WO2010131185A1 - Blocking anti-dkk-1 antibodies and their uses - Google Patents

Blocking anti-dkk-1 antibodies and their uses Download PDF

Info

Publication number
WO2010131185A1
WO2010131185A1 PCT/IB2010/052056 IB2010052056W WO2010131185A1 WO 2010131185 A1 WO2010131185 A1 WO 2010131185A1 IB 2010052056 W IB2010052056 W IB 2010052056W WO 2010131185 A1 WO2010131185 A1 WO 2010131185A1
Authority
WO
WIPO (PCT)
Prior art keywords
antibody
antibodies
seq
dkk
amino acid
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/IB2010/052056
Other languages
English (en)
French (fr)
Inventor
Mei Li
Vishwas Madhav Paralkar
Jaume Pons
Donna Marie Stone
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Pfizer Inc
Rinat Neuroscience Corp
Original Assignee
Pfizer Inc
Rinat Neuroscience Corp
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to NZ596274A priority Critical patent/NZ596274A/xx
Priority to AU2010246981A priority patent/AU2010246981B2/en
Priority to MX2011012039A priority patent/MX2011012039A/es
Priority to SG2011081080A priority patent/SG175881A1/en
Priority to CN2010800316466A priority patent/CN102666584A/zh
Priority to BRPI1010540A priority patent/BRPI1010540A2/pt
Priority to KR1020117029598A priority patent/KR101471239B1/ko
Priority to RU2011145435/10A priority patent/RU2548817C2/ru
Priority to EP10721057A priority patent/EP2430048A1/en
Priority to JP2012510415A priority patent/JP2012526542A/ja
Application filed by Pfizer Inc, Rinat Neuroscience Corp filed Critical Pfizer Inc
Priority to CA2761696A priority patent/CA2761696A1/en
Publication of WO2010131185A1 publication Critical patent/WO2010131185A1/en
Priority to IL216304A priority patent/IL216304A0/en
Priority to ZA2011/08310A priority patent/ZA201108310B/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/02Stomatological preparations, e.g. drugs for caries, aphtae, periodontitis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00Drugs for skeletal disorders
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00Drugs for skeletal disorders
    • A61P19/02Drugs for skeletal disorders for joint disorders, e.g. arthritis, arthrosis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00Drugs for skeletal disorders
    • A61P19/08Drugs for skeletal disorders for bone diseases, e.g. rachitism, Paget's disease
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00Drugs for skeletal disorders
    • A61P19/08Drugs for skeletal disorders for bone diseases, e.g. rachitism, Paget's disease
    • A61P19/10Drugs for skeletal disorders for bone diseases, e.g. rachitism, Paget's disease for osteoporosis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P29/00Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/12Drugs for disorders of the metabolism for electrolyte homeostasis
    • A61P3/14Drugs for disorders of the metabolism for electrolyte homeostasis for calcium homeostasis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/11DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/70Vectors or expression systems specially adapted for E. coli
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/85Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/33Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565Complementarity determining region [CDR]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/567Framework region [FR]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value

