agents In Cancer Therapy: A Review", pages: 475 - 506
TILESI ET AL., CURR OPIN MOL THER., vol. 11, no. 2, 2009, pages 156 - 64
TOMKINSON ET AL., J. IMMUNOL., vol. 166, 2001, pages 5792 - 5800
TRAUNECKER ET AL., NATURE, vol. 331, 1988, pages 84 - 86
TREAT ET AL.: "Liposomes in the Therapy of Infectious Disease and Bacterial infection", 1989, LISS, pages: 353 365
UCHIDA ET AL., JPN J ANTIBIOT., vol. 47, no. 10, 1994, pages 1407 - 12
VAN DER MERWE, P.A.; BODIAN, D.L.; DAENKE, S.; LINSLEY, P.; DAVIS, S.J.: "CD80 (B7-1) binds both CD28 and CTLA-4 with a low affinity and very fast kinetics", J EXP MED, vol. 185, 1997, pages 393 - 403, XP002584319
VAN DER MERWE; P. A., BODIAN; D. L., DAENKE, S.; LINSLEY, P.; DAVIS, S. J.: "CD80 (B7-1) binds both CD28 and CTLA-4 with a low affinity and very fast kinetics", J EXP MED, vol. 185, 1997, pages 393 - 403, XP002584319
VASSALLO ET AL., AM J RESPIR CELL MOL BIOL, vol. 25, no. 2, 2001, pages 203 - 211
VENTER, J.C.; ADAMS, M.D.; MYERS, E.W.; LI, P.W.; MURAL, R.J.; SUTTON, G.G.; SMITH, H.O.; YANDELL, M.; EVANS, C.A.; HOLT, R.A. ET: "The sequence of the human genome.", SCIENCE, vol. 291, 2001, pages 1304 - 1351, XP001061683, DOI: doi:10.1126/science.1058040
VIERLING, BEST PRACT RES CLIN GASTROENTEROL., vol. 15, no. 4, 2001, pages 591 - 610
VILLA-KAMAROFF ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 75, 1978, pages 3727 - 3731
VRIESENDORP, J INFECT DIS., vol. 176, no. 2, 1997, pages 164 - 8
WAGNER ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 78, 1981, pages 1441 - 1445
WALNUS ET AL., IMMUNITY, vol. 1, 1994, pages 405 - 413
WALUNAS, T. L. ET AL.: "CTLA-4 can function as a negative regulator of T cell activation", IMMUNITY, vol. 1, 1994, pages 405 - 13, XP027463746, DOI: doi:10.1016/1074-7613(94)90071-X
WALUNAS, T.L.; LENSCHOW, D.J.; BAKKER, C.Y.; LINSLEY, P.S.; FREEMAN, G.J.; GREEN, J.M.; THOMPSON, C.B.; BLUESTONE, J.A.: "CTLA-4 can function as a negative regulator of T cell activation", IMMUNITY, vol. 1, 1994, pages 405 - 413, XP027463746, DOI: doi:10.1016/1074-7613(94)90071-X
WANG ET AL., INT J PANCREATOL, vol. 29, no. 1, 2001, pages 37 - 46
WANG, CURR TOP MICROBIOL IMMUNOL., vol. 258, 2001, pages 201 - 19
WANG, S. ET AL.: "Costimulation of T cells by B7-H2, a B7-like molecule that binds ICOS", BLOOD, vol. 96, 2000, pages 2808 - 13, XP002156742
WANG, S. ET AL.: "Molecular modeling and functional mapping of B7-H and B7-DC uncouple costimulatory function from PD-1 interaction", J EXP MED, vol. 197, 2003, pages 1083 - 91, XP002517347, DOI: doi:10.1084/JEM.20021752
WANG, S.; BAJORATH, J.; FLIES, D.B; DONG, H.; HONJO, T.; CHEN, L.: "Molecular modeling and functional mapping of B7-H1 and B7-DC uncouple costimulatory function from PD-1 interaction", J EXP MED, vol. 197, 2003, pages 1083 - 1091, XP002517347, DOI: doi:10.1084/JEM.20021752
WHITE ET AL., BRAIN PATHOL, vol. 11, no. 4, 2001, pages 475 - 9
WICHER; WICHER, CRIT REV MICROBIOL., vol. 16, no. 3, 1989, pages 181 - 234
WILDER ET AL., AM J RESPIR CELL MOL BIOL, vol. 26, no. 3, 2002, pages 304 - 314
WILLIAMS ET AL., J INFECT DIS., vol. 178, no. 4, 1988, pages 1217 - 21
WILSON ET AL., CELL, vol. 37, 1984, pages 767
WINTER C. A. ET AL.: "Carrageenan Induced Edema in Hind Paw of the Rat as an Assay for Anti-inflammatory Drugs", PROC. SOC. EXP. BIOL MED., vol. 111, 1962, pages 544 - 547
WU ET AL., GASTROENTEROLOGY, vol. 128, 2005, pages 1416 - 1423
YAMAGATA ET AL., J CLIN MICROBIOL., vol. 38, no. 9, 2000, pages 32606
YAMAMOTO ET AL., CELL, vol. 22, 1980, pages 787 - 797
YONEZAWA ET AL., J INFECT CHEMOTHER, vol. 6, no. 3, 2000, pages 155 - 161
YOSHIDA, KANSENSHOGAKU ZASSHI., vol. 72, no. 6, June 1998 (1998-06-01), pages 621 - 30
YOSHINAGA ET AL., NATURE, vol. 402, 1999, pages 827 - 832
YOSHINAGA, S. K. ET AL.: "T-cell co-stimulation through B7RP-1 and ICOS", NATURE, vol. 402, 1999, pages 827 - 32, XP002630741, DOI: doi:10.1038/45582
YOSHINAGA, S.K.; WHORISKEY, J.S.; KHARE, S.D.; SARMIENTO, U.; GUO, J.; HORAN, T.; SHIH, G.; ZHANG, M.; COCCIA, M.A.; KOHNO, T. ET: "T-cell co-stimulation through B7RP- and ICOS", NATURE, vol. 402, 1999, pages 827 - 832, XP002630741, DOI: doi:10.1038/45582
ZHANG; ROTH, IN VIVO, vol. 8, no. 5, 1994, pages 755 - 69
ZHENG; VIL ET AL., J. IMMUNOL., vol. 154, 1995, pages 5590 - 5600
ZHU ET AL., ANTIMICROBIAL AGENTS AND CHEMOTHER, vol. 50, 2006, pages 3260 - 3268