Definitions

  • Wnt/LRP5 regulates bone mass and, that, activation of the Wnt signaling pathway leads to accrual of bone mass.
  • Wnt signaling is tightly regulated by antagonists, which include secreted molecules such as Dickkopf 1 (Dkk-1 ). Tian, E. et al . (2003) N Engl J Med 349:2483-2494.
  • Dkk-1 a useful target for the treatment of diseases or conditions where increased osteoblastic activity (increased bone mass density, increased bone formation without a corresponding increase in bone resorption) would be advantageous to the patient, including, for example, by reducing the number of fractures that occur, e.g., as a result of untreated osteoporosis.
  • WO2006/015373 discloses antibodies to Dkk-1 to treat various diseases, including bone disorders.
  • US2008/0193449 discloses antibodies specific for Dkk-1 which inhibit binding of Dkk-1 to LRP5, compositions comprising such antibodies for stimulating bone growth, and compositions comprising such antibodies for treating bone disorders such as osteoporosis.
  • the present invention relates to antibodies and fragments (e.g., antigen binding portions) thereof that bind to Dkk-1 and, in particular, to humanized antibodies and fragments thereof that bind to Dkk-1 and, even more particularly to fully humanized antibodies and immunologically functional fragments fragments that bind to Dkk-1.
  • the antibodies and fragments thereof antagonize the ability of Dkk-1 to inhibit Wnt activity.
  • the antibodies and immunologically functional fragments thereof antagonize the ability of Dkk-1 to inhibit the Wnt signaling pathway in bone with a corresponding increase in bone mass.
  • the antibodies and immunologically functional fragments thereof include antibodies with a naturally occurring structure, as well as polypeptides that have an antigen binding domain (e.g., domain antibody).
  • the antibodies and immunologically functional fragments thereof can be used to treat a variety of diseases, conditions and disorders, including those relating to a loss of bone mass, such as osteoporosis.
  • the antibodies and immunologically functional fragments thereof can also be used to treat diseases, conditions, or disorders relating to secondary bone loss, such as, bone loss resulting from or attendant to, for example, chronic treatment with corticosteroids, aromatase inhibitors, or thiazolidinethiones (TZDs); anorexia; or bone loss related to hypogonadism or renal osteodystrophy.
  • Some of the antibodies and functional fragments thereof that are provided include: (a) one or more light chain (LC) complementarity determining regions (CDRs) selected from the group consisting of:
  • CDR3 with at least 80% sequence identity to SEQ ID NO: 26;
  • CDRs one or more heavy chain (HC) complementarity determining regions (CDRs) selected from the group consisting of:
  • LCs and HCs of further provided antibodies and immunologically functional fragments thereof have at least 90% sequence identity to the foregoing sequences.
  • antibodies and immunologically functional fragments thereof that have a LC in which CDR1 has the amino acid sequence as set forth in SEQ ID NO: 22, CDR2 has the amino acid sequence as set forth in SEQ ID NO: 24 and/or CDR3 has the amino acid sequence as set forth in SEQ ID NO: 26.
  • antibodies and immunologically functional fragments thereof that have a HC in which CDR1 has the amino acid sequence as set forth in SEQ ID NO: 30, 49 or 50, CDR2 has the amino acid sequence as set forth in SEQ ID NO: 32 or 51 and/or CDR3 has the amino acid sequence as set forth in SEQ ID NO: 34 or 52.
  • antibodies and immunologically functional fragments thereof that have a LC in which CDR1 has the amino acid sequence as set forth in SEQ ID NO: 22, CDR2 has the amino acid sequence as set forth in SEQ ID NO: 24 and/or CDR3 has the amino acid sequence as set forth in SEQ ID NO: 26, and a HC in which CDR1 has the amino acid sequence as set forth in SEQ ID NO: 30, 49 or 50, CDR2 has the amino acid sequence as set forth in SEQ ID NO: 32 or 51 and/or CDR3 has the amino acid sequence as set forth in SEQ ID NO: 34 or 52.
  • antibodies and immunologically functional fragments thereof that have a LC in which CDR1 has the amino acid sequence as set forth in SEQ
  • CDR2 has the amino acid sequence as set forth in SEQ ID NO: 24 and
  • CDR3 has the amino acid sequence as set forth in SEQ ID NO: 26, and a HC in which
  • antibodies and immunologically functional fragments thereof which include: (a) a LC variable region (VL) having at least 80% sequence identity with the sequence as set forth in SEQ ID NO: 20; (b) a HC variable region (VH) having at least 80% sequence identity with the sequence as set forth in SEQ ID NO: 28; or (c) a VL of (a) and VH of (b).
  • VL LC variable region
  • VH HC variable region
  • antibodies and immunologically functional fragments thereof that are similar in structure but the VL has at least 90% sequence identity with the sequence as set forth in SEQ ID NO: 20 and the VH has at least 90% sequence identity with the sequence as set forth in SEQ ID NO: 28. Also provided are antibodies and immunologically functional fragments thereof that are similar in structure but the VL has at least 95% sequence identity with the sequence as set forth in SEQ ID NO: 20 and the VH has at least 95% sequence identity with the sequence as set forth in SEQ ID NO: 28.
  • the invention provides a humanized antibody or a fragment thereof, wherein said antibody or fragment specifically binds to human Dkk-1 antigen, wherein the CDRs of the LC variable region (CDR1 , CDR2 and CDR3) and the CDRs of the HC variable region (CDR1 , CDR2 and CDR3) have the following amino acid sequences and wherein the antibody or fragment can compete with mouse MabJC18 for binding to Dkk-1 + cells: LC: (i) CDR1 (SEQ ID NO: 22), (ii) CDR2 (SEQ ID NO: 24) and (iii) CDR3 (SEQ ID NO: 26); and HC: (i) CDR1 (SEQ ID NO: 30, 49 or 50), (ii) CDR2 (SEQ ID NO: 32 or 51 ), and (iii) CDR3 (SEQ ID NO: 34 or 52).
  • LC (i) CDR1 (SEQ ID NO: 22), (ii) CDR2 (SEQ ID NO: 24) and (
  • the invention also provides a humanized antibody or a fragment thereof, wherein said antibody or fragment specifically binds to human DKK-1 antigen, wherein the complementarity determining regions (CDR1 , CDR2 and CDR3) of the LC variable region and the complementarity determining regions (CDR1 , CDR2 and CDR3) of the HC variable region have the following amino acid sequences: LC: (i) CDR1 (SEQ ID NO: 22), (ii) CDR2 (SEQ ID NO: 24) and (iii) CDR3 (SEQ ID NO: 26); and HC: (i) CDR1 (SEQ ID NO: 30, 49 or 50), (ii) CDR2 (SEQ ID NO: 32 or 51 ), and (iii) CDR3 (SEQ ID NO: 34 or 52), in which the variable domain framework of the LC contains the human IGKV3-11 germline framework and IGKJ4 region and the variable domain framework of the HC contains the human IGHV3-07 germline framework (with
  • the fusion protein comprises a LC variable region as set forth in SEQ ID NO: 20 and/or a HC variable region as set forth in SEQ ID NO: 28.
  • HC heavy chain complementarity determining regions
  • the nucleic acids comprise or consist of a sequence that encodes a VL and/or a VH region of an antibody or immunologically functional fragment thereof wherein the VL has at least 70%, 80%, 90% or 95% sequence identity with the sequence set forth in SEQ ID NO: 20 and the VH has at least 70%, 80%, 90% or 95% sequence identity with the sequence set forth in SEQ ID NO: 28.
  • the nucleic acids include a sequence that encodes a VL that comprises or consists of the sequence as set forth in SEQ ID NO: 20 and/or a sequence that encodes a VH that comprises or consists of a sequence as set forth in SEQ ID NO: 28.
  • the nucleic acids include sequences that encode both a VL and a VH with the foregoing sequence characteristics.
  • polynucleotides encoding any of the following: (a) huMabJC18 or its variants shown in Table 4; (b) a fragment or a region of antibody huMabJC18 or its variants shown in Table 4; (c) a light chain of antibody huMabJC18 or its variants shown in Table 4; (c) a heavy chain of antibody huMabJC18 or its variants shown in Table 4; (d) one or more variable region(s) from a LC and/or a HC of antibody huMabJC18 or its variants shown in Table 4; (e) one or more CDR(s) (one, two, three, four, five or six CDRs) of antibody huMabJC18 or its variants shown in Table 4; (f) CDR H3 from the HC of antibody huMabJC18; (g) CDR H1 from the HC of antibody huMabJC18; (h) CDR H
  • Polynucleotides complementary to any such nucleic acid sequences are also provided.
  • Polynucleotides can be single-stranded (coding or antisense) or double- stranded, and may be DNA (genomic, cDNA or synthetic) or RNA molecules.
  • RNA molecules include, e.g., HnRNA molecules, which contain introns and correspond to a DNA molecule in a one-to-one manner, and mRNA molecules, which do not contain introns. Additional coding or non-coding sequences may, but need not, be present within a provided polynucleotide, and a polynucleotide may, but need not, be linked to other molecules and/or support materials.
  • Polynucleotides are provided which can comprise a native sequence (i.e., an endogenous sequence that encodes an antibody or a portion thereof), or may comprise a variant of such a sequence.
  • Polynucleotide variants can contain one or more substitutions, additions, deletions and/or insertions such that the immunoreactivity of the encoded polypeptide is not diminished, relative to a native immunoreactive molecule.
  • Variants preferably exhibit at least about 70% identity, more preferably at least about
  • the invention also provides a DNA molecule encoding the amino acid sequence of a humanized antibody or a fragment thereof, comprising:
  • variable domain framework of the LC contains the human IGKV3-11 germline framework and IGKJ4 region.
  • the invention also provides a DNA molecule encoding the amino acid sequence of a humanized antibody or a fragment thereof, comprising:
  • LC CDRs selected from the group consisting of: (i) a CDR1 with at least 80% sequence identity to SEQ ID NO: 22;
  • the invention also provides a DNA molecule encoding the amino acid sequence of a humanized antibody or a fragment thereof, comprising:
  • LC CDRs selected from the group consisting of: (i) a CDR1 with at least 80% sequence identity to SEQ ID NO: 22;
  • variable domain framework of the LC contains the human IGKV3-11 germline framework and IGKJ4 region and the variable domain framework of the HC contains the human IGHV3-07 germline framework (with single back mutation: R100 to T) and IGHJ6 region.
  • the invention also provides a DNA molecule encoding the amino acid sequence of a humanized antibody or a fragment thereof, comprising:
  • LC CDRs selected from the group consisting of: (i) a CDR1 (SEQ ID NO: 22);
  • HC CDRs selected from the group consisting of: (i) a CDR1 (SEQ ID NO: 30, 49 or 50);
  • the nucleotide sequences of the LC CDRs are as follows: CDR1 : as set forth in SEQ ID NO: 21 CDR2: as set forth in SEQ ID NO: 23 CDR3: as set forth in SEQ ID NO: 25.
  • the nucleotide sequences of the HC CDRs are as follows: CDR1 : as set forth in SEQ ID NO: 29 CDR2: as set forth in SEQ ID NO: 31 CDR3: as set forth in SEQ ID NO: 33.
  • nucleotide sequence of the LC variable region is as set forth in SEQ ID NO: 19. In some embodiments of the DNA molecules the nucleotide sequence of the HC variable region is as set forth in SEQ ID NO: 27.
  • the nucleotide sequence of the LC is as set forth in SEQ ID NO: 37 or SEQ ID NO: 41.
  • vectors e.g., expression vectors, comprising any of the polynucleotide sequences or DNA molecules encoding the antibodies or framents thereof.
  • DNA molecule encoding the amino acid sequence of a humanized antibody or a fragment thereof, comprising:
  • DNA molecule encoding the amino acid sequence of a humanized antibody or a fragment thereof, comprising:
  • a DNA molecule encoding the amino acid sequence of a humanized antibody or a fragment thereof, comprising: (a) one or more LC CDRs selected from the group consisting of:
  • LC CDRs selected from the group consisting of: (i) a CDR1 (SEQ ID NO: 22); (ii) a CDR2 (SEQ ID NO: 24); and
  • HC CDRs selected from the group consisting of: (i) a CDR1 (SEQ ID NO: 30, 49 or 50);
  • variable domain framework of the LC contains the human IGKV3-11 germline framework and IGKJ4 region and the variable domain framework of the HC contains the human IGHV3-07 germline framework (with single back mutation: R100 to T) and IGHJ6 region, in the form of an expression vector.
  • a host transformed with an expression vector of the invention comprising a DNA molecule encoding the amino acid sequence of a humanized antibody or a fragment thereof, comprising: (a) one or more LC CDRs selected from the group consisting of:
  • HC CDRs selected from the group consisting of: (i) a CDR1 (SEQ ID NO: 30, 49 or 50);
  • HC CDRs selected from the group consisting of: (i) a CDR1 (SEQ ID NO: 30, 49 or 50);
  • HC CDRs selected from the group consisting of: (i) a CDR1 (SEQ ID NO: 30, 49 or 50);
  • LC CDRs selected from the group consisting of: (i) a CDR1 (SEQ ID NO: 22); (ii) a CDR2 (SEQ ID NO: 24); and
  • HC CDRs selected from the group consisting of: (i) a CDR1 (SEQ ID NO: 30, 49 or 50);
  • HC CDRs selected from the group consisting of: (i) a CDR1 (SEQ ID NO: 30, 49 or 50); (ii) a CDR2 (SEQ ID NO: 32 or 51 ); and
  • a method for producing a humanized antibody or fragment thereof comprising culturing a host cell comprising a recombinant expression system encoding the LC and HC of a humanized antibody or a fragment thereof, wherein said antibody or fragment specifically binds to human Dkk-1 antigen, and wherein the CDRs of the LC and the HC have the following amino acid sequences:
  • LC CDRs selected from the group consisting of: (i) a CDR1 (SEQ ID NO: 22);
  • the invention also provides a method of treating or preventing a loss of bone mass comprising administering to a patient in need thereof an effective amount of the humanized antibodies and fragments thereof of the invention.
  • the patient is one who suffers from cancer that metastasizes to bone.
  • the patient is one who suffers from multiple myeloma.
  • the patient is selected from patients who suffer from osteoporosis, osteopenia, Paget's Disease, periodontitis, rheumatoid arthritis, and bone loss due to immobilization.
  • the patient suffers from osteoporosis.
  • the patient suffers from an estrogen deficiency.
  • the invention also provides a method of inducing increased bone mass comprising administering to a patient in need thereof an effective amount of the humanized antibodies and fragments thereof of the invention.
  • the patient is one who suffers from cancer that metastasizes to bone.
  • the patient is one who suffers from multiple myeloma.
  • the patient is selected from patients who suffer from osteoporosis, osteopenia, Paget's Disease, periodontitis, rheumatoid arthritis, and bone loss due to immobilization.
  • the patient suffers from osteoporosis.
  • the patient is a bone graft recipient or one who suffers from a bone fracture.
  • the patient has secondary bone loss due to: chronic treatment with corticosteroids, aromatase inhibitors, or TZDs; anorexia; or caused by hypogonadism or renal osteodystrophy.
  • the invention also provides a method of inducing Wnt activity comprising administering to a patient in need thereof an effective amount of a humanized antibody or a fragment thereof of the invention.
  • the invention also provides anti-Dkk-1 neutralizing monoclonal antibodies and immunologically functional fragments thereof.
  • the antibody or fragment thereof binds to human Dkk-1 with a Kd of ⁇ 100pM.
  • the antibody or fragment thereof antagonizes the action of Dkk-1 with an IC 5 O ⁇ 100 nM in functional cell-based assays.
  • the antibody or fragment thereof has a predicted human exposure profile expected to increase Bone Mineral Density (BMD) measurements after once-a-month dosing of £250 mg.
  • BMD Bone Mineral Density
  • kits comprising the antibodies and/or fragments thereof provided by the invention, or comprising the pharmaceutical compositions provided by the invention.
  • the kit further includes instructions for how to prepare the antibody or fragment and/or how to administer the antibody or fragment.
  • the kit is used as a diagnostic to determine whether a patient has the ability to increase bone mass by inhibiting the Wnt signaling pathway.
  • E.coli DH5 ⁇ carrying plasmid that has the HC variable region of huMabJC18 was deposited: pCR2.1 TOPO from E. coli in host E. coli DH5 ⁇ , UC 25553, ATCC Patent Deposit Designation PTA-9835.
  • E.coli DH5 ⁇ carrying plasmid that has the LC variable region of huMabJC18 was deposited: pCR2.1 TOPO from E. coli in host E. coli DH5 ⁇ , UC 25554, ATCC Patent Deposit Designation PTA- 9836. All restrictions on the availability to the public of the plasmids so deposited will be irrevocably removed upon the issuance of a patent from the specification of the present invention.
  • Figures 1A and 1 B show the effect of anti-mouse Dkk-1 monoclonal antibody (JC18) in an intact mouse model.
  • Total BMD of distal femurs was significantly increased by JC18 treatment at all dose levels ( Figure 1A).
  • JC18 also increased bone formation rates significantly at 60mg/kg dose level in mice ( Figure 1 B).
  • FIG. 3 shows that JC18 prevented bone loss induced by estrogen deficiency in OVX mouse model.
  • the mice treated with vehicle exhibited osteopenia at 8 weeks post-OVX as demonstrated by a significant decrease in total BMD.
  • the total BMD was not only higher than vehicle-treated OVX mice but also maintained at the sham control level, indicating that at this dose and dosing regimen JC18 completely prevented the development of osteopenia in OVX mice.
  • Figure 5 shows a Target Mediated Drug Disposition (TMDD) Model.
  • Figure 6 shows a graph of serum concentrations of V5-His tagged h-DKK-1 in rat following single intravenous administration at 1 , 5, 10 and 100ug/kg. At time points > 0.5 hr at 0.001 mg/kg, > 1 hr at 0.005mg/kg and > 2hr at 0.01 and 0.1 mg/kg samples were below the quantifiable limit of the assay method and were not included in the plot.
  • Figure 13 shows a graph of predicted free huMabJC18 concentrations in humans following subcutaneous administration of huMabJC18 1 /month for 6 months. Three different doses were tested: 0.003mg/kg which represents 1/10 of MABEL or a no effect dose, 0.03mg/kg which represents MABEL and 3.57mg/kg which represents predicted efficacious dose for osteoporosis. Anticipated Limit of Quantitation (LOQ) of the bioanalytical assay is shown to represent the futility of dosing lower than predicted MABEL.
  • LOQ Limit of Quantitation
  • Dkk-1 as used herein includes, for example, murine and human native forms of Dkk-1.
  • Exemplary Dkk-1 protein and nucleotide sequences are disclosed, e.g., in US2006/0127393 (WO2006/015373) and US2008/0193449.
  • the term also includes variants of such native sequences that are immunologically cross-reactive with these native proteins. These proteins can inhibit the interaction between LRP5 or LRP6 with Wnt.
  • the term can also refer to a fragment of a native or variant form of Dkk-1 that contains an epitope to which an antibody can specifically bind.
  • Said modifications include base modifications such as bromouhdine and inosine derivatives, ribose modifications such as 2',3'-dideoxyribose, and internucleotide linkage modifications such as phosphorothioate, phosphorodithioate, phosphoroselenoate, phosphorodiselenoate, phosphoroanilothioate, phoshoranil-adate and phosphoroamidate.
  • the term includes both single and double stranded forms.
  • oligonucleotide means a polynucleotide comprising 200 or fewer nucleotides. In some embodiments, oligonucleotides are 10 to 60 bases in length. In other embodiments, oligonucleotides are 12, 13, 14, 15, 16, 17, 18, 19, or 20 to 40 nucleotides in length. Oligonucleotides may be single stranded or double stranded, e.g., for use in the construction of a mutant gene. Oligonucleotides of the invention may be sense or antisense oligonucleotides.
  • An oligonucleotide of the invention can include a label, including a radiolabel, a fluorescent label, a hapten or an antigenic label, for detection assays. Oligonucleotides of the invention may be used, for example, as PCR primers, cloning primers or hybridization probes.
  • An "isolated nucleic acid molecule” means a DNA or RNA of genomic, mRNA, cDNA, or synthetic origin or some combination thereof which is not associated with all or a portion of a polynucleotide in which the isolated polynucleotide is found in nature, or is linked to a polynucleotide to which it is not linked in nature.
  • nucleic acid molecule comprising a particular nucleotide sequence does not encompass intact chromosomes.
  • isolated nucleic acid molecules "comprising" specified nucleic acid sequences may include, in addition to the specified sequences, coding sequences for up to ten or even up to twenty other proteins or portions thereof, or may include operably linked regulatory sequences that control expression of the coding region of the recited nucleic acid sequences, and/or may include vector sequences.
  • the left-hand end of any single-stranded polynucleotide sequence discussed herein is the 5' end; the left-hand direction of double-stranded polynucleotide sequences is referred to as the 5' direction.
  • the direction of 5' to 3' addition of nascent RNA transcripts is referred to as the transcription direction; sequence regions on the DNA strand having the same sequence as the RNA transcript that are 5' to the 5' end of the RNA transcript are referred to as "upstream sequences"; sequence regions on the DNA strand having the same sequence as the RNA transcript that are 3' to the 3' end of the RNA transcript are referred to as "downstream sequences".
  • control sequence refers to a polynucleotide sequence that can affect the expression and processing of coding sequences to which it is ligated. The nature of such control sequences may depend upon the host organism.
  • control sequences for prokaryotes may include a promoter, a ribosomal binding site, and a transcription termination sequence.
  • control sequences for eukaryotes may include promoters comprising one or a plurality of recognition sites for transcription factors, transcription enhancer sequences, and transcription termination sequence.
  • Control sequences according to the invention can include leader sequences and/or fusion partner sequences.
  • vector means any molecule or entity (e.g., nucleic acid, plasmid, bacteriophage or virus) used to transfer protein coding information into a host cell.
  • expression vector refers to a vector that is suitable for transformation of a host cell and contains nucleic acid sequences that direct and/or control (in conjunction with the host cell) expression of one or more heterologous coding regions operatively linked thereto.
  • An expression construct may include, but is not limited to, sequences that affect or control transcription, translation, and, if introns are present, affect RNA splicing of a coding region operably linked thereto.
  • operably linked means that the components to which the term is applied are in a relationship that allows them to carry out their inherent functions under suitable conditions.
  • a control sequence in a vector that is "operably linked" to a protein coding sequence is ligated thereto so that expression of the protein coding sequence is achieved under conditions compatible with the transcriptional activity of the control sequences.
  • host cell means a cell that has been transformed, or is capable of being transformed, with a nucleic acid sequence and thereby expresses a gene of interest.
  • the term includes the progeny of the parent cell, whether or not the progeny is identical in morphology or in genetic make-up to the original parent cell, so long as the gene of interest is present.
  • transduction means the transfer of genes from one bacterium to another, usually by bacteriophage. "Transduction” also refers to the acquisition and transfer of eukaryotic cellular sequences by retroviruses.
  • transfection means the uptake of foreign or exogenous DNA by a cell, and a cell has been "transfected" when the exogenous DNA has been introduced inside the cell membrane.
  • transfection techniques are well known in the art and are disclosed herein. See, e.g., Graham et al., 1973, Virology 52:456; Sambrook et al., 2001 , Molecular Cloning: A Laboratory Manual, Id.; Davis et al., 1986, Basic Methods in Molecular Biology, Elsevier; and Chu et al., 1981 , Gene 13:197.
  • Such techniques can be used to introduce one or more exogenous DNA moieties into suitable host cells.
  • polypeptide or "protein” mean a macromolecule having the amino acid sequence of a native protein, that is, a protein produced by a naturally-occurring and non-recombinant cell, or produced by a genetically-engineered or recombinant cell, and comprise molecules having the amino acid sequence of the native protein, or molecules having deletions from, additions to, and/or substitutions of one or more amino acids of the native sequence.
  • polypeptide and protein specifically encompass anti-Dkk-1 antibodies, or sequences that have deletions from, additions to, and/or substitutions of one or more amino acid of anti-Dkk-1 antibody.
  • polypeptide fragment refers to a polypeptide that has an amino-terminal deletion, a carboxyl-terminal deletion, and/or an internal deletion as compared with the full-length native protein. Such fragments may also contain modified amino acids as compared with the native protein. In certain embodiments, fragments are about 5 to 500 amino acids long. For example, fragments may be at least 5, 6, 8, 10, 14, 20, 50, 70, 100, 110, 150, 200, 250, 300, 350, 400, or 450 amino acids long.
  • Useful polypeptide fragments for this invention include immunologically functional fragments of antibodies, including binding domains. In the case of anti-Dkk-1 antibody, useful fragments include but are not limited to a CDR region, a variable domain of a heavy or light chain, a portion of an antibody chain or just its variable region including two CDRs, and the like.
  • a "variant" of a polypeptide comprises an amino acid sequence wherein one or more amino acid residues are inserted into, deleted from and/or substituted into the amino acid sequence relative to another polypeptide sequence.
  • Variants of the invention include fusion proteins.
  • a “derivative" of a polypeptide is a polypeptide (e.g., an antibody) that has been chemically modified in some manner distinct from insertion, deletion, or substitution variants, e.g., via conjugation to another chemical moiety.
  • the term encompasses the action of, for example, lymphocytes, antigen presenting cells, phagocytic cells, granulocytes, and soluble macromolecules produced by the above cells or the liver (including antibodies, cytokines, and complement) that results in selective damage to, destruction of, or elimination from the human body of invading pathogens, cells or tissues infected with pathogens, cancerous cells, or, in cases of autoimmunity or pathological inflammation, normal human cells or tissues.
  • lymphocytes for example, lymphocytes, antigen presenting cells, phagocytic cells, granulocytes, and soluble macromolecules produced by the above cells or the liver (including antibodies, cytokines, and complement) that results in selective damage to, destruction of, or elimination from the human body of invading pathogens, cells or tissues infected with pathogens, cancerous cells, or, in cases of autoimmunity or pathological inflammation, normal human cells or tissues.
  • an “antibody” is an immunoglobulin molecule capable of specific binding to a target, such as a carbohydrate, polynucleotide, lipid, polypeptide, etc., through at least one antigen recognition site, located in the variable region of the immunoglobulin molecule.
  • a target such as a carbohydrate, polynucleotide, lipid, polypeptide, etc.
  • the term encompasses not only intact polyclonal or monoclonal antibodies, but also fragments thereof (such as Fab, Fab', F(ab')2, Fv), single chain (ScFv) and domain antibodies, including shark and camelid antibodies), and fusion proteins comprising an antibody portion, and any other modified configuration of the immunoglobulin molecule that comprises an antigen recognition site.
  • Antibodies according to the invention may be derived solely from a single source, or may be "chimeric,” that is, different portions of the antibody may be derived from two different antibodies.
  • the CDR regions may be derived from a rat or murine source, while the framework regions of the V region are derived from a different animal source, such as a human.
  • the antibodies or binding fragments of the invention may be produced in hybridomas, by recombinant DNA techniques, or by enzymatic or chemical cleavage of intact antibodies.
  • the term “antibody” includes, in addition to antibodies comprising two full-length heavy chains and two full-length light chains, derivatives, variants, fragments, and muteins thereof, examples of which are described below.
  • Light chains according to the invention include kappa chains and lambda chains.
  • a full-length heavy chain includes a variable region domain, VH, and three constant region domains, CH1 , CH2, and CH3.
  • VH domain is at the amino-terminus of the polypeptide
  • CH domains are at the carboxyl-terminus, with the CH3 being closest to the --COOH end.
  • Heavy chains according to the invention may be of any isotype, including IgG (including IgGI , lgG2, lgG3 and lgG4 subtypes), IgA (including IgAI and lgA2 subtypes), IgM an
  • the VH and VL regions can be further subdivided into regions of hypervariability, termed complementarity determining regions (CDR), interspersed with regions that are more conserved, termed framework regions (FR).
  • CDR complementarity determining regions
  • FR framework regions
  • Each VH and VL is composed of three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1 , CDR1 , FR2, CDR2, FR3, CDR3, FR4.
  • variable regions of the heavy and light chains contain a binding domain that interacts with an antigen.
  • the constant regions of the antibodies may mediate the binding of the immunoglobulin to host tissues or factors, including various cells of the immune system (e.g., effector cells) and the first component (CIq) of the classical complement system.
  • the variable and constant regions are joined by a "J" region of about 12 or more amino acids, with the heavy chain also including a "D" region of about 10 or more amino acids. See generally, Fundamental Immunology Ch. 7 (Paul, W., ed., 2 nd ed. Raven Press, N.Y. (1989)).
  • antibody portion refers to one or more fragments of an antibody that retain the ability to specifically bind to an antigen (e.g., ⁇ 5 ⁇ 1 ). It has been shown that the antigen-binding function of an antibody can be performed by fragments of a full-length antibody.
  • an "isolated antibody”, as used herein, is intended to refer to an antibody that is substantially free of other antibodies having different antigenic specificities ⁇ e.g., an isolated antibody that specifically binds Dkk-1 is substantially free of antibodies that specifically bind antigens other than Dkk-1 ).
  • An isolated antibody that specifically binds Dkk-1 may, however, have cross-reactivity to other antigens, such as Dkk-1 molecules from other species.
  • an isolated antibody may be substantially free of other cellular material and/or chemicals.
  • monoclonal antibody refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical except for possible naturally-occurring mutations that may be present in minor amounts. Monoclonal antibodies are highly specific, being directed against a single antigenic site. Furthermore, in contrast to polyclonal antibody preparations, which typically include different antibodies directed against different determinants (epitopes), each monoclonal antibody is directed against a single determinant on the antigen.
  • the modifier "monoclonal” indicates the character of the antibody as being obtained from a substantially homogeneous population of antibodies, and is not to be construed as requiring production of the antibody by any particular method.
  • the monoclonal antibodies to be used in accordance with the present invention may be made by the hybridoma method first described by Kohler and Milstein (1975) Nature 256:495, or may be made by recombinant DNA methods such as described in U.S. Pat. No. 4,816,567.
  • the monoclonal antibodies may also be isolated from phage libraries generated using the techniques described in McCafferty et al. (1990) Nature 348:552-554, for example.
  • isotype or “class” refers to the antibody class ⁇ e.g., IgM or IgG) that is encoded by the heavy chain constant region genes.
  • the constant domains of antibodies are not involved in binding to antigen, but exhibit various effector functions.
  • a given human antibody or immunoglobulin can be assigned to one of five major classes of immunoglobulins: IgA, IgD, IgE, IgG, and IgM.
  • the structures and three-dimensional configurations of different classes of immunoglobulins are well-known.
  • Fc ⁇ RII receptors include Fc ⁇ RIIA (an “activating receptor”) and Fc ⁇ RIIB (an “inhibiting receptor”), which have similar amino acid sequences that differ primarily in the cytoplasmic domains thereof.
  • Activating receptor Fc ⁇ RIIA contains an immunoreceptor tyrosine-based activation motif (ITAM) in its cytoplasmic domain.
  • Inhibiting receptor Fc ⁇ RIIB contains an immunoreceptor tyrosine- based inhibition motif (ITIM) in its cytoplasmic domain (see, Daeron, Annu. Rev. Immunol., 15:203-234 (1997)).
  • FcRs are reviewed in Ravetch and Kinet, Annu. Rev.
  • capable of inducing antibody dependent cellular cytotoxicity refers to the ability of an agent, such as an antibody, to demonstrate ADCC as measured by assay(s) known to those of skill in the art. Such activity is typically characterized by the binding of the Fc region with various FcRs.
  • an antibody to demonstrate ADCC can be, for example, by virtue of it subclass (such as IgGI or lgG3), by mutations introduced into the Fc region, or by virtue of modifications to the carbohydrate patterns in the Fc region of the antibody. Such modifications are described, for example, in U.S. Patent Application Publication No. 2007/0092521.
  • high affinity for an IgG antibody generally refers to an antibody having a K 0 of 1 x 10 "7 M or less, 5 x 10 ⁇ 8 M or less, or 5 x 10 "9 M or less for a target antigen.
  • high affinity binding can vary for other antibody isotypes.
  • “high affinity” binding for an IgM isotype refers to an antibody having a K 0 of 10 ⁇ 6 M or less, 10 ⁇ 7
  • identity refers to a relationship between the sequences of two or more polypeptide molecules or two or more nucleic acid molecules, as determined by aligning and comparing the sequences. "Percent identity” means the percent of identical residues between the amino acids or nucleotides in the compared molecules and is calculated based on the size of the smallest of the molecules being compared. For these calculations, gaps in alignments (if any) must be addressed by a particular mathematical model or computer program (i.e., an "algorithm”). Methods that can be used to calculate the identity of the aligned nucleic acids or polypeptides include those described in Computational Molecular Biology, (Lesk, A.
  • the sequences being compared are aligned in a way that gives the largest match between the sequences.
  • the computer program used to determine percent identity is the GCG program package, which includes GAP (Devereux et al. (1984) Nucl Acid Res 12:387; Genetics Computer Group, University of Wisconsin, Madison, Wise).
  • GAP is used to align the two polypeptides or polynucleotides for which the percent sequence identity is to be determined.
  • the sequences are aligned for optimal matching of their respective amino acid or nucleotide (the "matched span", as determined by the algorithm).
  • a gap opening penalty (which is calculated as 3.times.
  • Certain alignment schemes for aligning two amino acid sequences may result in matching of only a short region of the two sequences, and this small aligned region may have very high sequence identity even though there is no significant relationship between the two full-length sequences. Accordingly, the selected alignment method (GAP program) can be adjusted if so desired to result in an alignment that spans at least 50 contiguous amino acids of the target polypeptide.
  • substantially pure means that the described species of molecule is the predominant species present, that is, on a molar basis it is more abundant than any other individual species in the same mixture.
  • a substantially pure molecule is a composition wherein the object species comprises at least 50% (on a molar basis) of all macromolecular species present.
  • a substantially pure composition will comprise at least 80%, 85%, 90%, 95%, or 99% of all macromolecular species present in the composition.
  • the object species is purified to essential homogeneity wherein contaminating species cannot be detected in the composition by conventional detection methods and thus the composition consists of a single detectable macromolecular species.
  • the present invention provides novel compositions comprising antibodies and antigen-binding sites of immunoglobulins specific for Dkk-1. Some of these antibodies and antibody fragments can cross-react with Dkk-1 from several mammalian sources, including rat, mouse and human Dkk-1. Some of the antibodies and fragments have higher affinity for Dkk-1 from one species than another.
  • the invention also provides novel neutralizing antibodies, including chimeric, humanized and human antibodies, as well as antibodies and immunologically functional fragments thereof. Nucleic acids encoding the antibodies and fragments are also disclosed, as well as methods for expressing the antibodies using these nucleic acids.
  • the invention relates to molecules (e.g., immunologically functional fragments and polypeptides) that are capable of exhibiting immunological binding properties of antibody antigen-binding sites.
  • the antibodies and immunologically functional fragments that are disclosed herein have a variety of utilities. Some of the antibodies and fragments, for instance, are useful in specific binding assays, affinity purification of Dkk-1 or its ligands and in screening assays to identify other antagonists of Dkk-1 activity. Certain of the antibodies can be used to treat various diseases that are associated with the activity of Dkk-1.
  • a variety of selective binding agents useful for regulating the activity of Dkk-1 are provided. These agents include, for instance, antibodies and immunologically functional fragments thereof that contain an antigen binding domain (e.g., single chain antibodies, domain antibodies, immunoadhesions, and polypeptides with an antigen binding region) and specifically bind to a Dkk-1 polypeptide (e.g., a human, rat and/or murine Dkk-1 polypeptide). Some of the agents, for example, are useful in inhibiting the binding of Dkk-1 to LRP5 and/or LRP6, and can thus be used to stimulate one or more activities associated with Wnt signaling.
  • an antigen binding domain e.g., single chain antibodies, domain antibodies, immunoadhesions, and polypeptides with an antigen binding region
  • a Dkk-1 polypeptide e.g., a human, rat and/or murine Dkk-1 polypeptide.
  • each chain typically includes a variable domain that is responsible for antigen recognition.
  • the carboxy-terminal portion is more conserved evolutionarily than the other end of the chain and is referred to as the "constant region" or "C region.”
  • Human light chains generally are classified as kappa and lambda light chains, and each of these contains one variable domain and one constant domain.
  • Heavy chains are typically classified as mu, delta, gamma, alpha, or epsilon chains, and these define the antibody's isotype as IgM, IgD, IgG, IgA, and IgE, respectively.
  • IgG has several subtypes, including, but not limited to, IgGI , lgG2, lgG3, and lgG4.
  • IgM subtypes include IgM, and lgM2.
  • IgA subtypes include IgAI and lgA2.
  • the IgA and IgD isotypes contain four heavy chains and four light chains; the IgG and IgE isotypes contain two heavy chains and two light chains; and the IgM isotype contains five heavy chains and five light chains.
  • the heavy chain C region typically comprises one or more domains that may be responsible for effector function. The number of heavy chain constant region domains will depend on the isotype.
  • IgG heavy chains for example, each contains three C region domains known as CH1 , CH2 and CH3.
  • the antibodies that are provided can have any of these isotypes and subtypes.
  • a numbering system has been devised for assigning numbers to amino acids that occupy positions in each of these domains. This numbering system is defined in Kabat Sequences of Proteins of Immunological Interest ((1987 and 1991 ) National Institutes of Health, Bethesda, Md.), or Chothia & Lesk (1987) J. MoI. Biol. 196: 901 - 917; Chothia et al. (1989) Nature 342: 878-883.
  • Each of the light chains provided by the present disclosure can be combined with any of the heavy chains provided by the present disclosure to form an antibody.
  • the antibodies contain two identical light chains and two identical heavy chains.
  • antibodies that are provided are variants of antibodies formed by combination of the provided heavy and light chains and comprise light and/or heavy chains that each has at least 70%, 75%, 80%, 85%, 90%, 95%, 97% or 99% identity to the amino acid sequences of these chains.
  • such antibodies include at least one heavy chain and one light chain, whereas in other instances such variant forms contain two identical light chains and two identical heavy chains.
  • Antibodies and immunologically functional fragments thereof that compete with one the exemplified antibodies or functional fragments for specific binding to Dkk-1 are also provided. Such antibodies and fragments may also bind to the same epitope as one of the exemplified antibodies. Antibodies and fragments that compete with or bind to the same epitope as the exemplified antibody or fragment are expected to show similar functional properties.
  • Suitable cell lines for use in mouse fusions include Sp-20, P3-X63/Ag8, P3-X63-Ag8.653, NS1/1.Ag 4 1 , Sp210-Ag14, FO, NSO/U, MPC-11 , MPC11-X45-GTG 1.7 and S194/5XXO BuI; examples of cell lines used in rat fusions include R210.RCY3, Y3-Ag 1.2.3, IR983F and 4B210.
  • Other cell lines useful for cell fusions are U-266, GM1500-GRG2, LICR-LON-HMy2 and UC729-6.
  • a hybridoma cell line is produced by immunizing an animal
  • Monoclonal antibodies secreted by a hybridoma cell line can be purified using any technique known in the art.
  • Hybridomas or Mabs may be further screened to identify Mabs with particular properties, such as the ability to block a Wnt induced activity. Examples of such screens are provided in the examples below.
  • Chimeric and humanized antibodies based upon the foregoing sequences are also provided.
  • Monoclonal antibodies for use as therapeutic agents may be modified in various ways prior to use.
  • a "chimeric" antibody which is an antibody composed of protein segments from different antibodies that are covalently joined to produce functional immunoglobulin light or heavy chains or immunologically functional portions thereof.
  • a portion of the heavy chain and/or light chain is identical with or homologous to a corresponding sequence in antibodies derived from a particular species or belonging to a particular antibody class or subclass, while the remainder of the chain(s) is/are identical with or homologous to a corresponding sequence in antibodies derived from another species or belonging to another antibody class or subclass.
  • a humanized antibody is produced from a monoclonal antibody raised initially in a non- human animal. Certain amino acid residues in this monoclonal antibody, typically from non-antigen recognizing portions of the antibody, are modified to be homologous to corresponding residues in a human antibody of corresponding isotype. Humanization can be performed, for example, using various methods by substituting at least a portion of a rodent variable region for the corresponding regions of a human antibody (see, e.g., U.S. Pat. Nos.: 5,585,089 and 5,693,762; Jones et al. (1986) Nature 321 :522-25; Riechmann et al. (1988) Nature 332:323-27; Verhoeyen et al. (1988) Science 239:1534- 36). In some embodiments constant regions from species other than human can be used along with the human variable region(s) to produce hybrid antibodies.
  • Fully human antibodies are also provided. Methods are available for making fully human antibodies specific for a given antigen without exposing human beings to the antigen ("fully human antibodies”).
  • One means for implementing the production of fully human antibodies is the "humanization" of the mouse humoral immune system.
  • Introduction of human immunoglobulin (Ig) loci into mice in which the endogenous Ig genes have been inactivated is one means of producing fully human monoclonal antibodies (Mabs) in mouse, an animal that can be immunized with any desirable antigen.
  • Mabs monoclonal antibodies
  • Using fully human antibodies can minimize the immunogenic and allergic responses that can sometimes be caused by administering mouse or mouse-dehvatized Mabs to humans as therapeutic agents.
  • Fully human antibodies can be produced by immunizing transgenic animals (usually mice) that are capable of producing a repertoire of human antibodies in the absence of endogenous immunoglobulin production.
  • Antigens for this purpose typically have six or more contiguous amino acids, and optionally are conjugated to a carrier, such as a hapten.
  • a carrier such as a hapten.
  • transgenic animals are produced by incapacitating the endogenous mouse immunoglobulin loci encoding the mouse heavy and light immunoglobulin chains therein, and inserting into the mouse genome large fragments of human genome DNA containing loci that encode human heavy and light chain proteins.
  • Partially modified animals which have less than the full complement of human immunoglobulin loci, are then cross-bred to obtain an animal having all of the desired immune system modifications.
  • these transgenic animals produce antibodies that are immunospecific for the immunogen but have human rather than murine amino acid sequences, including the variable regions.
  • mice described above contain a human immunoglobulin gene minilocus that encodes unrearranged human heavy ( ⁇ and ⁇ ) and K light chain immunoglobulin sequences, together with targeted mutations that inactivate the endogenous ⁇ and k chain loci (Lonberg et al. (1994) Nature 368: 856-859). Accordingly, the mice exhibit reduced expression of mouse IgM and k in response to immunization, and the introduced human heavy and light chain transgenes undergo class switching and somatic mutation to generate high affinity human IgG K monoclonal antibodies (Lonberg et al., supra.; Lonberg and Huszar (1995) Intern. Rev.
  • HCo7 and HCo12 transgenic mice strains can be used to generate human anti-Dkk-1 antibodies.
  • antigen-specific human MAbs with the desired specificity can be produced and selected from the transgenic mice such as those described above.
  • Such antibodies may be cloned and expressed using a suitable vector and host cell, or the antibodies can be harvested from cultured hybridoma cells.
  • Fully human antibodies can also be derived from phage-display libraries (as disclosed in Hoogenboom et al. (1991 ) J. MoI. Biol. 227:381 ; and Marks et al. (1991 ) J. MoI. Biol. 222:581 ).
  • Phage display techniques mimic immune selection through the display of antibody repertoires on the surface of filamentous bacteriophage, and subsequent selection of phage by their binding to an antigen of choice.
  • One such technique is described in WO99/10494 (hereby incorporated by reference), which describes the isolation of high affinity and functional agonistic antibodies for MPL- and msk-receptors using such an approach.
  • Conservative amino acid substitutions may encompass non-naturally occurring amino acid residues, which are typically incorporated by chemical peptide synthesis rather than by synthesis in biological systems. These include peptidomimetics and other reversed or inverted forms of amino acid moieties. Non-conservative substitutions may involve the exchange of a member of one of the above classes for a member from another class. Such substituted residues may be introduced into regions of the antibody that are homologous with human antibodies, or into the non-homologous regions of the molecule.
  • the hydropathic index of amino acids may be considered.
  • the hydropathic profile of a protein is calculated by assigning each amino acid a numerical value ("hydropathy index") and then repetitively averaging these values along the peptide chain.
  • Each amino acid has been assigned a hydropathic index on the basis of its hydrophobicity and charge characteristics.
  • hydropathic profile in conferring interactive biological function on a protein is understood in the art (see, for example, Kyte et al., 1982, J. MoI. Biol. 157:105-131 ). It is known that certain amino acids may be substituted for other amino acids having a similar hydropathic index or score and still retain a similar biological activity. In making changes based upon the hydropathic index, in certain embodiments, the substitution of amino acids whose hydropathic indices are within .+-.2 is included. In some aspects of the invention, those which are within .+-.1 are included, and in other aspects of the invention, those within .+-.0.5 are included.
  • the substitution of like amino acids can be made effectively on the basis of hydrophilicity, particularly where the biologically functional protein or peptide thereby created is intended for use in immunological embodiments, as in the present case.
  • the greatest local average hydrophilicity of a protein correlates with its immunogenicity and antigen-binding or immunogenicity, that is, with a biological property of the protein.
  • hydrophilicity values have been assigned to these amino acid residues: arginine (+3.0); lysine (+3.0); aspartate (+3.0.+-.1 ); glutamate (+3.0.+-.1 ); serine (+0.3); asparagine (+0.2); glutamine (+0.2); glycine (0); threonine (-0.4); proline (- 0.5.+-.1 ); alanine (-0.5); histidine (-0.5); cysteine (-1.0); methionine (-1.3); valine (-1.5); leucine (-1.8); isoleucine (-1.8); tyrosine (-2.3); phenylalanine (-2.5) and tryptophan (- 3.4).
  • the substitution of amino acids whose hydrophilicity values are within .+- .2 is included, in other embodiments, those which are within .+-.1 are included, and in still other embodiments, those within .+-.0.5 are included.
  • a skilled artisan will be able to determine suitable variants of polypeptides as set forth herein using well-known techniques.
  • One skilled in the art may identify suitable areas of the molecule that may be changed without destroying activity by targeting regions not believed to be important for activity.
  • the skilled artisan also will be able to identify residues and portions of the molecules that are conserved among similar polypeptides.
  • even areas that may be important for biological activity or for structure may be subject to conservative amino acid substitutions without destroying the biological activity or without adversely affecting the polypeptide structure.
  • one skilled in the art can review structure-function studies identifying residues in similar polypeptides that are important for activity or structure. In view of such a comparison, one can predict the importance of amino acid residues in a protein that correspond to amino acid residues important for activity or structure in similar proteins.
  • One skilled in the art may opt for chemically similar amino acid substitutions for such predicted important amino acid residues.
  • One skilled in the art can also analyze the three-dimensional structure and amino acid sequence in relation to that structure in similar polypeptides. In view of such information, one skilled in the art may predict the alignment of amino acid residues of an antibody with respect to its three dimensional structure. One skilled in the art may choose not to make radical changes to amino acid residues predicted to be on the surface of the protein, since such residues may be involved in important interactions with other molecules. Moreover, one skilled in the art may generate test variants containing a single amino acid substitution at each desired amino acid residue. These variants can then be screened using assays for Dkk-1 neutralizing activity, (see examples below) thus yielding information regarding which amino acids can be changed and which must not be changed. In other words, based on information gathered from such routine experiments, one skilled in the art can readily determine the amino acid positions where further substitutions should be avoided either alone or in combination with other mutations.
  • polypeptides or proteins that have a sequence identity of greater than 30%, or similarity greater than 40% often have similar structural topologies.
  • the recent growth of the protein structural database (PDB) has provided enhanced predictability of secondary structure, including the potential number of folds within a polypeptide's or protein's structure. See Holm et al. (1999) Nucl. Acid. Res. 27:244-247. It has been suggested (Brenner et al. (1997) Curr. Op. Struct. Biol. 7:369-376) that there are a limited number of folds in a given polypeptide or protein and that once a critical number of structures have been resolved, structural prediction will become dramatically more accurate. Additional methods of predicting secondary structure include "threading" (Jones
  • substitutions that eliminate or alter this sequence will prevent addition of an N-linked carbohydrate chain present in the native polypeptide.
  • the glycosylation can be reduced by the deletion of an Asn or by substituting the Asn with a different amino acid.
  • one or more new N-linked sites are created.
  • Antibodies typically have a N-linked glycosylation site in the Fc region.
  • Additional preferred antibody variants include cysteine variants wherein one or more cysteine residues in the parent or native amino acid sequence are deleted from or substituted with another amino acid (e.g., serine). Cysteine variants are useful, inter alia when antibodies must be refolded into a biologically active conformation. Cysteine variants may have fewer cysteine residues than the native antibody, and typically have an even number to minimize interactions resulting from unpaired cysteines.
  • the heavy and light chains, variable regions domains and CDRs that are disclosed can be used to prepare polypeptides that contain an antigen binding region that can specifically bind to a Dkk-1 polypeptide.
  • one or more of the CDRs listed in Table 4 can be incorporated into a molecule (e.g., a polypeptide) covalently or noncovalently to make an immunoadhesion.
  • An immunoadhesion may incorporate the CDR(s) as part of a larger polypeptide chain, may covalently link the CDR(s) to another polypeptide chain, or may incorporate the CDR(s) noncovalently.
  • the CDR(s) enable the immunoadhesion to bind specifically to a particular antigen of interest (e.g., a Dkk-1 polypeptide or epitope thereof).
  • Mimetics e.g., peptide mimetics” or “peptidomimetics” based upon the variable region domains and CDRs that are described herein are also provided. These analogs can be peptides, non-peptides or combinations of peptide and non-peptide regions. Fauchere (1986) Adv. Drug Res. 15: 29; Veber and Freidinger (1985) TINS p. 392; and Evans et al. (1987) J. Med. Chem. 30: 1229, which are incorporated herein by reference for any purpose. Peptide mimetics that are structurally similar to therapeutically useful peptides may be used to produce a similar therapeutic or prophylactic effect. Such compounds are often developed with the aid of computerized molecular modeling.
  • Systematic substitution of one or more amino acids of a consensus sequence with a D-amino acid of the same type may be used in certain embodiments of the invention to generate more stable proteins.
  • constrained peptides comprising a consensus sequence or a substantially identical consensus sequence variation may be generated by methods known in the art (Rizo and Gierasch (1992) Ann. Rev. Biochem. 61 : 387), incorporated herein by reference), for example, by adding internal cysteine residues capable of forming intramolecular disulfide bridges which cyclize the peptide.
  • the dehvatized antibody or fragment may comprise any molecule or substance that imparts a desired property to the antibody or fragment, such as increased half-life in a particular use.
  • the derivatized antibody can comprise, for example, a detectable (or labeling) moiety (e.g., a radioactive, colorimethc, antigenic or enzymatic molecule, a detectable bead (such as a magnetic or electrodense (e.g., gold) bead), or a molecule that binds to another molecule (e.g., biotin or streptavidin)), a therapeutic or diagnostic moiety (e.g., a radioactive, cytotoxic, or pharmaceutically active moiety), or a molecule that increases the suitability of the antibody for a particular use (e.g., administration to a subject, such as a human subject, or other in vivo or in vitro uses).
  • a detectable (or labeling) moiety e.g., a radioactive, colorimethc, antigenic or enzymatic molecule, a detectable bead (such as a magnetic or electrodense (e.g., gold) bead
  • an antibody examples include albumin (e.g., human serum albumin) and polyethylene glycol (PEG).
  • Albumin-linked and PEGylated derivatives of antibodies can be prepared using techniques well known in the art.
  • the antibody is conjugated or otherwise linked to transthyretin (TTR) or a TTR variant.
  • TTR or TTR variant can be chemically modified with, for example, a chemical selected from the group consisting of dextran, poly(n-vinyl pyrrolidone), polyethylene glycols, propropylene glycol homopolymers, polypropylene oxide/ethylene oxide co-polymers, polyoxyethylated polyols and polyvinyl alcohols.
  • conjugates of anti-Dkk-1 antibodies, or fragments thereof with other proteins or polypeptides, such as by expression of recombinant fusion proteins comprising heterologous polypeptides fused to the N-terminus or C-terminus of an anti-Dkk-1 antibody polypeptide.
  • the conjugated peptide may be a heterologous signal (or leader) polypeptide, e.g., the yeast alpha-factor leader, or a peptide such as an epitope tag.
  • Anti-Dkk-1 antibody-containing fusion proteins can comprise peptides added to facilitate purification or identification of the anti-Dkk-1 antibody (e.g., poly-His).
  • An anti-Dkk-1 antibody polypeptide also can be linked to the FLAG peptide as described in Hopp et al., Bio/Technology 6:1204 (1988) and U.S. Pat. No. 5,011 ,912.
  • the FLAG peptide is highly antigenic and provides an epitope reversibly bound by a specific monoclonal antibody (Mab), enabling rapid assay and facile purification of expressed recombinant protein.
  • Reagents useful for preparing fusion proteins in which the FLAG peptide is fused to a given polypeptide are commercially available (Sigma, St. Louis, Mo.).
  • Oligomers that contain one or more anti-Dkk-1 antibody polypeptides may be employed as Dkk-1 antagonists. Oligomers may be in the form of covalently-l inked or non-covalently-linked dimers, trimers, or higher oligomers. Oligomers comprising two or more anti-Dkk-1 antibody polypeptides are contemplated for use, with one example being a homodimer. Other oligomers include heterodimers, homothmers, heterothmers, homotetramers, heterotetramers, etc.
  • One embodiment is directed to oligomers comprising multiple anti-Dkk-1 antibody polypeptides joined via covalent or non-covalent interactions between peptide moieties fused to the anti-Dkk-1 antibody polypeptides.
  • Such peptides may be peptide linkers (spacers), or peptides that have the property of promoting oligomerization.
  • Leucine zippers and certain polypeptides derived from antibodies are among the peptides that can promote oligomerization of anti-Dkk-1 antibody polypeptides attached thereto, as described in more detail below.
  • the oligomers comprise from two to four anti-Dkk-1 antibody polypeptides.
  • the anti-Dkk-1 antibody moieties of the oligomer may be in any of the forms described above, e.g., variants or fragments.
  • the oligomers comprise anti-Dkk-1 antibody polypeptides that have Dkk-1 binding activity.
  • an oligomer is prepared using polypeptides derived from immunoglobulins.
  • Preparation of fusion proteins comprising certain heterologous polypeptides fused to various portions of antibody-derived polypeptides (including the Fc domain) has been described, e.g., by Ashkenazi et al., (1991 ) PNAS USA 88:10535; Byrn et al., (1990) Nature 344:677; and Hollenbaugh et al., (1992) "Construction of Immunoglobulin Fusion Proteins", in Current Protocols in Immunology, Suppl. 4, pages 10.19.1 -10.19.11.
  • One embodiment of the present invention is directed to a dimer comprising two fusion proteins created by fusing a Dkk-1 binding fragment of an anti-Dkk-1 antibody to the Fc region of an antibody.
  • the dimer can be made by, for example, inserting a gene fusion encoding the fusion protein into an appropriate expression vector, expressing the gene fusion in host cells transformed with the recombinant expression vector, and allowing the expressed fusion protein to assemble much like antibody molecules, whereupon interchain disulfide bonds form between the Fc moieties to yield the dimer.
  • Fc polypeptide as used herein includes native and mutein forms of polypeptides derived from the Fc region of an antibody. Truncated forms of such polypeptides containing the hinge region that promotes dimehzation also are included. Fusion proteins comprising Fc moieties (and oligomers formed therefrom) offer the advantage of facile purification by affinity chromatography over Protein A or Protein G columns.
  • Fc polypeptide described in PCT application WO 93/10151 and
  • U.S. Pat. Nos.: 5,426,048 and 5,262,522 is a single chain polypeptide extending from the N-terminal hinge region to the native C-terminus of the Fc region of a human IgGI antibody.