Cited By (102)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
TWI556194B (zh) * 2012-06-29 2016-11-01 希科母股份有限公司 對象檢出裝置、對象檢出方法及對象檢出用電腦程式
US9790277B2 (en) 2012-12-21 2017-10-17 The Johns Hopkins University Anti-H7CR antibodies
CN104968679B (zh) * 2012-12-21 2019-04-16 艾普利穆恩公司 抗h7cr抗体
CN104968679A (zh) * 2012-12-21 2015-10-07 艾普利穆恩公司 抗h7cr抗体
WO2014100823A1 (en) 2012-12-21 2014-06-26 Amplimmune, Inc. Anti-h7cr antibodies
RU2650756C2 (ru) * 2012-12-21 2018-04-17 МЕДИММЬЮН, ЭлЭлСи Антитела к h7cr
US20160024210A1 (en) * 2012-12-21 2016-01-28 Amplimmune, Inc. Anti-h7cr antibodies
JP2016509585A (ja) * 2012-12-21 2016-03-31 アンプリミューン, インコーポレイテッド 抗h7cr抗体
RU2691428C2 (ru) * 2012-12-21 2019-06-13 МЕДИММЬЮН, ЭлЭлСи Антитела к h7cr
AU2013363962B2 (en) * 2012-12-21 2016-11-24 Amplimmune, Inc. Anti-H7CR antibodies
AU2017201231B2 (en) * 2012-12-21 2019-02-14 Medimmune, Llc ANTI-H7CR Antibodies
US20160002337A1 (en) * 2013-03-01 2016-01-07 Albert Einstein College Of Medicine Of Yeshiva University Hhla2 as a novel inhibitor of human immune system and uses thereof
US10093737B2 (en) * 2013-03-01 2018-10-09 Albert Einstein College Of Medicine, Inc. HHLA2 as a novel inhibitor of human immune system and uses thereof
US11261253B2 (en) 2013-03-01 2022-03-01 Albert Einstein College Of Medicine HHLA2 as a novel inhibitor of human immune system and uses thereof
CN106414489A (zh) * 2013-05-24 2017-02-15 米迪缪尼有限公司 抗-b7-h5抗体及其用途
WO2014190356A3 (en) * 2013-05-24 2015-04-23 Amplimmune, Inc. Anti-b7-h5 antibodies and their uses
WO2014190356A2 (en) 2013-05-24 2014-11-27 Amplimmune, Inc. Anti-b7-h5 antibodies and their uses
AU2014268298B2 (en) * 2013-05-24 2019-01-17 Medlmmune, Llc Anti-B7-H5 antibodies and their uses
US10316092B2 (en) 2013-05-24 2019-06-11 The John Hopkins University Anti-B7-H5 antibodies and their uses
US11773175B2 (en) 2014-03-04 2023-10-03 Kymab Limited Antibodies, uses and methods
US11753479B2 (en) 2014-03-04 2023-09-12 Kymab Limited Nucleic acids encoding anti-OX40L antibodies
US10280208B2 (en) 2014-04-30 2019-05-07 Albert Einstein College Of Medicine TMIGD2 and its derivatives as blockers or binders of cancer-expressed HHLA2 for immunotherapies
US20190263886A1 (en) * 2014-04-30 2019-08-29 Albert Einstein College Of Medicine Tmigd2 and its derivatives as blockers or binders of cancer-expressed hhla2 for immunotherapies
US10882893B2 (en) 2014-04-30 2021-01-05 Albert Einstein College Of Medicine TMIGD2 and its derivatives as blockers or binders of cancer-expressed HHLA2 for immunotherapies
US20210388052A1 (en) * 2014-04-30 2021-12-16 Albert Einstein College Of Medicine Tmigd2 and its derivatives as blockers or binders of cancer-expressed hhla2 for immunotherapies
WO2015167948A1 (en) * 2014-04-30 2015-11-05 Albert Einstein College Of Medicine Of Yeshiva University Tmigd2 and its derivatives as blockers or binders of cancer-expressed hhla2 for immunotherapies