  • Another useful Fc polypeptide is the Fc mutein described in U.S. Pat. No. 5,457,035 and in Baum et al. (1994) EMBO J. 13:3992-4001.
  • the amino acid sequence of this mutein is identical to that of the native Fc sequence presented in WO 93/10151 , except that amino acid 19 has been changed from Leu to Ala, amino acid 20 has been changed from Leu to GIu, and amino acid 22 has been changed from GIy to Ala.
  • the mutein exhibits reduced affinity for Fc receptors.
  • variable portion of the heavy and/or light chains of an anti-Dkk-1 antibody such as disclosed herein may be substituted for the variable portion of an antibody heavy and/or light chain.
  • the oligomer is a fusion protein comprising multiple anti-Dkk-1 antibody polypeptides, with or without peptide linkers (spacer peptides).
  • suitable peptide linkers are those described in U.S. Pat. Nos.: 4,751 ,180 and 4,935,233.
  • Another method for preparing oligomeric anti-Dkk-1 antibody derivatives involves use of a leucine zipper.
  • Leucine zipper domains are peptides that promote oligomerization of the proteins in which they are found. Leucine zippers were originally identified in several DNA-binding proteins (Landschulz et al. (1988) Science 240:1759), and have since been found in a variety of different proteins.
  • leucine zippers are naturally occurring peptides and derivatives thereof that dimerize or trimerize.
  • leucine zipper domains suitable for producing soluble oligomeric proteins are described in WO 94/10308, and the leucine zipper derived from lung surfactant protein D (SPD) described in Hoppe et al. (1994) FEBS Letters 344:191 , hereby incorporated by reference.
  • SPD lung surfactant protein D
  • the use of a modified leucine zipper that allows for stable thmehzation of a heterologous protein fused thereto is described in Fanslow et al. (1994) Semin. Immunol. 6:267-78.
  • recombinant fusion proteins comprising an anti-Dkk-1 antibody fragment or derivative fused to a leucine zipper peptide are expressed in suitable host cells, and the soluble oligomeric anti-Dkk-1 antibody fragments or derivatives that form are recovered from the culture supernatant.
  • the nucleic acids can be any length.
  • nucleic acids can be, for example, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 75, 100, 125, 150, 175, 200, 250, 300, 350, 400, 450, 500, 750, 1 ,000, 1 ,500, 3,000, 5,000 or more nucleotides in length, and/or can comprise one or more additional sequences, for example, regulatory sequences, and/or be part of a larger nucleic acid, for example, a vector.
  • the nucleic acids can be single-stranded or double-stranded and can comprise RNA and/or DNA nucleotides, and artificial variants thereof (e.g., peptide nucleic acids). Nucleic acids encoding fusion proteins that include these peptides are also provided.
  • DNA encoding antibody polypeptides may be isolated from B-cells of mice that have been immunized with Dkk-1 or an immunogenic fragment thereof.
  • the DNA may be isolated by conventional procedures such as polymerase chain reaction (PCR).
  • Phage display is another example of a known technique whereby derivatives of antibodies may be prepared.
  • polypeptides that are components of an antibody of interest are expressed in any suitable recombinant expression system, and the expressed polypeptides are allowed to assemble to form antibody molecules.
  • Exemplary nucleic acids that encode the light and heavy chains, variable regions and CDRs of the antibodies and immunologically functional fragments are provided.
  • each of the polypeptide sequences is also encoded by a large number of other nucleic acid sequences besides those listed.
  • the present invention provides each degenerate nucleotide sequence encoding each antibody of the invention.
  • the invention further provides nucleic acids that hybridize to other nucleic acids under particular hybridization conditions.
  • Methods for hybridizing nucleic acids are well- known in the art. See, e.g., Current Protocols in Molecular Biology, John Wiley & Sons, N.Y. (1989), 6.3.1 -6.3.6. Examples of known moderately stringent hybridization condition use a prewashing solution containing ⁇ .times.
  • hybridization buffer of about 50% formamide, 6.times.SSC, and a hybridization temperature of 55°C (or other similar hybridization solutions, such as one containing about 50% formamide, with a hybridization temperature of 42°C), and washing conditions of 60 0 C, in O. ⁇ .times.SSC, 0.1 % SDS.
  • Examples of known stringent hybridization conditions hybridize in 6.times.SSC at 45°C, followed by one or more washes in 0.1.times.
  • nucleic acids comprising nucleotide sequences that are at least 65, 70, 75, 80, 85, 90, 95, 98 or 99% identical to each other typically remain hybridized to each other.
  • Changes can be introduced by mutation into a nucleic acid, thereby leading to changes in the amino acid sequence of a polypeptide (e.g., an antibody or antibody derivative of the invention) that it encodes.
  • Mutations can be introduced using any technique known in the art. In one embodiment, one or more particular amino acid residues are changed using, for example, a site-directed mutagenesis protocol. In another embodiment, one or more randomly selected residues is changed using, for example, a random mutagenesis protocol. However it is made, a mutant polypeptide can be expressed and screened for a desired property. Mutations can be introduced into a nucleic acid without significantly altering the biological activity of a polypeptide that it encodes.
  • one or more mutations can be introduced into a nucleic acid that selectively changes the biological activity of a polypeptide that it encodes.
  • the mutation can quantitatively or qualitatively change the biological activity. Examples of quantitative changes include increasing, reducing or eliminating the activity.
  • Examples of qualitative changes include changing the antigen specificity of an antibody.
  • the present invention provides nucleic acid molecules that are suitable for use as primers or hybridization probes for the detection of nucleic acid sequences of the invention.
  • a nucleic acid molecule of the invention can comprise only a portion of a nucleic acid sequence encoding a full-length polypeptide of the invention, for example, a fragment that can be used as a probe or primer or a fragment encoding an active portion (e.g., a Dkk-1 binding portion) of a polypeptide of the invention.
  • Probes based on the sequence of a nucleic acid of the invention can be used to detect the nucleic acid or similar nucleic acids, for example, transcripts encoding a polypeptide of the invention.
  • the probe can comprise a label group, e.g., a radioisotope, a fluorescent compound, an enzyme, or an enzyme co-factor. Such probes can be used to identify a cell that expresses the polypeptide.
  • the present invention provides vectors comprising a nucleic acid encoding a polypeptide of the invention or a portion thereof (e.g., a fragment containing one or more CDRs or one or more variable region domains). Examples of vectors include, but are not limited to, plasmids, viral vectors, non-episomal mammalian vectors and expression vectors, for example, recombinant expression vectors.
  • the recombinant expression vectors of the invention can comprise a nucleic acid of the invention in a form suitable for expression of the nucleic acid in a host cell.
  • the recombinant expression vectors include one or more regulatory sequences, selected on the basis of the host cells to be used for expression, which is operably linked to the nucleic acid sequence to be expressed. Regulatory sequences include those that direct constitutive expression of a nucleotide sequence in many types of host cells (e.g., SV40 early gene enhancer, Rous sarcoma virus promoter and cytomegalovirus promoter), those that direct expression of the nucleotide sequence only in certain host cells (e.g., tissue-specific regulatory sequences, see Voss et al.
  • the expression vector can depend on such factors as the choice of the host cell to be transformed, the level of expression of protein desired, etc.
  • the expression vectors of the invention can be introduced into host cells to thereby produce proteins or peptides, including fusion proteins or peptides, encoded by nucleic acids as described herein.
  • the present invention provides host cells into which a recombinant expression vector of the invention has been introduced.
  • a host cell can be any prokaryotic cell (for example, E. coli) or eukaryotic cell (for example, yeast, insect, or mammalian cells (e.g., CHO cells)).
  • Vector DNA can be introduced into prokaryotic or eukaryotic cells via conventional transformation or transfection techniques. For stable transfection of mammalian cells, it is known that, depending upon the expression vector and transfection technique used, only a small fraction of cells may integrate the foreign DNA into their genome.
  • a gene that encodes a selectable marker (e.g., for resistance to antibiotics) is generally introduced into the host cells along with the gene of interest.
  • selectable markers include those which confer resistance to drugs, such as G418, hygromycin and methotrexate.
  • Cells stably transfected with the introduced nucleic acid can be identified by drug selection (e.g., cells that have incorporated the selectable marker gene will survive, while the other cells die), among other methods.
  • the non-human antibodies that are provided can be, for example, derived from any antibody-producing animal, such as mouse, rat, rabbit, goat, donkey, or non-human primate (such as monkey (e.g., cynomologous or rhesus monkey) or ape (e.g., chimpanzee)).
  • Non-human antibodies can be used, for instance, in in vitro cell culture and cell-culture based applications, or any other application where an immune response to the antibody does not occur or is insignificant, can be prevented, is not a concern, or is desired.
  • the antibodies may be produced by immunizing with full-length Dkk-1 or with the carboxy-terminal half of Dkk-1.
  • the antibodies may be polyclonal, monoclonal, or may be synthesized in host cells by expressing recombinant DNA.
  • Fully human antibodies may be prepared as described above by immunizing transgenic animals containing human immunoglobulin loci or by selecting a phage display library that is expressing a repertoire of human antibodies.
  • the monoclonal antibodies (Mabs) of the invention can be produced by a variety of techniques, including conventional monoclonal antibody methodology, e.g., the standard somatic cell hybridization technique of Kohler and Milstein (1975) Nature 256: 495. Alternatively, other techniques for producing monoclonal antibodies can be employed, for example, the viral or oncogenic transformation of B-lymphocytes.
  • One suitable animal system for preparing hybridomas is the murine system, which is a very well established procedure. Immunization protocols and techniques for isolation of immunized splenocytes for fusion are known in the art. For such procedures, B cells from immunized mice are fused with a suitable immortalized fusion partner, such as a murine myeloma cell line.
  • mice can be immunized instead of mice and B cells from such animals can be fused with the murine myeloma cell line to form hybridomas.
  • a myeloma cell line from a source other than mouse may be used. Fusion procedures for making hybridomas also are well known.
  • the single chain antibodies that are provided may be formed by linking heavy and light chain variable domain (Fv region) fragments via an amino acid bridge (short peptide linker), resulting in a single polypeptide chain.
  • Such single-chain Fvs may be prepared by fusing DNA encoding a peptide linker between DNAs encoding the two variable domain polypeptides (VL and VH).
  • the resulting polypeptides can fold back on themselves to form antigen-binding monomers, or they can form multimers (e.g., dimers, trimers, or tetramers), depending on the length of a flexible linker between the two variable domains (Kortt et al. (1997) Prot. Eng.
  • Antibodies provided herein that are of one subclass can be changed to antibodies from a different subclass using subclass switching methods.
  • IgG antibodies may be derived from an IgM antibody, for example, and vice versa.
  • Such techniques allow the preparation of new antibodies that possess the antigen-binding properties of a given antibody (the parent antibody), but also exhibit biological properties associated with an antibody isotype or subclass different from that of the parent antibody.
  • Recombinant DNA techniques may be employed. Cloned DNA encoding particular antibody polypeptides may be employed in such procedures, e.g., DNA encoding the constant domain of an antibody of the desired isotype. See, e.g., Lantto et al. (2002) Methods MoI. Biol.178:303-16.
  • chain shuffling involves displaying immunoglobulin variable domain gene repertoires on the surface of filamentous bacteriophage, often referred to as phage display. Chain shuffling has been used to prepare high affinity antibodies to the hapten 2-phenyloxazol-5-one, as described by Marks et al. (1992) BioTechnology, 10:779.
  • Antibodies and functional fragments thereof according to the invention may be further modified in various ways. For example, if they are to be used for therapeutic purposes, they may be conjugated with polyethylene glycol (pegylated) to prolong the serum half-life or to enhance protein delivery. Alternatively, the V region of the subject antibodies or fragments thereof may be fused with the Fc region of a different antibody molecule. The Fc region used for this purpose may be modified so that it does not bind complement, thus reducing the likelihood of inducing cell lysis in the patient when the fusion protein is used as a therapeutic agent.
  • pegylated polyethylene glycol
  • TTR transthyretin
  • substantial modifications in the functional and/or biochemical characteristics of the antibodies and fragments described herein may be achieved by creating substitutions in the amino acid sequence of the heavy and light chains that differ significantly in their effect on maintaining (a) the structure of the molecular backbone in the area of the substitution, for example, as a sheet or helical conformation, (b) the charge or hydrophobicity of the molecule at the target site, or (c) the bulkiness of the side chain.
  • a "conservative amino acid substitution” may involve a substitution of a native amino acid residue with a nonnative residue that has little or no effect on the polarity or charge of the amino acid residue at that position.
  • any native residue in the polypeptide may also be substituted with alanine, as has been previously described for alanine scanning mutagenesis.
  • Amino acid substitutions (whether conservative or non-conservative) of the subject antibodies can be implemented by those skilled in the art by applying routine techniques. Amino acid substitutions can be used to identify important residues of the antibodies provided herein, or to increase or decrease the affinity of these antibodies for human Dkk-1 or for modifying the binding affinity of other anti-Dkk-1 antibodies described herein.
  • anti-Dkk-1 antibodies and immunological functional fragments can be prepared by any of a number of conventional techniques.
  • anti-Dkk-1 antibodies may be produced by recombinant expression systems, using any technique known in the art. See, for example, Monoclonal Antibodies, Hybhdomas: A New Dimension in Biological Analyses, Kennet et al. (eds.) Plenum Press, New York (1980): and Antibodies: A Laboratory Manual, Harlow and Lane (eds.), Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. (1988).
  • Antibodies of the present invention can be expressed in hybridoma cell lines or in cell lines other than hybhdomas.
  • Expression constructs encoding the antibodies can be used to transform a mammalian, insect or microbial host cell. Transformation can be performed using any known method for introducing polynucleotides into a host cell, including, for example packaging the polynucleotide in a virus or bacteriophage and transducing a host cell with the construct by transfection procedures known in the art, as exemplified by U.S. Pat. Nos.: 4,399,216, 4,912,040, 4,740,461 , and 4,959,455. The optimal transformation procedure used will depend upon which type of host cell is being transformed.
  • Methods for introduction of heterologous polynucleotides into mammalian cells include, but are not limited to, dextran-mediated transfection, calcium phosphate precipitation, polybrene mediated transfection, protoplast fusion, electroporation, encapsulation of the polynucleotide(s) in liposomes, mixing nucleic acid with positively-charged lipids, and direct microinjection of the DNA into nuclei.
  • Recombinant expression constructs of the invention typically comprise a nucleic acid molecule encoding a polypeptide comprising one or more of the following: a heavy chain constant region; a heavy chain variable region; a light chain constant region; a light chain variable region; one or more CDRs of the light or heavy chain of the anti-Dkk- 1 antibody.
  • These nucleic acid sequences are inserted into an appropriate expression vector using standard ligation techniques.
  • the vector is typically selected to be functional in the particular host cell employed (i.e., the vector is compatible with the host cell machinery, permitting amplification and/or expression of the gene can occur).
  • vectors are used that employ protein-fragment complementation assays using protein reporters, such as dihydrofolate reductase (see, for example, U.S. Pat. No. 6,270,964, which is hereby incorporated by reference).
  • protein reporters such as dihydrofolate reductase
  • Suitable expression vectors can be purchased, for example, from Invitrogen Life Technologies or BD Biosciences (formerly "Clontech”).
  • Other useful vectors for cloning and expressing the antibodies and fragments of the invention include those described in Bianchi and McGrew, Biotech Biotechnol Bioeng 84(4):439-44 (2003), which is hereby incorporated by reference. Additional suitable expression vectors are discussed, for example, in Methods Enzymol, vol. 185 (D. V. Goeddel, ed.) (1990) New York: Academic Press.
  • expression vectors used in any of the host cells contain sequences for plasmid or virus maintenance and for cloning and expression of exogenous nucleotide sequences.
  • sequences collectively referred to as “flanking sequences” typically include one or more of the following operatively linked nucleotide sequences: a promoter, one or more enhancer sequences, an origin of replication, a transcriptional termination sequence, a complete intron sequence containing a donor and acceptor splice site, a sequence encoding a leader sequence for polypeptide secretion, a ribosome binding site, a polyadenylation sequence, a polylinker region for inserting the nucleic acid encoding the polypeptide to be expressed, and a selectable marker element.
  • the vector may contain a "tag"-encoding sequence, that is, an oligonucleotide molecule located at the 5' or 3' end of the coding sequence, the oligonucleotide sequence encoding polyHis (such as hexaHis), or another "tag” for which commercially available antibodies exist, such as FLAG®, HA (hemaglutinin from influenza virus), or myc.
  • the tag is typically fused to the antibody protein upon expression, and can serve as a means for affinity purification of the antibody from the host cell. Affinity purification can be accomplished, for example, by column chromatography using antibodies against the tag as an affinity matrix.
  • the tag can subsequently be removed from the purified antibody polypeptide by various means such as using certain peptidases for cleavage.
  • Flanking sequences in the expression vector may be homologous (i.e., from the same species and/or strain as the host cell), heterologous (i.e., from a species other than the host cell species or strain), hybrid (i.e., a combination of flanking sequences from more than one source), synthetic or native.
  • the source of a flanking sequence may be any prokaryotic or eukaryotic organism, any vertebrate or invertebrate organism, or any plant, provided that the flanking sequence is functional in, and can be activated by, the host cell machinery.
  • Flanking sequences useful in the vectors of this invention may be obtained by any of several methods well known in the art. Typically, flanking sequences useful herein will have been previously identified by mapping and/or by restriction endonuclease digestion and can thus be isolated from the proper tissue source using the appropriate restriction endonucleases. In some cases, the full nucleotide sequence of a flanking sequence may be known. Here, the flanking sequence may be synthesized using the methods described herein for nucleic acid synthesis or cloning.
  • flanking sequence may be obtained using PCR and/or by screening a genomic library with a suitable oligonucleotide and/or flanking sequence fragment from the same or another species.
  • flanking sequence may be not known, a fragment of DNA containing a flanking sequence may be isolated from a larger piece of DNA that may contain, for example, a coding sequence or even another gene or genes. Isolation may be accomplished by restriction endonuclease digestion to produce the proper DNA fragment followed by isolation using agarose gel purification, Qiagen® column chromatography (Chatsworth, Calif.), or other methods known to the skilled artisan. The selection of suitable enzymes to accomplish this purpose will be readily apparent to those skilled in the art.
  • An origin of replication is typically a part of prokaryotic expression vectors, particularly those purchased commercially, and the origin aids in the amplification of the vector in a host cell. If the vector of choice does not contain an origin of replication site, one may be chemically synthesized based on a known sequence, and ligated into the vector.
  • the origin of replication from the plasmid pBR322 (New England Biolabs, Beverly, Mass.) is suitable for most gram-negative bacteria and various origins (e.g., SV40, polyoma, adenovirus, vesicular stomatitis virus (VSV), or papillomaviruses such as HPV or BPV) are useful for cloning vectors in mammalian cells.
  • origins e.g., SV40, polyoma, adenovirus, vesicular stomatitis virus (VSV), or papillomaviruses such as HPV or BPV
  • a mammalian origin of replication is not needed for mammalian expression vectors (for example, the SV40 origin is often used only because it contains the early promoter).
  • the expression and cloning vectors of the present invention will typically contain a promoter that is recognized by the host organism and operably linked to nucleic acid encoding the anti-Dkk-1 antibody or immunologically functional fragment thereof Promoters are untranscribed sequences located upstream (i.e., 5') to the start codon of a structural gene (generally within about 100 to 1000 bp) that control transcription of the structural gene. Promoters are conventionally grouped into one of two classes: inducible promoters and constitutive promoters. Inducible promoters initiate increased levels of transcription from DNA under their control in response to some change in culture conditions, such as the presence or absence of a nutrient or a change in temperature.
  • Constitutive promoters initiate continuous gene product production; that is, there is little or no experimental control over gene expression.
  • a large number of promoters, recognized by a variety of potential host cells, are well known.
  • a suitable promoter is operably linked to the DNA encoding anti-Dkk-1 antibody by removing the promoter from the source DNA by restriction enzyme digestion or amplifying the promoter by polymerase chain reaction and inserting the desired promoter sequence into the vector.
  • Suitable promoters for use with yeast hosts are also well known in the art.
  • Yeast enhancers are advantageously used with yeast promoters.
  • Suitable promoters for use with mammalian host cells are well known and include, but are not limited to, those obtained from the genomes of viruses such as polyoma virus, fowlpox virus, adenovirus (such as Adenovirus 2), bovine papilloma virus, avian sarcoma virus, cytomegalovirus, retroviruses, hepatitis-B virus and -most preferably Simian Virus 40 (SV40).
  • viruses such as polyoma virus, fowlpox virus, adenovirus (such as Adenovirus 2), bovine papilloma virus, avian sarcoma virus, cytomegalovirus, retroviruses, hepatitis-B virus and -most preferably Simian Virus 40 (SV40).
  • promoters useful in the practice of the recombinant expression vectors of the invention include, but are not limited to: the SV40 early promoter region (Bemoist and Chambon (1981 ) Nature 290: 304-10); the CMV promoter; the promoter contained in the 3' long terminal repeat of Rous sarcoma virus (Yamamoto, et al. (1980) Cell 22: 787-97); the herpes thymidine kinase promoter (Wagner et al. (1981 ) Proc. Natl. Acad. Sci. U.S.A. 78: 1444-45); the regulatory sequences of the metallothionine gene (Bhnster et al.
  • prokaryotic expression vectors such as the beta- lactamase promoter (Villa-Kamaroff et al. (1978) Proc. Natl. Acad. Sci. U.S.A., 75: 3727- 31 ); or the tac promoter (DeBoer et al. (1983) Proc. Natl. Acad. Sci. U.S.A. 80: 21 -25).
  • the elastase I gene control region that is active in pancreatic acinar cells (Swift et al.
  • Enhancers may be inserted into the vector to increase the transcription in higher eukaryotes of a nucleic acid encoding an anti-Dkk-1 antibody or immunologically functional fragment thereof of the present invention.
  • Enhancers are cis- acting elements of DNA, usually about 10-300 bp in length, that act on promoters to increase transcription. Enhancers are relatively orientation and position independent. They have been found 5' and 3' to the transcription unit.
  • enhancer sequences available from mammalian genes are known (e.g., globin, elastase, albumin, alpha-feto- protein and insulin). An enhancer sequence from a virus also can be used.
  • the SV40 enhancer, the cytomegalovirus early promoter enhancer, the polyoma enhancer, and adenovirus enhancers are exemplary enhancing elements for the activation of eukaryotic promoters. While an enhancer may be spliced into the vector at a position 5' or 3' to a nucleic acid molecule, it is typically placed at a site 5' to the promoter.
  • a transcription termination sequence is typically located 3' of the end of a polypeptide-coding region and serves to terminate transcription.
  • a transcription termination sequence used for expression in prokaryotic cells typically is a G-C rich fragment followed by a poly-T sequence. While the sequence is easily cloned from a library or even purchased commercially as part of a vector, it can also be readily synthesized using methods for nucleic acid synthesis such as those described herein.
  • a selectable marker gene element encodes a protein necessary for the survival and growth of a host cell grown in a selective culture medium.
  • Typical selection marker genes used in expression vectors encode proteins that (a) confer resistance to antibiotics or other toxins, e.g., ampicillin, tetracycline, or kanamycin for prokaryotic host cells; (b) complement auxotrophic deficiencies of the cell; or (c) supply critical nutrients not available from complex media.
  • selectable markers include the kanamycin resistance gene, the ampicillin resistance gene and the tetracycline resistance gene.
  • a bacterial neomycin resistance gene can also be used for selection in both prokaryotic and eukaryotic host cells. Other selection genes can be used to amplify the gene that will be expressed.
  • Amplification is a process whereby genes that cannot in single copy be expressed at high enough levels to permit survival and growth of cells under certain selection conditions are reiterated in tandem within the chromosomes of successive generations of recombinant cells.
  • suitable amplifiable selectable markers for mammalian cells include dihydrofolate reductase (DHFR) and promoterless thymidine kinase.
  • DHFR dihydrofolate reductase
  • promoterless thymidine kinase promoterless thymidine kinase.
  • mammalian cell transformants are placed under selection pressure wherein only the transformants are uniquely adapted to survive by virtue of the selection gene present in the vector. Selection pressure is imposed by culturing the transformed cells under conditions in which the concentration of selection agent in the medium is successively increased, thereby permitting survival of only those cells in which the selection gene has been amplified.
  • DNA adjacent to the selection gene such as DNA encoding an antibody of the invention, is co-
  • a ribosome-binding site is usually necessary for translation initiation of mRNA and is characterized by a Shine-Dalgarno sequence (prokaryotes) or a Kozak sequence (eukaryotes).
  • the element is typically located 3' to the promoter and 5' to the coding sequence of the polypeptide to be expressed.
  • various presequences can be manipulated to improve glycosylation or yield.
  • the peptidase cleavage site of a particular signal peptide can be altered, or pro-sequences added, which also may affect glycosylation.
  • the final protein product may have, in the -1 position (relative to the first amino acid of the mature protein) one or more additional amino acids incident to expression, which may not have been totally removed.
  • the final protein product may have one or two amino acid residues found in the peptidase cleavage site, attached to the amino-terminus.
  • use of some enzyme cleavage sites may result in a slightly truncated yet active form of the desired polypeptide, if the enzyme cuts at such area within the mature polypeptide.
  • the vector can be modified by individually ligating these sequences into the vector. After the vector has been chosen and modified as desired, a nucleic acid molecule encoding an anti-Dkk-1 antibody or immunologically functional fragment thereof is inserted into the proper site of the vector.
  • the completed vector containing sequences encoding the inventive antibody or immunologically functional fragment thereof is inserted into a suitable host cell for amplification and/or polypeptide expression.
  • the transformation of an expression vector for an anti-Dkk-1 antibody immunologically functional fragment thereof into a selected host cell may be accomplished by well-known methods including methods such as transfection, infection, calcium chloride, electroporation, microinjection, lipofection, DEAE-dextran method, or other known techniques. The method selected will in part be a function of the type of host cell to be used. These methods and other suitable methods are well known to the skilled artisan.
  • the transformed host cell when cultured under appropriate conditions, synthesizes an anti-Dkk-1 antibody or functional fragment thereof that can subsequently be collected from the culture medium (if the host cell secretes it into the medium) or directly from the host cell producing it (if it is not secreted).
  • the selection of an appropriate host cell will depend upon various factors, such as desired expression levels, polypeptide modifications that are desirable or necessary for activity (such as glycosylation or phosphorylation) and ease of folding into a biologically active molecule.
  • Mammalian cell lines available as hosts for expression are well known in the art and include, but are not limited to, many immortalized cell lines available from the American Type Culture Collection (ATCC), such as Chinese hamster ovary (CHO) cells, HeLa cells, baby hamster kidney (BHK) cells, monkey kidney cells (COS), human hepatocellular carcinoma cells (e.g., Hep G2), and a number of other cell lines.
  • ATCC American Type Culture Collection
  • CHO Chinese hamster ovary
  • HeLa cells HeLa cells
  • BHK baby hamster kidney
  • COS monkey kidney cells
  • human hepatocellular carcinoma cells e.g., Hep G2
  • the best cell line for expressing a particular DNA construct may be selected by testing various cell lines to determine which ones have the highest levels of expression levels and produce antibodies with constitutive Dkk-1 binding properties.
  • compositions in another aspect, provides a composition, e.g., a pharmaceutical composition, containing one or a combination of monoclonal antibodies, or antigen-binding portion(s) thereof, of the present disclosure, formulated together with a pharmaceutically acceptable carrier.
  • a pharmaceutical composition of the disclosure can comprise one or a combination of (e.g., two or more different) antibodies, or immunoconjugates or bispecific molecules of the disclosure.
  • a pharmaceutical composition of the disclosure can comprise a combination of antibodies (or immunoconjugates or bispecifics) that bind to different epitopes on the target antigen or that have complementary activities.
  • Pharmaceutical compositions of the disclosure also can be administered in combination therapy, i.e., combined with other agents.
  • the combination therapy can include a anti-Dkk-1 antibody of the present disclosure combined with at least one other anti-inflammatory or immunosuppressant agent.
  • therapeutic agents that can be used in combination therapy are described in greater detail below in the section on uses of the antibodies of the disclosure.
  • pharmaceutically acceptable carrier includes any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like that are physiologically compatible.
  • the carrier is suitable for intravenous, intramuscular, subcutaneous, parenteral, spinal or epidermal administration (e.g., by injection or infusion).
  • the active compound i.e., antibody, antigen-binding portion thereof, immunoconjugate, or bispecific molecule
  • the active compound i.e., antibody, antigen-binding portion thereof, immunoconjugate, or bispecific molecule
  • the antibodies of the present disclosure may be present in a neutral form (including zwitter ionic forms) or as a positively or negatively-charged species. In some cases, the antibodies may be complexed with a countehon to form a pharmaceutically acceptable salt.
  • the pharmaceutical compounds of the disclosure may include one or more pharmaceutically acceptable salts.
  • a “pharmaceutically acceptable salt” refers to a salt that retains the desired biological activity of the parent compound (e.g., antibody) and does not impart undesired toxicological effects (see e.g., Berge, S. M., et al. (1977) J. Pharm. Sci. 66:1 - 19).
  • the term “pharmaceutically acceptable salt” includes a complex comprising one or more antibodies and one or more counterions, where the counterions are derived from pharmaceutically acceptable inorganic and organic acids and bases.
  • Acid addition salts include those derived from nontoxic inorganic acids, such as hydrochloric, nitric, phosphoric, sulfuric, hydrobromic, hydroiodic, phosphorous and the like, as well as from nontoxic organic acids such as aliphatic mono- and dicarboxylic acids, phenyl- substituted alkanoic acids, hydroxy alkanoic acids, aromatic acids, aliphatic and aromatic sulfonic acids and the like.
  • Base addition salts include those derived from alkaline earth metals, such as sodium, potassium, magnesium, calcium and the like, as well as from nontoxic organic amines, such as N,N'-dibenzylethylenediamine, N- methylglucamine, chloroprocaine, choline, diethanolamine, ethylenediamine, procaine and the like.
  • pharmaceutically acceptable inorganic bases include metallic ions.
  • Metallic ions include, but are not limited to, appropriate alkali metal salts, alkaline earth metal salts and other physiological acceptable metal ions.
  • Salts derived from inorganic bases include aluminum, ammonium, calcium, cobalt, nickel, molybdenum, vanadium, manganese, chromium, selenium, tin, copper, ferric, ferrous, lithium, magnesium, manganic salts, manganous, potassium, rubidium, sodium, and zinc, and in their usual valences.
  • aqueous and nonaqueous carriers examples include water, ethanol, polyols (such as glycerol, propylene glycol, polyethylene glycol, and the like), and suitable mixtures thereof, vegetable oils, such as olive oil, and injectable organic esters, such as ethyl oleate.
  • polyols such as glycerol, propylene glycol, polyethylene glycol, and the like
  • vegetable oils such as olive oil
  • injectable organic esters such as ethyl oleate.
  • Proper fluidity can be maintained, for example, by the use of coating materials, such as lecithin, by the maintenance of the required particle size in the case of dispersions, and by the use of surfactants.
  • compositions typically must be sterile and stable under the conditions of manufacture and storage.
  • the composition can be formulated as a solution, microemulsion, liposome, or other ordered structure suitable to high drug concentration.
  • the carrier can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyethylene glycol, and the like), and suitable mixtures thereof.
  • the proper fluidity can be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants.
  • Sterile injectable solutions can be prepared by incorporating the active compound in the required amount in an appropriate solvent with one or a combination of ingredients enumerated above, as required, followed by sterilization microfiltration.
  • dispersions are prepared by incorporating the active compound into a sterile vehicle that contains a basic dispersion medium and the required other ingredients from those enumerated above.
  • methods of preparation include, but are not limited to, vacuum drying and freeze-drying (lyophilization) that yield a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.
  • the effective amount of a pharmaceutical composition comprising anti-Dkk-1 antibodies or immunologically functional fragments thereof to be employed therapeutically or prophylactically will depend, for example, upon the therapeutic context and objectives.
  • the appropriate dosage levels for treatment will thus vary depending, in part, upon the molecule delivered, the indication for which the anti- Dkk-1 antibody is being used, the route of administration, and the size (body weight, body surface or organ size) and/or condition (the age and general health) of the patient.
  • a clinician may titer the dosage and modify the route of administration to obtain the optimal therapeutic effect.
  • the baseline value for the chosen indicator or indicators is established by examination of the patient prior to administration of the first dose of antibody. Preferably, the baseline examination is done within about 60 days of administering the first dose. If the antibody is being administered to treat acute symptoms, such as for example to treat a broken bone, the first dose is administered as soon as practically possible after the injury has occurred. Improvement is induced by administering the subject anti-Dkk-1 antibodies or immunologically functional fragments thereof until the patient manifests an improvement over baseline for the chosen indicator or indicators.
  • anti-Dkk-1 antibodies or immunologically functional fragments thereof can be administered alone or in combination with other therapeutic agents, for example, in combination with cancer therapy agents, with agents that inhibit osteoclast activity or with other agents that enhance osteoblast activity.
  • inventive antibodies can be administered to cancer patients undergoing radiation therapy or chemotherapy.
  • Chemotherapies used in combination with the inventive antibodies may include anthracyclines, taxol, tamoxifene, doxorubicin, 5-fluorouracil, oxaloplatin, Velcade® ([(1 R)-3-methyl-1 -[[(2S)-1-oxo-3-phenyl-2-
  • kits that include an antibody or immunologically functional fragment or a pharmaceutical composition as described herein are also provided. Some kits include such an antibody, fragment or composition in a container (e.g., vial or ampule), and may also include instructions for use of the antibody or fragment in the various detection, screening and therapeutic applications disclosed above.
  • the Fc ⁇ . portion can be modified to avoid interaction with Fc ⁇ receptor and the complement immune system.
  • This type of modification was designed by Dr. Mike Clark from the Department of Pathology at Cambridge University, and techniques for preparation of such antibodies are described, for example, in WO 99/58572, published November 18, 1999.
  • the constant region may be engineered to more resemble human constant regions to avoid an immune response if the antibody is used for treating human beings. See, for example, U.S. Patent Nos. 5,997,867 and 5,866,692.
  • Modifications to huMabJC18 huMabJC18 is a fully humanized anti-Dkk-1 monoclonal antibody.
  • Amino acid modifications can range from changing or modifying one or more amino acids to complete redesign of a region, such as the variable region. Changes in the variable region can alter binding affinity and/or specificity. In some embodiments, no more than one to five conservative amino acid substitutions are made within a CDR domain. In other embodiments, no more than one to three conservative amino acid substitutions are made within a CDR domain. In still other embodiments, the CDR domain is CDR H3 and/or CDR L3. Glycosylation of huMabJC 18
  • the antibody comprises a modified constant region, such as a constant region that is immunologically inert or partially inert, e.g., does not trigger complement mediated lysis, does not stimulate antibody- dependent cell mediated cytotoxicity (ADCC), or does not activate microglia; or have reduced activities (compared to the unmodified antibody) in any one or more of the following: triggering complement mediated lysis, stimulating antibody-dependent cell mediated cytotoxicity (ADCC), or activating microglia.
  • Different modifications of the constant region may be used to achieve optimal level and/or combination of effector functions. See, for example, Morgan et al., Immunology 86:319-324 (1995); Lund et al., J.
  • the constant region is aglycosylated enzymatically (such as removing carbohydrate by enzyme PNGase).
  • antibody modifications include antibodies that have been modified as described, e.g., in WO 99/58572, published November 18, 1999. These antibodies comprise, in addition to a binding domain directed at the target molecule, an effector domain having an amino acid sequence substantially homologous to all or part of a constant domain of a human immunoglobulin heavy chain. These antibodies are capable of binding the target molecule without triggering significant complement dependent lysis, or cell-mediated destruction of the target. In some embodiments, the effector domain is capable of specifically binding FcRn and/or Fc ⁇ Rllb. These are typically based on chimeric domains derived from two or more human immunoglobulin heavy chain C H 2 domains.
  • every amino acid position in a CDR is replaced (in some embodiments, one at a time) with all 20 natural amino acids using art recognized mutagenesis methods (some of which are described herein).
  • This generates small libraries of clones (in some embodiments, one for every amino acid position that is analyzed), each with a complexity of 20 members (if all 20 amino acids are substituted at every position).
  • the library to be screened comprises substitutions in two or more positions, which may be in the same CDR or in two or more CDRs.
  • the library may comprise substitutions in two or more positions in one CDR.
  • the library may comprise substitution in two or more positions in two or more CDRs.
  • the library may comprise substitution in 3, 4, 5, or more positions, said positions found in two, three, four, five or six CDRs.
  • the substitution may be prepared using low redundancy codons. See, e.g., Table 2 of Balint et al. (1993) Gene 137(1 ):109-18).
  • the CDR may be CDRH3 and/or CDRL3.
  • the CDR may be one or more of CDRL1 , CDRL2, CDRL3, CDRH1 , CDRH2, and/or CDRH3.
  • the CDR may be a Kabat CDR, a Chothia CDR, or an extended CDR.
  • Candidates with improved binding may be sequenced, thereby identifying a CDR substitution mutant which results in improved affinity (also termed an "improved" substitution).
  • Candidates that bind may also be sequenced, thereby identifying a CDR substitution which retains binding. Multiple rounds of screening may be conducted.
  • Library scanning mutagenesis also provides a means for characterizing a CDR, in so far as the frequency of clones with improved binding, the same binding, decreased binding or no binding also provide information relating to the importance of each amino acid position for the stability of the antibody-antigen complex. For example, if a position of the CDR retains binding when changed to all 20 amino acids, that position is identified as a position that is unlikely to be required for antigen binding. Conversely, if a position of CDR retains binding in only a small percentage of substitutions, that position is identified as a position that is important to CDR function. Thus, the library scanning mutagenesis methods generate information regarding positions in the CDRs that can be changed to many different amino acid (including all 20 amino acids), and positions in the CDRs which cannot be changed or which can only be changed to a few amino acids.
  • Candidates with improved affinity may be combined in a second library, which includes the improved amino acid, the original amino acid at that position, and may further include additional substitutions at that position, depending on the complexity of the library that is desired, or permitted using the desired screening or selection method.
  • adjacent amino acid position can be randomized to at least two or more amino acids. Randomization of adjacent amino acids may permit additional conformational flexibility in the mutant CDR, which may in turn, permit or facilitate the introduction of a larger number of improving mutations.
  • the library may also comprise substitution at positions that did not show improved affinity in the first round of screening.
  • the second library is screened or selected for library members with improved and/or altered binding affinity using any method known in the art, including screening using BIAcore surface plasmon resonance analysis, and selection using any method known in the art for selection, including phage display, yeast display, and ribosome display. Fusion Proteins
  • compositions comprising huMabJC18 antibodies or polypeptides conjugated (for example, linked) to an agent that facilitate coupling to a solid support (such as biotin or avidin).
  • a solid support such as biotin or avidin.
  • Conjugation generally refers to linking these components as described herein.
  • the linking (which is generally fixing these components in proximate association at least for administration) can be achieved in any number of ways. For example, a direct reaction between an agent and an antibody is possible when each possesses a substituent capable of reacting with the other.
  • the invention provides polynucleotides encoding any of the antibodies (including antibody fragments) and polypeptides described herein.
  • the provided polynucleotides can be made by procedures known in the art.
  • the invention provides compositions (including pharmaceutical compositions described in more detail in the foregoing and below) comprising any of the polynucleotides of the invention.
  • the composition comprises an expression vector comprising a polynucleotide encoding huMabJC18 as described herein.
  • the composition comprises an expression vector comprising a polynucleotide encoding any of the antibodies or polypeptides described herein.
  • the composition comprises either or both of the polynucleotides shown in SEQ ID NO: 19 and SEQ ID NO: 28. Expression vectors and administration of polynucleotide compositions are further described herein.
  • the invention provides methods of making any of the polynucleotides described herein.
  • Polynucleotides complementary to any such sequences are also encompassed by the present invention.
  • Polynucleotides may be single-stranded (coding or antisense) or double-stranded, and may be DNA (genomic, cDNA or synthetic) or RNA molecules.
  • RNA molecules include HnRNA molecules, which contain introns and correspond to a DNA molecule in a one-to-one manner, and mRNA molecules, which do not contain introns. Additional coding or non-coding sequences may, but need not, be present within a polynucleotide of the present invention, and a polynucleotide may, but need not, be linked to other molecules and/or support materials.
  • the "percentage of sequence identity” is determined by comparing two optimally aligned sequences over a window of comparison of at least 20 positions, wherein the portion of the polynucleotide or polypeptide sequence in the comparison window may comprise additions or deletions (i.e. gaps) of 20 percent or less, usually 5 to 15 percent, or 10 to 12 percent, as compared to the reference sequences (which does not comprise additions or deletions) for optimal alignment of the two sequences.
  • additions or deletions i.e. gaps
  • the percentage is calculated by determining the number of positions at which the identical nucleic acid bases or amino acid residue occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the reference sequence (i.e., the window size) and multiplying the results by 100 to yield the percentage of sequence identity.
  • Variants may also, or alternatively, be substantially homologous to a native gene, or a portion or complement thereof.
  • Such polynucleotide variants are capable of hybridizing under moderately stringent conditions to a naturally occurring DNA sequence encoding a native antibody (or a complementary sequence).
  • Suitable “moderately stringent conditions” include prewashing in a solution of 5 X SSC, 0.5% SDS, 1.0 mM EDTA (pH 8.0); hybridizing at 50°C-65°C, 5 X SSC, overnight; followed by washing twice at 65°C for 20 minutes with each of 2X, 0.5X and 0.2X SSC containing 0.1 % SDS.
  • polynucleotides of this invention can be obtained using chemical synthesis, recombinant methods, or PCR. Methods of chemical polynucleotide synthesis are well known in the art and need not be described in detail herein. One of skill in the art can use the sequences provided herein and a commercial DNA synthesizer to produce a desired DNA sequence.
  • RNA can be obtained by using the isolated DNA in an appropriate vector and inserting it into a suitable host cell. When the cell replicates and the DNA is transcribed into RNA, the RNA can then be isolated using methods well known to those of skill in the art, as set forth in, e.g., Sambrook et al., (1989).
  • Suitable cloning vectors may be constructed according to standard techniques, or may be selected from a large number of cloning vectors available in the art. While the cloning vector selected may vary according to the host cell intended to be used, useful cloning vectors will generally have the ability to self-replicate, may possess a single target for a particular restriction endonuclease, and/or may carry genes for a marker that can be used in selecting clones containing the vector.
  • Suitable examples include plasmids and bacterial viruses, e.g., pUC18, pUC19, Blueschpt (e.g., pBS SK+) and its derivatives, mp18, mp19, pBR322, pMB9, CoIEI , pCR1 , RP4, phage DNAs, and shuttle vectors such as pSA3 and pAT28.
  • plasmids and bacterial viruses e.g., pUC18, pUC19, Blueschpt (e.g., pBS SK+) and its derivatives, mp18, mp19, pBR322, pMB9, CoIEI , pCR1 , RP4, phage DNAs, and shuttle vectors such as pSA3 and pAT28.
  • pSA3 and pAT28 shuttle vectors
  • Expression vectors generally are replicable polynucleotide constructs that contain a polynucleotide according to the invention. It is implied that an expression vector must be replicable in the host cells either as episomes or as an integral part of the chromosomal DNA. Suitable expression vectors include, but are not limited to, e.g, plasmids, viral vectors, including adenoviruses, adeno-associated viruses, retroviruses, cosmids, and expression vector(s) disclosed in WO 87/04462.
  • Vector components may generally include, but are not limited to, one or more of the following: a signal sequence; an origin of replication; one or more marker genes; suitable transcriptional controlling elements (such as promoters, enhancers and terminator). For expression (i.e., translation), one or more translational controlling elements are also usually required, such as ribosome binding sites, translation initiation sites, and stop codons.
  • Non-limiting examples of mammalian host cells include, but are not limited to: COS, HeLa, and CHO cells. See also, e.g., WO 87/04462.
  • Suitable non- mammalian host cells include prokaryotes (such as E. coli or B. subtillis) and yeast (such as S. cerevisae, S. pombe; or K. lactis).
  • the host cells express the cDNAs at a level of about 5 fold higher, more preferably 10 fold higher, even more preferably 20 fold higher than that of the corresponding endogenous antibody or protein of interest, if present, in the host cells.
  • Screening the host cells for a specific binding to Afc>i-4o is effected by, e.g., an immunoassay or FACS.
  • a cell overexpressing the antibody or protein of interest can be identified.
  • mice were immunized intraperitoneal ⁇ with 50ug/dose/mouse of KLH- conjugated rhuDkk-1 protein. This dose was repeated on 3 occasions over a 4 week period. 2 days and 1 day before fusion the mice received a final boost of 50ugs of protein. Spleen lymphocytes were fused with the non secretory sp2/0 myeloma cell line and subjected to HAT selection as previously described (Galfre and Milstein, Methods Enzymol 73 3-46 (1981 )). A hybridoma secreting Dkk1 -specific IgG was recovered, subcloned and detected using assays described below.
  • Dkk-1 specific antibodies were detected using the following ELISA based method.
  • rhuDkk-1 protein R&D systems cat no. 1096 DK/CF
  • coating buffer Sigma carbonate/bicarbonate coating buffer pH 9.6 Cat No. C-3041 made up according to manufacturers instructions.
  • 10OuIs of Dkk-1 was added per well to Nunc Maxisorp 96 well plates and incubated overnight at 4 0 C. Wells were washed 4x with 250uls/well of wash buffer (0.05% (v/v) Tween-20 (Sigma Cat no. P2287) in dPBS without Ca/Mg++ (Sigma Cat No.
  • blocking buffer (1 % PVA (Sigma cat no. 363170) (weight/volume) in dPBS (Sigma cat no.D8537)) for 2hrs at room temperature. Blocking buffer was then removed by rapid decanting. Antibodies were diluted by consecutive 2-fold serial dilutions in blocking buffer and applied to each plate at 100 ul per well. Plates were incubated for 1 hour at RT and then washed as described above.
  • Binding of the test antibody to Dkk was determined by addition of a secondary antibody specific for the antibody species.
  • murine antibodies 100uls/well of an HRP conjugated Goat anti-Mouse IgG (H&L) was used at a dilution of 1 in 4000 in blocking buffer (Jackson ImmunoResearch Cat No. 115-035-146).
  • humanized antibodies 100uls/well of an HRP conjugated Goat anti- Human IgG F(ab')2 was used at a dilution of 1 in 4000 in blocking buffer (Jackson ImmunoResearch Cat No. 109-035-097). The plates were incubated for 30 mins at room temperature then washed 2x as described above.
  • JC18 The ability of JC18 to bind to other human Dkk proteins was assessed using the ELISA protocol described above with the exception that plates were also coated with recombinant human Dkk3 (R&D systems Cat No. 1118-DK/CF) and Dkk4 (R&D systems Cat No. 1269-DK/CF). JC18 showed weak binding to human Dkk-4 and no binding to human Dkk-3 up to 5ug/ml.
  • JC18 The ability of JC18 to bind to other species Dkk proteins was assessed using the ELISA protocol described above with the exception that plates were also coated with recombinant rat Dkk-1 (R&D systems Cat No. 4010-DK/CF), mouse Dkk-1 (R&D systems Cat No. 1765-DK/CF), mouse Dkk-2 (R&D systems Cat No. 2435-DK/CF), and mouse Dkk-4 (R&D systems Cat No. 3105-DK/CF).
  • JC18 showed: (1 ) similar binding to mouse and rat Dkk-1 as human Dkk-1 , up to 5ug/ml; (2) no binding to mouse Dkk-2, up to 5ug/ml; and (3) weak binding to mouse Dkk-4, up to 5ug/ml.
  • RNAeasy Mini kit from QIAGEN.
  • cDNA was synthesized using Superscript III RT kit from Invitrogen.
  • Variable regions from the Dkk-1 antibodies were cloned using the mouse IgG-Primer Sets from Novagen, which consist of degenerate primers for cloning mouse IgG heavy chain genes and the mouse kappa or lambda light chains.
  • PCR cycling conditions were the followings: 1 cycle at 94 0 C for 2 min; five cycles at 94 0 C for 30 sec, 44 0 C for 30 sec and 68 0 C for 60 sec; followed by 25 cycles at 94 0 C for 30 sec, 54 0 C for 30 sec and 68 0 C for 60 sec.
  • the resulting PCR products were cloned into Topo-TA cloning vector from Invitrogen and sequenced.
  • the cloned antibody sequences were confirmed by direct comparison using mass spectrometry (MS) analysis of the cloned antibody sequences and the original antibodies produced from ascites.
  • MS mass spectrometry
  • nucleotide sequence and the predicted amino acid sequence of the light and heavy chains of the variable regions of the JC18 wildtype (mouse) monoclonal antibody are provided below.
  • the master plate was stored at 4°C and the cells from the working plate were pelleted at 5000 rpm and resuspended with 1 mL of LB+Ampicillin (50 ⁇ g/ml)+ 1 mM IPTG to induce expression of Fabs.
  • HBS-EP 100 mM HEPES buffer pH 7.4, 150 mM NaCI, 0.005% P20. Lysis of HBS-EP resuspended cells was attained by one cycle of freezing (-80 0 C) then thawing at 37°C. Cell lysates were centrifuged at 5000 rpm for 30 min to separate cell debris from supernatants containing Fabs. Supernatants were filtered using 96-well Multiscreen HTS filter plates (Millipore, cat# MSFBN6B50). The supernatants were then injected into the BIAcore plasmon resonance apparatus to obtain affinity information for each Fab. Clones expressing Fabs were rescued from the master plate to sequence the DNA and for large scale Fab production and detailed characterization as described below.
  • heavy and light chain variable regions were cloned in mammalian expression vectors and transfected using lipofectamine into HEK 293 cells for transient expression.
  • Antibodies were purified with protein A using standard methods.
  • BIAcore Assays The affinity of huMabJC18 to human, mouse or rat Dkk1 was determined by using the BIAcore3000TM surface plasmon resonance (SPR) system (BIAcore Inc., Piscataway, NJ), equipped with a CM5 sensor chip (BIAcore AB, Uppsala, Sweden). For the huMabJC18-human Dkk1 interaction analysis, reaction surfaces were generated by amine coupling of huMabJC18 to three flow cells (Fc2, Fc3 and Fc4).
  • SPR surface plasmon resonance
  • huMabJC18 For the interaction analyses of huMabJC18 with mouse or rat Dkk-1 , low-levels of huMabJC18 (typically, 100-400 response units) were captured on individual flow cells by goat Fab2 anti-human Fc, which was pre-immobilized to the CM5 chip surface. A goat Fab2 anti-human Fc-saturated flow cell containing no humanized antibody served as reference channel. Mouse or rat Dkk-1 (R&D Systems) was titrated over the chip using 70.1 nM or 30.2 nM as top concentration, respectively, of a three-fold dilution series Association and dissociation phases were monitored at 100 ⁇ L/min for 90 seconds and 30 minutes, respectively. Capture surfaces for all experiments were regenerated with two 30 second pulses of 0.75mM H 3 PO 4 , except for the amine-coupled huMabJC18 surface used in the human Dkk-1 experiment, which was not regenerated.
  • BIAcore For screening assays to determine binding and dissociation rates of huMabJC18 variants to human Dkk1 , either BIAcore or ProteOn XPR36 (BioRad, Inc.) systems were used.
  • biotinylated-human Dkk1 was captured on SA (streptavidin) BIAcore chips according to the supplier's instructions.
  • Biotinylated-human Dkk-1 protein was diluted into HBS-EP, and injected over the chip at a concentration of 5 ⁇ g/ml_. Flow times across the individual chip channels were selected to achieve an antigen density of approximately 500-600 response units (RU).
  • HBS-EP buffer was used as running buffer.
  • binding affinity of huMabJCW and its variants to Dkk1 The amino acid sequences of huMabJC18 is as set forth in SEQ ID NO: 40 (HC variable region) and SEQ ID NO: 42 (LC variable region).
  • SEQ ID NO: 40 HC variable region
  • SEQ ID NO: 42 LC variable region
  • the binding affinity of huMabJC18 IgG to Dkk-1 determined using BIAcore as described above is shown in Table 3 below.
  • Table 4 Amino acid sequences and kinetic data for huMabJC18 and its variants as determined at 37°C by BIAcore or Proteon analyses
  • # represents a gap in that position(s); n.d., not determined.
  • K 0 values were therefore determined experimentally by measuring k on .
  • Other K 0 values are theoretical, based on an estimated k on value of 1x10 6 (1/Ms). Since onrates for all analyzed clones were very fast and thus diffusion limited (>1x10 6 , and too fast to measure accurately), affinities are most likely even higher than shown.
  • HuMabJC18 was analyzed for binding to other available Dkk homologs, including human Dkk-3, human Dkk-4, mouse Dkk-2 and mouse Dkk-4 (R&D Systems). The results are summarized in Table 5. Table 5: Interaction of huMabJC18 with Dkk homologs
  • the binding affinities of mouse antibody JC18 to human, mouse or rat Dkk1 (R&D Systems) as determined at 25°C by BIAcore analysis are shown in Table 6 below.
  • polyclonal anti-mouse IgG was amine-coupled to the BIAcore chip.
  • Anti- Dkk-1 antibody JC18 is at 6.53 ⁇ g/ml, and was captured for 1 min at 5 ⁇ l/min.
  • a five-fold series dilution of human, mouse or rat Dkk-1 (R&D Systems; from 0.4-25OnM) was injected for 1 min at 50-100 ⁇ l/min. Dissociation was monitored for 3-5 min.
  • the chip was regenerated with two 30-sec pulses of 10OmM H 3 PO 4 .
  • Table 6 Kinetic data for mouse antibody JC18 binding to human, mouse or rat Dkk-1 as determined by BIAcore at 25°C.
  • Glycosylation Site HC, N296.
  • U2OS cell line (U2OS TF) containing the Luciferase reporter gene under control of the TK promoter with TCF binding sites was chosen for the cell-based functional assay.