EP3152222A4 (en) * 2014-06-04 2017-11-01 NGM Biopharmaceuticals, Inc. Compositions and methods for targeting a pathway
AU2016235362B2 (en) * 2015-03-23 2021-12-16 Jounce Therapeutics, Inc. Antibodies to ICOS
EP3735986A1 (en) * 2015-03-23 2020-11-11 Jounce Therapeutics, Inc. Antibodies to icos
US10023635B2 (en) 2015-03-23 2018-07-17 Jounce Therapeutics, Inc. Antibodies to ICOS
EP3273992A4 (en) * 2015-03-23 2018-05-02 Jounce Therapeutics, Inc. Antibodies to icos
CN107530428B (zh) * 2015-03-23 2022-05-13 震动疗法股份有限公司 Icos的抗体
US10570203B2 (en) 2015-03-23 2020-02-25 Jounce Therapeutics, Inc. Antibodies to ICOS
CN107530428A (zh) * 2015-03-23 2018-01-02 震动疗法股份有限公司 Icos的抗体
WO2016168771A3 (en) * 2015-04-17 2016-12-01 Alpine Immune Sciences, Inc. Immunomodulatory proteins with tunable affinities
CN107969128A (zh) * 2015-04-17 2018-04-27 高山免疫科学股份有限公司 具有可调的亲和力的免疫调节蛋白
US11319359B2 (en) 2015-04-17 2022-05-03 Alpine Immune Sciences, Inc. Immunomodulatory proteins with tunable affinities
EP3875477A1 (en) * 2015-04-17 2021-09-08 Alpine Immune Sciences, Inc. Immunomodulatory proteins with tunable affinities
US12486312B2 (en) 2015-04-17 2025-12-02 Alpine Immune Sciences, Inc. Immunomodulatory proteins with tunable affinities
USRE50880E1 (en) 2015-04-30 2026-05-05 Kymab Limited Anti-human OX40L antibodies and methods of treatment
US11230587B2 (en) 2015-05-27 2022-01-25 Università Degli Studi del Piemonte Orientale “Amedeo Avogadro” Ligands of B7H receptor in the treatment of osteopenia and osteoporosis
US11267889B2 (en) 2015-05-29 2022-03-08 Agenus Inc. Anti-CTLA-4 antibodies and methods of use thereof
US10144779B2 (en) 2015-05-29 2018-12-04 Agenus Inc. Anti-CTLA-4 antibodies and methods of use thereof
US12492257B2 (en) 2015-05-29 2025-12-09 Agenus Inc. Anti-CTLA-4 antibodies and methods of use thereof
US10479833B2 (en) 2015-05-29 2019-11-19 Agenus Inc. Anti-CTLA-4 antibodies and methods of use thereof
US10968277B2 (en) 2015-10-22 2021-04-06 Jounce Therapeutics, Inc. Gene signatures for determining ICOS expression
US12110339B2 (en) 2016-04-15 2024-10-08 Alpine Immune Sciences, Inc. ICOS ligand variant immunomodulatory proteins and uses thereof
US11078282B2 (en) 2016-04-15 2021-08-03 Alpine Immune Sciences, Inc. CD80 variant immunomodulatory proteins and uses thereof
US11498967B2 (en) 2016-04-15 2022-11-15 Alpine Immune Sciences, Inc. CD80 variant immunomodulatory proteins and uses thereof
US11359022B2 (en) 2016-04-15 2022-06-14 Alpine Immune Sciences, Inc. CD80 variant immunomodulatory proteins and uses thereof
US11479609B2 (en) 2016-04-15 2022-10-25 Alpine Immune Sciences, Inc. CD80 variant immunomodulatory proteins and uses thereof
US10882914B2 (en) 2016-04-15 2021-01-05 Alpine Immune Sciences, Inc. ICOS ligand variant immunomodulatory proteins and uses thereof
WO2017220989A1 (en) 2016-06-20 2017-12-28 Kymab Limited Anti-pd-l1 and il-2 cytokines
WO2017220988A1 (en) 2016-06-20 2017-12-28 Kymab Limited Multispecific antibodies for immuno-oncology
US11965026B2 (en) 2016-06-20 2024-04-23 Kymab Limited Anti-PD-L1 and IL-2 cytokines
WO2017220990A1 (en) 2016-06-20 2017-12-28 Kymab Limited Anti-pd-l1 antibodies
US12209128B2 (en) 2016-06-20 2025-01-28 Kymab Limited Anti-PD-L1 antibodies
US9957323B2 (en) 2016-06-20 2018-05-01 Kymab Limited Anti-ICOS antibodies
US10604576B2 (en) 2016-06-20 2020-03-31 Kymab Limited Antibodies and immunocytokines
US11834490B2 (en) 2016-07-28 2023-12-05 Alpine Immune Sciences, Inc. CD112 variant immunomodulatory proteins and uses thereof
US12624087B2 (en) 2016-07-28 2026-05-12 Alpine Immune Sciences, Inc. CD155 variant immunomodulatory proteins and uses thereof
US11471488B2 (en) 2016-07-28 2022-10-18 Alpine Immune Sciences, Inc. CD155 variant immunomodulatory proteins and uses thereof
US11858996B2 (en) 2016-08-09 2024-01-02 Kymab Limited Anti-ICOS antibodies
WO2018029474A2 (en) 2016-08-09 2018-02-15 Kymab Limited Anti-icos antibodies
US11779604B2 (en) 2016-11-03 2023-10-10 Kymab Limited Antibodies, combinations comprising antibodies, biomarkers, uses and methods
US11638755B2 (en) 2016-12-07 2023-05-02 Agenus Inc. Anti-CTLA-4 antibodies and methods of use thereof
US12246066B2 (en) 2016-12-07 2025-03-11 Agenus Inc. Anti-CTLA-4 antibodies and methods of use thereof
US11013802B2 (en) 2016-12-07 2021-05-25 Agenus Inc. Anti-CTLA-4 antibodies and methods of use thereof
US10912831B1 (en) 2016-12-07 2021-02-09 Agenus Inc. Anti-CTLA-4 antibodies and methods of use thereof
US11732022B2 (en) 2017-03-16 2023-08-22 Alpine Immune Sciences, Inc. PD-L2 variant immunomodulatory proteins and uses thereof
US11440960B2 (en) 2017-06-20 2022-09-13 Kymab Limited TIGIT antibodies, encoding nucleic acids and methods of using said antibodies in vivo
US11306144B2 (en) 2017-08-25 2022-04-19 Five Prime Therapeutics, Inc. B7-H4 antibodies and methods of use thereof
US11814431B2 (en) 2017-08-25 2023-11-14 Five Prime Therapeutics, Inc. B7-H4 antibodies and methods of use thereof
US11753458B2 (en) 2017-10-10 2023-09-12 Alpine Immune Sciences, Inc. CTLA-4 variant immunomodulatory proteins and uses thereof
US12612446B2 (en) 2017-10-10 2026-04-28 Alpine Immune Sciences, Inc. CTLA-4 variant immunomodulatory proteins and uses thereof
US12358969B2 (en) 2017-10-10 2025-07-15 Alpine Immune Sciences, Inc. CTLA-4 variant immunomodulatory proteins and uses thereof
JP7530457B2 (ja) 2017-10-18 2024-08-07 アルパイン イミューン サイエンシズ インコーポレイテッド バリアントicosリガンド免疫調節タンパク質ならびに関連する組成物および方法
JP7863589B2 (ja) 2017-10-18 2026-05-21 アルパイン イミューン サイエンシズ インコーポレイテッド バリアントicosリガンド免疫調節タンパク質ならびに関連する組成物および方法