  • the promoter is activated through the Wnt signaling pathway, when cells are treated with Wnt3a conditioned media. This activation is antagonized by Dkk-1.
  • the Dkk-1 -mediated inhibition of Wnt signaling in turn, can be reversed by adding a Dkk-1 neutralizing mAb.
  • JC18 is a monoclonal antibody that binds to mouse and human Dkk-
  • U2OS TOPFIash cells were obtained from the ATCC and stably transfected with TOPFIash plasmid (Upstate), a TCF-luciferase reporter construct. Cells were maintained at 37 0 C, 5% CO2 in McCoys 5A Media supplemented with 10% fetal calf serum, 1 % Pen Strep, and 2mM Glutamine. U2OS TOPFIash cells were plated in regular growth media at a density of 31 ,250 cells/cm 2 and incubated overnight.
  • mice Female adult C57BL/6 mice are used for the evaluation of skeletal effect of test Dkk-1 antibodies in vivo.
  • the animals are housed at 24°C with a 12h light/12h dark cycle and allowed free access to water and a commercial diet (Purina laboratory Rodent Chow 5001 , Puhna-Mills, St. Louis, MO).
  • the experiments are conducted according to Pfizer animal care-approved protocols, and animals were maintained in accordance with the ILAR (Institute of Laboratory Animal Research) Guide for the Care and Use of Laboratory Animals.
  • the mice are treated with either vehicle or antibodies by oral gavage once or twice per week for various weeks.
  • the mice are euthanized and the serum is harvested for the measurements of free antibody and free Dkk-1 levels.
  • bone samples are harvested for assessing the changes in bone mass and bone formation by peripheral quantitative computed tomography (pQCT), micro-CT, and histomorphometry.
  • pQCT peripheral quantitative computed tomography
  • the right femurs are scanned by pQCT (Stratec XCT Research M; Norland Medical Systems, Fort Atkison, Wl, USA) with software version 5.40.
  • a 1 -mm-thick cross-section of each distal femoral metaphysis is taken at 2.5 mm proximal to the distal end (-1.5 mm to the growth plate, a cancellous bone enriched site), and 1 -mm-thick cross-section of each femoral diaphysis is taken at 8 mm proximal from the distal end (a cortical bone enriched site) with a voxel size of 0.10 mm.
  • Volumetric bone content, density and area are determined for total, trabecular and cortical bone.
  • the right femurs are scanned by a microCT machine (Micro-CT40, Scanco Medical, Auenhng 6-8, Bassersdorf, Switzerland) with software version 3.1.
  • the left femurs are processed for histomorphomethc assessment on cancellous bone. Briefly, the left femurs are dehydrated in graded concentrations of ethanol and embedded undecalcified in methyl methacrylate. Longitudinal frontal sections of the distal femur are cut at 4- and 10- ⁇ r ⁇ n thickness using a Reichert-Jung Polycut S microtome (Leica Corp., Heidelberg, Germany). The 4- ⁇ r ⁇ n sections are stained with a modified Masson's Trichrome stain and the 10- ⁇ r ⁇ n sections remained unstained.
  • All histomorphometric measurements are performed in cancellous bone tissue of the distal femoral metaphyses in an area between 0.375 and 0.875 mm proximal to the growth plate-epiphyseal junction using an image analysis system (Osteomeasure, Inc., Altanta, GA). Cancellous bone volume as a percentage of bone tissue area and osteoclast surface as a percentage of total cancellous perimeter are measured in 4- ⁇ r ⁇ n thick, stained sections. Trabecular number, thickness and separation are calculated.
  • Fluorochrome-based indices of bone formation including the percentage of cancellous bone surface with a double fluorochrome label (mineralizing surface), mineral apposition rate, bone formation rates (bone surface and tissue volume referent) are obtained in 10- ⁇ m thick, unstained sections.
  • mice Female adult C57BL/6 mice were orally dosed with vehicle or mouse IgGI or
  • mice 0, 0.001 , 0.01 , 0.1 , 1 , 3, 10, and 30 mg/kg, weekly for 6 weeks.
  • One group of mice was treated with mouse chimera at 5 mg/kg, twice per week for 6 weeks.
  • Right distal femur of each animal was analyzed using pQCT.
  • mouse chimera increased total BMD at doses from 1 to 30 mg/kg compared with vehicle treatment.
  • SEQ ID NO: 43 chimeric antibody (hu-mu): chimeric huMabJC18Lvar-mouse kappa aa sequence EIVLTQSPATLSLSPGERATLSCRASESVDDFGISFINWYQQKPGQAPRL
  • SEQ ID NO: 44 chimeric antibody (hu-mu): chimeric huMabJC18Hvar-mouselgG1 constant aa sequence
  • SEQ ID NO: 45 chimeric antibody (hu-mu): huMabJC18Lvar nt sequence GAGATCGTGCTGACCCAGAGCCCCGCCACCCTGAGCCTGAGCCCTG GCGAGCGGGCCACCCTGTCCTGCCGGGCCAGCGAGAGCGTGGACG ACTTCGGCATCAGCTTCATCAACTGGTATCAGCAGAAGCCCGGCCAG GCCCCCAGACTGCTCATCTACGCCGGCAGCAAGCAGGGCAGCGGC ATCCCCGCCAGGTTCAGCGGCAGCGGCACCGACTTCACCC
  • SEQ ID NO: 46 chimeric antibody (hu-mu): mouse kappa nt sequence
  • SEQ ID NO: 47 chimeric antibody (hu-mu): huMabJC18Hvar nt sequence GAGGTGCAGCTGGTCGAGTCTGGCGGCGGACTGGTGCAGCCTGGC
  • SEQ ID NO: 48 chimeric antibody (hu-mu): mouse IgGI CH1 -CH2-CH3 nt sequence GCCAAAACGACACCCCCATCTGTCTATCCACTGGCCCCTGGATCTGC
  • Ovariectomized Mouse Model Female adult C57BL/6 mice are subjected to sham or ovariectomized (OVX) surgery for the evaluation of skeletal effect of test Dkk-1 antibodies in an estrogen deficient condition, which mimic postmenopausal bone loss. The animals are housed at 24°C with a 12h light/12h dark cycle and allowed free access to water and a commercial diet (Purina laboratory Rodent Chow 5001 , Puhna-Mills, St. Louis, MO). The experiments are conducted according to Pfizer animal care-approved protocols, and animals were maintained in accordance with the ILAR (Institute of Laboratory Animal Research) Guide for the Care and Use of Laboratory Animals.
  • ILAR Institute of Laboratory Animal Research
  • mice are treated with either vehicle or antibodies by oral gavage once or twice per week for various weeks.
  • the mice are euthanized and the bone samples are harvested for assessing the changes in bone mass by peripheral quantitative computed tomography (pQCT), micro CT, and histomorphometry.
  • pQCT peripheral quantitative computed tomography
  • micro CT micro CT
  • histomorphometry The methodologies of these measurements have been described in the earlier section.
  • mice at 4 months of age were subjected to either sham or ovariectomized (OVX) surgeries and treated with either vehicle or JC18 at 0.3, 1 , 3, 10, and 30 mg/kg weekly, or JC18 at 15 mg/kg twice weekly for 8 weeks starting the day after surgery.
  • OVX ovariectomized
  • JC18 dose-responsively increased total BMD as measured by pQCT at distal femurs by
  • mice treated with JC18 at 15 mg/kg twice weekly the total BMD was not only higher than vehicle-treated OVX mice but also maintained at the sham control level, indicating that at this dose and dosing regimen JC18 completely prevented the development of osteopenia in OVX mice
  • Distal femur BMD and femeral shaft BMC bone mineral content were significantly increased by 11 and 16% or 7 and 8%, respectively, in the rats treated with huMabJC18 at doses of 10 and 100 mg/kg, indicating an increase of cancellous and cortical bone mass in these animals.
  • Osteoporosis is a bone disease characterized by low bone mineral density which leads to bone fragility and subsequently to bone fractures.
  • the majority of pharmacological osteoporosis therapies including bisphosphonates, calcitonin, HRT and selective estrogen receptor modulators (SERM), prevent bone loss by reducing bone resorption. Restoration of bone mass in patients suffering from osteoporosis is an area of unmet medical need.
  • a neutralizing Dkk-1 antibody is expected to increase bone mass due to increased bone formation by osteoblasts and, thus, prevent osteoporotic fractures.
  • HuMabJC18 is a humanized prototype anti-Dkk-1 monoclonal antibody for the treatment of osteoporosis, among other disorders. It binds human, mouse, rat and cynomolgous monkey Dkk-1 in vitro with high affinities (Kd ⁇ 100pM). It increases bone mass in intact mice and restores bone mass to the osteopenic skeleton of ovahectomized mice, a model of postmenopausal bone loss (Li et al., 2009; manuscript in preparation).
  • PK Pharmacokinetics
  • PD Pharmacodynamics
  • the purpose of the study was to compare and contrast predicted clinical starting doses of an anti-Dkk-1 lgG2 antibody (huMabJC18) obtained by the following calculations: (1 ) no adverse effect level (NOAEL) in toxicology species, (2) minimum anticipated biological effect level (MABEL) using the classical Duff equation and (3) MABEL using a target-mediated drug disposition (TMDD) model.
  • NOAEL no adverse effect level
  • MABEL minimum anticipated biological effect level
  • TMDD target-mediated drug disposition
  • Preclinical safety studies in rat and monkey were used to determine NOAEL.
  • a 100-fold safety factor was applied to the NOAEL to generate a recommended starting dose.
  • the classical Duff equation was used to calculate receptor occupancy and the MABEL was defined as the dose which resulted in 10% receptor occupancy.
  • a TMDD model was used to fit free Dkk-1 and antibody concentrations over time in the rat and monkey studies. The model was extrapolated to humans and MABEL was estimated to be the dose which gave 10% reduction in Dkk-1.
  • Monoclonal anti-Dkk-1 antibodies were made at Genovac (Germany) by immunization of Balb/C mice with full-length recombinant human Dkk-1 protein (R&D Systems, Minneapolis, MN).
  • a single mouse Igd/kappa isotype antibody (JC18) was humanized and affinity matured using a library scanning mutagenesis strategy (Pons et al., 2009; manuscript in preparation).
  • the humanized antibody exhibited a >100-fold increase in affinity for both human and mouse Dkk-1.
  • HDkk-1 -V5-6His human
  • rDkk-1-TEV-V5-6His rat
  • BIAcore experiment Interaction between huMabJC18 and human or mouse or rat or Cynomolgous monkey Dkk-1 were analyzed using a BIAcore 3000TM system equipped with a CM5 sensor chip (BIAcore AB, Uppsala, Sweden). The association and dissociation phases were monitored during the interaction analysis. The binding responses were double- referenced and fit globally to a simple model using BiaEvaluation v.4.0 software. Affinities were deduced from the quotient of the kinetic rate constants k on ).
  • Serial blood samples were collected pre-dose and at 0.083, 0.25, 0.5, 1 , 2, 4, 6, 8 and 24 hours post-dose.
  • Serial blood samples (300 ⁇ l) were collected pre- dose and at 0.083, 0.17, 0.33, 0.5, 1 , 2, 4 and 6 hours post-dose. Serum was obtained by centrifugation and stored at -2O 0 C until analysis.
  • Serial blood samples were collected pre-dose and at 1 , 3, 8, 24, 48, 72, 168, 240, 336, 408, 504, 576, 672, 744, 840, 912 and 1008 hours post first dose from each treatment group. Serum was obtained by centrifugation and stored at -2O 0 C until analysis for Dkk-1 and huMabJC18 concentrations.
  • Bone mineral density determination in rats To assess the effect of anti-Dkk-1 mAb treatment on bone mass, the excised right femurs were scanned by peripheral quantitative computed tomography (pQCT, Stratec XCT Research M, Norland Medical Systems, Fort Atkinson, Wl) with software version 5.40. A 1 -mm thick cross section of each distal femoral metaphysis was scanned at 2.5 mm proximal to the distal end, a cancellous bone enriched site, with a voxel size of 0.10 mm. Volumetric total bone mineral density (BMD) was determined as previously described (Ke et al., 2001 ).
  • Serum concentrations of V5 tagged Dkk-1 were determined by an ELISA method. Samples were diluted in a PBS buffer (containing 3% BSA and 0.05% Tween-20) to a final minimum required dilution (MRD) range of 1/4 to 1/40, used to reduce background and enable concentrations to fall within the linear range of the assays (-0.195-25 ng/ml on assay plate). hDkk-1 -V5-6His or rDkk-1 -TEV-V5-6His calibration and quality control standards were diluted into the same matrix composition as samples.
  • MRD final minimum required dilution
  • the 96-well immunosorbent assay plates (Nalgene Nunc, Rochester, NY) were overnight coated at 4°C with 50 ⁇ l of anti-V5 antibody (Invitrogen, Carlsbad, CA) at 2 ⁇ g/ml then washed with PBS buffer containing 0.05% Tween-20 followed by blocking with PBS buffer containing 3% BSA and 0.05% Tween-20.
  • the diluted samples and standards were added to plates (50 ⁇ l/ well) and incubated with shaking at room temperature for 1 hour. The plates were then washed with two wash cycles, followed by incubation with a horseradish peroxidase-conjugated anti-Dkk-1 secondary antibody (from Assay Designs kit, Ann Arbor, Ml) for 1 hour.
  • TMB 3,3',5,5'-tetramethylbenzidine
  • KPL 3,3',5,5'-tetramethylbenzidine
  • 2M H 2 SO 4 2M H 2 SO 4 .
  • Blank matrix OD values were background subtracted after the absorbance OD reading was determined at a wavelength of 450 nm (with subtraction of 650 nm).
  • the V5 tagged Dkk-1 calibration standards were used to construct a standard curve using 4-parameter fitting with uniform weighting in SoftMax Pro 4.8. Serum concentrations of V5 tagged Dkk-1 in unknown samples were interpolated from this standard curve.
  • Serum osteocalcin concentrations were measured by using the Rat-MIDTM Osteocalcin ELISA Kit (Nordic Bioscience Diagnostics A/S, Herlev, Denmark).
  • Serum concentrations of huMabJC18 were determined by an electrochemiluminescence (ECL) method using a Meso Scale Discovery (MSD) system (Gaithersburg, MD). Samples were diluted in a PBS buffer containing 1 % BSA to a final minimum required dilution (MRD) of 1/2 to 1/150 followed by an additional 10-4000 fold dilution in order to reduce background interference and to fall within the linear range of the assays (-5-1300 ng/ml on assay plate). HuMabJC18 calibration and quality control standards were diluted into the same matrix composition as samples.
  • ECL electrochemiluminescence
  • MSD Meso Scale Discovery
  • 96-well MSD high bind plates (Cat# L11XB-3) were overn ight coated at 4 ° C with hDkk-1-V5-6His (generated internally) at 5 ⁇ g/ml. After inverting the plate to remove the coat, plates were blocked with 1 % BSA in PBS. The diluted samples and standards were added to plates (25 ⁇ l/ well) and incubated with shaking at room temperature for 2 hours. The plates were then washed with three wash cycles with PBS buffer containing 0.05% Tween-20, followed by incubation with a MSD ruthinylated goat anti-human IgG antibody (Cat# R32AJ-1 ) for 1 hour.
  • a MSD ruthinylated goat anti-human IgG antibody (Cat# R32AJ-1 ) for 1 hour.
  • MSD read buffer T (4x) with surfactant (Cat# R92TC-1 ) was added to each well and immediately read on a MSD Sector Imager 6000. Blank matrix values were background subtracted from the sample values.
  • the anti-Dkk- 1 humanized antibody calibration standards were used to construct a standard curve using 4-parameter fitting with 1/y 2 weighting in the MSD Discovery Workbench v 3.0 software. Serum concentrations of anti-DKK-1 humanized antibody in unknown samples were interpolated from this standard curve.
  • Serum concentrations of huMabJC18 were determined by an ELISA method. Samples were diluted in a PBS buffer (containing 3% BSA and 0.05% Tween-20) to a final minimum required dilution (MRD) of 1/4 to 1/100 followed by an additional 10-500 fold dilution in order to reduce background interference and to fall within the linear range of the assays (-8-100 ng/ml on assay plate). HuMabJC18 calibration and quality control standards were diluted into the same matrix composition as samples.
  • the 96-well immunosorbent assay plates were overnight coated at 4 ° C hDkk-1 -V5-6His (generated internally) at 1 .5 ⁇ g/ml and then blocked with PBS (containing 3% BSA and 0.05% Tween-20) after washing with PBS buffer containing 0.05% Tween-20.
  • PBS containing 3% BSA and 0.05% Tween-20
  • the diluted samples and standards were added to plates (100 ⁇ l/well) and incubated with shaking at room temperature for 1 hour.
  • the anti-Dkk-1 humanized antibody calibration standards were used to construct a standard curve using 4-parameter fitting with uniform weighting in SoftMax Pro 4.8. Serum concentrations of anti-Dkk-1 humanized antibody in unknown samples were interpolated from this standard curve.
  • Presence of anti-drug antibodies (ADA) against huMabJC18 in rat and monkey was measured with a bridging ligand binding assay (LBA) using the Meso Scale Discovery (MSD) platform (Gaithersburg, MD).
  • Serum samples 25 ⁇ l
  • assay diluent 3% BSA, 0.05% Tween 20, PBS
  • the plate was washed and 25 ⁇ l of ruthenium labeled huMabJC18 was added to each well at 1 ⁇ g/ml and incubated again for 1 hour at room temperature.
  • the plate was washed and following addition of 150 ⁇ l of MSD read buffer (2x), the plate was read on a MSD Sector Imager 6000.
  • Pharmacokinetic analysis was performed using the WinNonLin Enterprise Edition computer software, Version 5.2 (Pharsight Corp., Cary, NC).
  • the terminal phase rate constant ⁇ k e i) was determined by linear regression of the log plasma concentration time profile.
  • the terminal elimination half-life (t 1/2 ) was calculated from 0.693/ /c e /.
  • C max , T max and C mm values were obtained directly from recorded data.
  • Area under the serum- concentration time curve (AUCo-tiast) was calculated using the linear trapezoidal rule and extrapolated to infinity (AUC 0- ⁇ n f ) using /c e/ .
  • the elimination half-life value quoted for h-Dkk-1 was a mean of the half-life values determined at 5, 10 and 100 ⁇ g/kg dose levels. Insufficient data points were available to calculate an elimination half-life value at the 1 ⁇ g/kg dose level.
  • the elimination half-life was calculated from a na ⁇ ve pool analysis of the 3 rats at 100 ⁇ g/kg, which was the only dose administered.
  • Pharmacokinetic/ pharmacodynamic analysis A preliminary non-compartmental analysis (Jusko, 1992) of individual rat and monkey antibody concentration versus time data was conducted, revealing non-linear pharmacokinetics of the antibody.
  • a mechanistic target-mediated drug disposition model (Mager and Jusko, 2001 ) was used to describe the PK/PD profile of huMabJC18 in rats and monkeys ( Figure 5).
  • the TMDD model assumes that saturable high affinity binding of the antibody (huMabJC18) to the target (Dkk-1 ) is responsible for the observable nonlinear pharmacokinetic behavior.
  • Antibody in the central compartment (volume V1 ) binds (rate constant, k on ) to free Dkk-1 to form an antibody-Dkk-1 receptor complex.
  • the complex may dissociate (rate constant, k off ) or the antibody- Dkk-1 complex may be eliminated (rate constant, k e ⁇ , C om P iex)- Unbound antibody can also be directly eliminated from the central compartment at a first order rate (/c e /).
  • rate constant rate constant
  • k e ⁇ rate constant
  • C om P iex rate constant
  • Unbound antibody can also be directly eliminated from the central compartment at a first order rate (/c e /).
  • the model was extended to account for antibody distribution to non-specific tissue sites which are described by the rate constants k 12 and k 2 i
  • the model was implemented as the following set of differential equations:
  • the goodness-of-fit was assessed from the precision of the parameter estimates and correlation matrix of the parameters provided by the $COV subroutine in NONMEM, visual inspection for a random spread of weighted residual against time and predicted concentrations, together with visual inspection of the individual subject predicted versus actual concentration-time plots for a lack of systematic bias at any points in time.
  • HuMabJC18 binds human, mouse and rat Dkk-1 with high affinity (K d ⁇ 2pM, ⁇ 30pM and ⁇ 100pM, respectively). In most cases, on rates (Zc 0n ) were too fast and off rates (Zw) were too slow to be measured precisely by the BIAcore instrumentation. HuMabJC18 also binds to cynomolgous monkey Dkk-1 , although a K d could not be determined due to impurity of the Dkk-1 sample.
  • Table 9 Dkk-1 concentrations in pre-menopausal, post-menopausal, osteopenic and osteoporotic female subjects
  • a normal T-score is >-1.0
  • osteopenia is defined as a T-score of ⁇ -1.0 and >-2.5
  • osteoporosis is defined as a T-score of -2.5 or lower.
  • V5-His tagged human (h-) Dkk-1 and rat (r-) Dkk-1 were administered to male Sprague-Dawley rats by intravenous bolus administration at 1 , 5, 10 and 100 ⁇ g/kg (h- Dkk-1 ) or 100 ⁇ g/kg (r-Dkk-1 ).
  • h-Dkk-1 kinetics were linear over the dose range tested.
  • the mean elimination half-life was 22.3 ⁇ 6.4 min for h-Dkk-1 ( Figure 6) and 34 min for r-Dkk-1.
  • the mean free/partially free huMabJC18 concentration versus time profiles following weekly intravenous administration to female Sprague-Dawley rats are shown in Figure 7.
  • Non-compartmental pharmacokinetic parameters are shown in Table 10.
  • the pharmacokinetics of huMabJC18 were non-linear across the dose range with supra- proportional increases in AUC with dose up to 10mg/kg. This indicates a higher rate of clearance at the lower doses (0.1 and 1 mg/kg) compared with the higher doses (10 and 100mg/kg).
  • serum huMabJC18 concentrations in some of the rats were lower than expected or below the limit of quantitation of the assay.
  • Rat anti- huMabJC18 antibodies were confirmed in these samples using a qualitative anti-drug antibody (ADA) assay and data from these rats were removed from the analysis and the plots.
  • ADA qualitative anti-drug antibody
  • cCave AUC(i st dosing intervai/tlast of 1 st dosing interval (not for entire duration of study due to sparse sampling).
  • dC m ⁇ n 1 st dosing interval (0-168hrs).
  • Loss of exposure in the 1 mg/kg group around 14 days and in one monkey in the 10 mg/kg group around 21 days post dose is likely to be due to formation of anti- huMabJC18 antibodies and these data were removed from the analysis and the plots. However, this could not be confirmed using a qualitative ADA assay.
  • V1 mAb (L/kg) 0.147 1.74 0.052 2.02 fre/ m A b (day "1 ) 0.278 3.52 0.051 1.54
  • the Dkk-1 half-life estimates (26 min in monkey and 11 min in rat) determined from the Dkk-1 k ei are similar to the values estimated from the V5-his tagged h-Dkk-1 and r-Dkk-1 turnover studies (22.3 min and 34 min respectively, see target kinetics section above).
  • the half-life of the complex (estimated from the complex k e j) is intermediate between the estimated half-life of the antibody, huMabJC18 and the target, Dkk-1.
  • osteocalcin which is a well established biomarker of bone formation
  • BMD bone mineral density
  • Table 13 Changes in total bone mineral density (BMD) at dista femurs in female rats treated for six weeks with huMabJC18 a G r o u p V e h i c l e 0 . 1 m g 1 m g 1 0 m g 1 0 0 m g
  • mice Female rats were treated with huMabJC18 at various doses weekly for 6 weeks by intravenous injection. BMD was measured at the end of the study.
  • TMDD mechanism based PK/PD
  • Figure 5 The mechanism based PK/PD (TMDD) model ( Figure 5) was used to simulate the PK/PD of huMabJC18 in humans and to predict an efficacious dose for treatment of osteoporosis, among other disorders.
  • Non-linear pharmacokinetics of huMabJC18 are predicted across the dose range encompassing MABEL (0.03mg/kg) and the predicted efficacious dose (3.57mg/kg). This is due to TMDD and is shown in Figure 13.
  • Dkk-1 is a master regulator of bone remodeling (Diarra et al. (2007) Nat Med 13:156-163) and Dkk-1 baseline levels are approximately 5 times higher in disease state (ovariectomised, OVX) mice compared with healthy mice (in- house data). Dkk-1 levels have also been shown to be elevated in bone marrow plasma and peripheral blood of multiple myeloma patients with bone lesions (Tian et al., 2003). A sensitivity analysis showed that predicted human dose of an anti-Dkk-1 monoclonal antibody (huMabJC18) was highly sensitive to Dkk-1 baseline levels. The higher the baseline Dkk-1 levels, the greater the concentration of antibody required to reduce Dkk- 1.
  • the baseline levels of the target are often known from prior clinical measurements, however the lack of this information for Dkk-1 prompted establishment of reference ranges for human Dkk-1 levels in both healthy subjects and the patient population (osteopenic and osteoporotic patients) that could be used for more informative dose predictions at different stages of clinical development.
  • the analysis showed that Dkk-1 levels were higher in osteopenic and osteoporotic women (T-score ⁇ -1 ) compared with healthy women.
  • the rate of turnover of target ligands can vary from minutes to days which can have a significant impact on efficacious dose and even potential of the target to be perturbed for clinical benefit. Some ligands have similar kinetics across species, but for others the turnover is not predictable a priori. Meno-Tetang et al. (Meno-Tetang and Lowe (2005) Basic Clin Pharmacol Toxicol 96:182-192) showed that IgE turnover rates range from 5-8 hr in mouse to 2.7 days in man which markedly affected the predictions of human effect of an anti-lgE antibody.
  • Dkk-1 a sensitivity analysis confirmed that predicted dose of an anti-Dkk-1 monoclonal antibody (huMabJC18) was sensitive to Dkk-1 half-life with a higher molar excess of antibody required at higher target turn-over rates.
  • the rapid turnover rate of Dkk-1 was later confirmed by using PK/PD modeling to estimate Dkk-1 half-life in rats and monkeys dosed with huMabJC18.
  • huMabJC18 exhibited non-linear pharmacokinetics with higher rates of clearance and shorter elimination half-life values at lower doses. This is indicative of target mediated drug disposition (TMDD) where interaction of an antibody with its pharmacological target influences disposition at lower doses (Tabrizi et al. (2006) Drug Discov Today 11 :81 -88.; Wang et al. (2008) Clin Pharmacol Ther 84:548-558).
  • TMDD target mediated drug disposition
  • This pathway is saturated at higher doses because of the finite expression of the target.
  • typical IgG FcRn catabolic clearance mechanisms predominate, which gives the antibody its characteristic long half-life.
  • TMDD is more common for monoclonal antibodies directed against proteins expressed on cell membranes where receptor mediated endocytosis results in drug elimination.
  • TMDD can also be observed with soluble targets: omalizumab and denosumab are antibodies for soluble targets (IgE and receptor activator of NFkB respectively) which exhibit non-linear elimination kinetics (Hayashi et al., 2007; Marathe et al., 2008).
  • Empirical PK/PD models consisting of a PK model to describe systemic drug concentrations, which is used as a forcing function to describe PD, are often not appropriate for characterizing TMDD as they do not account for the interdependency of PK and PD.
  • a single model describing drug PK, target dynamics and their interaction was proposed by Mager at al (Mager and Jusko (2001 ) J Pharmacokinet Pharmacodyn 28:507-532). This model accounts for specific and non-specific distribution and elimination of the drug molecule as well as providing flexibility to account for target dynamics.
  • the model gave an estimation of non-target mediated pharmacokinetics of huMabJC18 that were fairly consistent with typical lgG2 pharmacokinetics in each species (Peppard and Orlans (1980) Immunology 40:683-686; Hinton et al. (2004) J Biol Chem 279:6213-6216).
  • the elimination half-life was 2.5 days in rat and 13.6 days in monkey.
  • Volume of distribution was approximately equivalent to plasma volume in the monkey (0.052L/kg) but higher than plasma volume in rat (0.147L/kg).
  • the half-life of the huMabJC18-Dkk-1 complex was estimated to be intermediate between huMabJC18 half-life and Dkk-1 half-life which likely reflects the target mediated clearance mechanism.
  • binding of the target to the antibody interferes with antibody binding to FcRn and studies are being completed in-house to test this hypothesis.
  • MABEL minimum anticipated biological effect level
  • non-target mediated were combined with knowledge of Dkk-1 target kinetics and huMabJC18-Dkk-1 complex kinetics obtained from the rat and monkey PK/PD modeling.
  • a shorter complex half-life in humans would be predicted by allometric scaling of the complex half-life estimated by the rat PK/PD modeling.
  • Dkk-1 suppression and therefore dose was not sensitive to the change in complex half-life predicted from rat versus monkey.
  • Nonlinear pharmacokinetics are predicted in the clinic (Fig 13), with huMabJC18 exhibiting a higher clearance and shorter half-life at lower doses due to TMDD.
  • An alternative approach to predicting human pharmacology is to predict maximal receptor occupancy (RO) using a formula based on equilibrium-drug interaction theory:
  • the observed NOAEL (100 mg/kg) is in excess of that required for 100% binding of Dkk-1 to antibody.
  • the MABEL calculated according to the Duff equation is likely a severe underestimation due to lack of consideration of the rapid turnover of Dkk-1. As such, these methods are not acceptable approaches to setting the starting clinical dose in this instance.
  • the TMDD model provided excellent characterization of the preclinical data which indicated the role of target turnover in determining % binding of Dkk-1. Therefore, the MABEL estimate derived from the TMDD model (0.03 mg/kg) will ensure both the safety and efficiency of FIH studies.
  • huMabJC18 is a humanized prototype anti-Dkk-1 antibody for the treatment of osteoporosis, among other disorders.
  • a mechanistic TMDD model was used to characterize huMabJC18 versus Dkk-1 concentration response relationship in rat and monkey. This model was translated to human to predict efficacious dose and MABEL by incorporating information on target expression and turnover rates. These parameters were found to have more impact on the dose response relationship than affinity for this mechanism.
  • huMAbJC18 the heavy and light chain variable regions of the antibody designated as huMAbJC18 herein with the American Type Culture Collection (ATCC) Manassas, VA 20110-2209 U.S.A.
  • ATCC American Type Culture Collection
  • the huMabJC18 HC variable region was deposited on March 19, 2009, and was assigned ATCC Deposit No. PTA-9835
  • the huMabJC18 LC variable region was deposited on March 19, 2009, and was assigned ATCC Deposit No. PTA-9836.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • General Health & Medical Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Medicinal Chemistry (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Veterinary Medicine (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Molecular Biology (AREA)
  • Biomedical Technology (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Immunology (AREA)
  • Physical Education & Sports Medicine (AREA)
  • Biotechnology (AREA)
  • Zoology (AREA)
  • Wood Science & Technology (AREA)
  • General Engineering & Computer Science (AREA)
  • Rheumatology (AREA)
  • Microbiology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Orthopedic Medicine & Surgery (AREA)
  • Plant Pathology (AREA)
  • Physics & Mathematics (AREA)
  • Obesity (AREA)
  • Hematology (AREA)
  • Diabetes (AREA)
  • Endocrinology (AREA)
  • Pain & Pain Management (AREA)
  • Mycology (AREA)
  • Epidemiology (AREA)
  • Peptides Or Proteins (AREA)
PCT/IB2010/052056 2009-05-12 2010-05-10 Blocking anti-dkk-1 antibodies and their uses Ceased WO2010131185A1 (en)