JP2023055821A (ja) * 2017-10-18 2023-04-18 アルパイン イミューン サイエンシズ インコーポレイテッド バリアントicosリガンド免疫調節タンパク質ならびに関連する組成物および方法
CN111712515A (zh) * 2017-10-18 2020-09-25 高山免疫科学股份有限公司 变体icos配体免疫调节蛋白及相关组合物和方法
JP2021500024A (ja) * 2017-10-18 2021-01-07 アルパイン イミューン サイエンシズ インコーポレイテッド バリアントicosリガンド免疫調節タンパク質ならびに関連する組成物および方法
JP2024103596A (ja) * 2017-10-18 2024-08-01 アルパイン イミューン サイエンシズ インコーポレイテッド バリアントicosリガンド免疫調節タンパク質ならびに関連する組成物および方法
US11613566B2 (en) 2017-10-18 2023-03-28 Alpine Immune Sciences, Inc. Variant ICOS ligand immunomodulatory proteins and related compositions and methods
JP7282760B2 (ja) 2017-10-18 2023-05-29 アルパイン イミューン サイエンシズ インコーポレイテッド バリアントicosリガンド免疫調節タンパク質ならびに関連する組成物および方法
WO2019079520A3 (en) * 2017-10-18 2019-05-23 Alpine Immune Sciences, Inc. Variant icos ligand immunomodulatory proteins and related compositions and methods
WO2019122884A1 (en) 2017-12-19 2019-06-27 Kymab Limited Antibodies to icos
US12404330B2 (en) 2017-12-19 2025-09-02 Kymab Limited Antibodies to ICOS
US11629189B2 (en) 2017-12-19 2023-04-18 Kymab Limited Bispecific antibody for ICOS and PD-L1
US12297253B2 (en) 2018-01-03 2025-05-13 Alpine Immune Sciences, Inc. Multi-domain immunomodulatory proteins and methods of use thereof
US12435145B2 (en) 2018-02-21 2025-10-07 Five Prime Therapeutics, Inc. B7-H4 antibody formulations
US11939383B2 (en) 2018-03-02 2024-03-26 Five Prime Therapeutics, Inc. B7-H4 antibodies and methods and use thereof
IL276746B1 (en) * 2018-04-06 2026-02-01 Dana Farber Cancer Inst Inc Kir3dl3 as a hhla2 receptor, anti-hhla2 antibodies and their uses
US12103972B2 (en) 2018-04-06 2024-10-01 Dana-Farber Cancer Institute, Inc. KIR3DL3 as an HHLA2 receptor, anti-HHLA2 antibodies, and uses thereof
EP3773658A4 (en) * 2018-04-06 2022-04-27 Dana-Farber Cancer Institute, Inc. KIR3DL3 AS HLA2 RECEPTOR, ANTI-HHLA2 ANTIBODY AND ITS USES
AU2019257249B2 (en) * 2018-04-06 2025-12-18 Dana-Farber Cancer Institute, Inc. KIR3DL3 as an HHLA2 receptor, anti-HHLA2 antibodies, and uses thereof
US12065476B2 (en) 2018-06-15 2024-08-20 Alpine Immune Sciences, Inc. PD-1 variant immunomodulatory proteins and uses thereof
WO2020041300A1 (en) * 2018-08-21 2020-02-27 Ngm Biopharmaceuticals, Inc. B7-h7-binding agents and methods of use thereof
US12552853B2 (en) 2018-11-30 2026-02-17 Alpine Immune Sciences, Inc. CD86 variant immunomodulatory proteins and uses thereof
US12612447B2 (en) 2020-05-08 2026-04-28 Alpine Immune Sciences, Inc. April and BAFF inhibitory immunomodulatory proteins and methods of use thereof
WO2021229032A1 (en) 2020-05-14 2021-11-18 Kymab Limited Tumour biomarkers for immunotherapy
WO2022243378A1 (en) 2021-05-18 2022-11-24 Kymab Limited Uses of anti-icos antibodies
WO2022254227A1 (en) 2021-06-04 2022-12-08 Kymab Limited Treatment of pd-l1 negative or low expressing cancer with anti-icos antibodies

Also Published As

Publication number Publication date
JP5883384B2 (ja) 2016-03-15
US20160024211A1 (en) 2016-01-28
US20120219559A1 (en) 2012-08-30
AU2010282340B2 (en) 2016-12-22
JP2013501814A (ja) 2013-01-17
EP2464661A2 (en) 2012-06-20
AU2010282340A1 (en) 2012-03-01
US9676856B2 (en) 2017-06-13
AU2016266078A1 (en) 2016-12-22
ES2666152T3 (es) 2018-05-03
US20160002336A1 (en) 2016-01-07
EP2464661B1 (en) 2018-01-17
US8840889B2 (en) 2014-09-23
CA2769822A1 (en) 2011-02-17
WO2011020024A3 (en) 2011-06-23
CA2769822C (en) 2019-02-19
EP3381937A2 (en) 2018-10-03
EP3381937A3 (en) 2018-10-31

Similar Documents

Publication Publication Date Title
EP2464661A2 (en) Methods of modulating immune function
JP7531545B2 (ja) インターロイキン-21ムテイン及び治療方法
US11958893B2 (en) Methods for modulating an immune response
EP3515478B1 (en) Antibodies for siglec-15 and methods of use thereof
EP2724728B1 (en) Complexes of il-15 and il-15r alpha and uses thereof
JP2011513479A (ja) モノクローナル抗体、及びその(therof)方法
KR20240082387A (ko) 암을 치료하기 위한 항 pd-1 항체와 조합된 pd-l1 및 cd137에 대한 다중특이적 결합제
HK1261775A1 (en) Methods of modulating immune function
HK40076582A (en) Interleukin-21 muteins and methods of treatment
HK1171459A (en) Methods of modulating immune function with anti-b7-h7cr antibodies
HK1171459B (en) Methods of modulating immune function with anti-b7-h7cr antibodies
HK40076582B (en) Interleukin-21 muteins and methods of treatment
HK40029717B (en) Interleukin-21 muteins and methods of treatment
HK40029717A (en) Interleukin-21 muteins and methods of treatment
EA042111B1 (ru) Способы модулирования иммунного ответа
HK1143084B (en) Complexes of il-15 and il-15ralpha and uses thereof

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 10744821

Country of ref document: EP

Kind code of ref document: A2

WWE Wipo information: entry into national phase

Ref document number: 2769822

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 2010282340

Country of ref document: AU

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 2012524903

Country of ref document: JP

ENP Entry into the national phase

Ref document number: 2010282340

Country of ref document: AU

Date of ref document: 20100813

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 2010744821

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 13390054

Country of ref document: US