Priority Applications (13)

Application Number Priority Date Filing Date Title
EP10721057A EP2430048A1 (en) 2009-05-12 2010-05-10 Blocking anti-dkk-1 antibodies and their uses
MX2011012039A MX2011012039A (es) 2009-05-12 2010-05-10 Anticuerpos bloqueadores anti-dkk-1 y sus usos.
SG2011081080A SG175881A1 (en) 2009-05-12 2010-05-10 Blocking anti-dkk-1 antibodies and their uses
CN2010800316466A CN102666584A (zh) 2009-05-12 2010-05-10 封闭性抗dkk-1抗体及其用途
BRPI1010540A BRPI1010540A2 (pt) 2009-05-12 2010-05-10 "anticorpos especéficos para dkk-1 e seus usos"
KR1020117029598A KR101471239B1 (ko) 2009-05-12 2010-05-10 항-dkk-1 항체의 차단 및 그의 용도
RU2011145435/10A RU2548817C2 (ru) 2009-05-12 2010-05-10 БЛОКИРУЮЩИЕ АНТИТЕЛА ПРОТИВ Dkk-1 И ИХ ПРИМЕНЕНИЯ
NZ596274A NZ596274A (en) 2009-05-12 2010-05-10 Blocking anti-dkk-1 antibodies and their uses
AU2010246981A AU2010246981B2 (en) 2009-05-12 2010-05-10 Blocking anti-Dkk-1 antibodies and their uses
JP2012510415A JP2012526542A (ja) 2009-05-12 2010-05-10 遮断抗dkk−1抗体およびその使用
CA2761696A CA2761696A1 (en) 2009-05-12 2010-05-10 Blocking anti-dkk-1 antibodies and their uses
IL216304A IL216304A0 (en) 2009-05-12 2011-11-10 Blocking anti- dkk-1 antibodies and their uses
ZA2011/08310A ZA201108310B (en) 2009-05-12 2011-11-11 Blocking anti-dkk-1 antibodies and their uses

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US17765009P 2009-05-12 2009-05-12
US61/177,650 2009-05-12
US24463809P 2009-09-22 2009-09-22
US61/244,638 2009-09-22

Publications (1)

Publication Number Publication Date
WO2010131185A1 true WO2010131185A1 (en) 2010-11-18

Family

ID=42315893

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/IB2010/052056 Ceased WO2010131185A1 (en) 2009-05-12 2010-05-10 Blocking anti-dkk-1 antibodies and their uses

Country Status (20)

Country Link
US (2) US8338576B2 (https=)
EP (1) EP2430048A1 (https=)
JP (1) JP2012526542A (https=)
KR (1) KR101471239B1 (https=)
CN (1) CN102666584A (https=)
AR (1) AR076668A1 (https=)
AU (1) AU2010246981B2 (https=)
BR (1) BRPI1010540A2 (https=)
CA (1) CA2761696A1 (https=)
CO (1) CO6460768A2 (https=)
IL (1) IL216304A0 (https=)
MX (1) MX2011012039A (https=)
NZ (1) NZ596274A (https=)
PE (1) PE20120475A1 (https=)
RU (1) RU2548817C2 (https=)
SA (1) SA110310369B1 (https=)
SG (1) SG175881A1 (https=)
TW (1) TWI411444B (https=)
WO (1) WO2010131185A1 (https=)
ZA (1) ZA201108310B (https=)

Cited By (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2012058393A3 (en) * 2010-10-27 2012-10-04 Amgen Inc. Dkk1 antibodies and methods of use
WO2015008052A1 (en) * 2013-07-15 2015-01-22 King's College London Dickkopf (dkk) proteins as biomarkers for cognitive decline associated with alzheimer's disease
US12084513B2 (en) 2017-11-14 2024-09-10 Chugai Seiyaku Kabushiki Kaisha Anti-C1S antibodies and methods of use
US12473353B2 (en) 2019-05-15 2025-11-18 Chugai Seiyaku Kabushiki Kaisha Antigen-binding molecule, a pharmaceutical composition, and a method

Families Citing this family (16)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
AU2008330125B2 (en) * 2007-11-21 2012-11-22 Amgen Inc. Wise binding antibodies and epitopes
US9540443B2 (en) 2011-01-26 2017-01-10 Kolltan Pharmaceuticals, Inc. Anti-kit antibodies
US8852592B2 (en) 2011-05-10 2014-10-07 Biocare Medical, Llc Systems and methods for anti-PAX8 antibodies
US10316103B1 (en) 2012-03-30 2019-06-11 Biocare Medical, Llc Systems and methods for anti-Uroplakin III antibodies
NZ630363A (en) 2012-07-25 2018-09-28 Celldex Therapeutics Inc Anti-kit antibodies and uses thereof
EP2900265B1 (en) 2012-09-27 2018-05-30 Biocare Medical, LLC Anti-uroplakin ii antibodies systems and methods
US10429390B2 (en) 2012-12-18 2019-10-01 Biocare Medical, Llc Antibody cocktail systems and methods for classification of histologic subtypes in lung cancer
DK2962113T3 (da) 2013-02-28 2019-07-01 Biocare Medical Llc Systemer og fremgangsmåder med anti-p40-antistoffer
US9816997B2 (en) 2013-10-03 2017-11-14 Biocare Medical, Llc Anti-SOX10 antibody systems and methods
CN113975386A (zh) 2014-05-23 2022-01-28 塞尔德克斯医疗公司 嗜酸性粒细胞或肥大细胞相关病症的治疗
US10584174B2 (en) 2015-05-18 2020-03-10 Eli Lilly And Company Anti-Dkk-1-anti-RANKL bispecific antibody compounds
US20210079079A1 (en) * 2018-05-02 2021-03-18 Ortheus, Inc. Systems and methods for local modulation of wnt signaling
CN112180094A (zh) * 2019-07-04 2021-01-05 上海东慈生物科技有限公司 Dkk1抑制剂在预防和/或治疗肿瘤恶病质与糖尿病伴随疾病中的应用
KR102192471B1 (ko) * 2019-10-18 2020-12-17 주식회사 인코스팜 탈모 완화 및 모발 성장을 촉진시키는 펩타이드 및 이를 포함하는 화장료 조성물
KR102494042B1 (ko) * 2020-11-20 2023-02-07 주식회사 하울바이오 인간모유두세포의 성장을 촉진하는 항-dkk-1 항체 및 이의 용도
CN112592402B (zh) * 2020-12-02 2022-04-26 杭州奕安济世生物药业有限公司 抗dkk2抗体、包含该抗dkk2抗体的组合物及其用途

Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2002066509A2 (en) * 2001-02-16 2002-08-29 Genentech, Inc. Treatment involving dkk-1 or antagonists thereof
WO2002092015A2 (en) * 2001-05-17 2002-11-21 Genome Therapeutics Corporation Reagents and methods for modulating dkk-mediated interactions
WO2006015373A2 (en) * 2004-08-04 2006-02-09 Amgen Inc Antibodies to dkk-1
WO2008097510A1 (en) * 2007-02-08 2008-08-14 Merck & Co., Inc. Antibodies specific for dkk-1

Family Cites Families (24)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US7057017B2 (en) 1997-04-16 2006-06-06 Millennium Pharmaceuticals, Inc. Human dickkopf-related protein and nucleic acid molecules and uses therefor
US6391311B1 (en) 1998-03-17 2002-05-21 Genentech, Inc. Polypeptides having homology to vascular endothelial cell growth factor and bone morphogenetic protein 1
DE19747418C1 (de) 1997-10-27 1999-07-15 Deutsches Krebsforsch Inhibitor-Protein des wnt-Signalwegs
US7446181B2 (en) 1998-01-15 2008-11-04 Millennium Pharmaceuticals, Inc. Antibodies that bind human Dickkopf-1 proteins
ES2312205T3 (es) 1998-03-10 2009-02-16 Genentech, Inc. Nuevo polipeptido y acidos nucleicos que lo codifican.
US6962797B2 (en) 1998-04-15 2005-11-08 Genentech, Inc. Nucleic acids encoding PRO615
US6344541B1 (en) 1998-09-25 2002-02-05 Amgen Inc. DKR polypeptides
US7193050B2 (en) 2000-02-18 2007-03-20 Genentech, Inc. Secreted and transmembrane polypeptides and nucleic acids encoding the same
US6673549B1 (en) 2000-10-12 2004-01-06 Incyte Corporation Genes expressed in C3A liver cell cultures treated with steroids
US20040038860A1 (en) 2002-05-17 2004-02-26 Allen Kristina M. Reagents and methods for modulating dkk-mediated interactions
US7371736B2 (en) 2001-11-07 2008-05-13 The Board Of Trustees Of The University Of Arkansas Gene expression profiling based identification of DKK1 as a potential therapeutic targets for controlling bone loss
US7308364B2 (en) 2001-11-07 2007-12-11 The University Of Arkansas For Medical Sciences Diagnosis of multiple myeloma on gene expression profiling
MXPA04004378A (es) 2001-11-07 2004-09-10 Univ Arkansas Diagnostico, prognosis e identificacion de objetivos terapeuticos potenciales de mieloma multiple basado en el perfilado de expresion de genes.
US7894992B2 (en) 2001-11-07 2011-02-22 Board Of Trustees Of The University Of Arkansas Diagnosis and classification of multiple myeloma
CA2507496C (en) 2002-12-05 2014-11-04 John D. Shaughnessy Molecular determinants of myeloma bone disease and uses thereof
US7642238B2 (en) 2002-12-05 2010-01-05 Shaughnessy John D Molecular determinants of myeloma bone disease and uses thereof
US7811750B2 (en) 2002-12-05 2010-10-12 Board Of Trustees Of The University Of Arkansas Molecular determinants of myeloma bone disease and use thereof
US8124087B2 (en) 2002-12-05 2012-02-28 Board Of Trustees Of The University Of Arkansas Methods of controlling bone loss by inhibiting DKK1
US20050084494A1 (en) 2003-05-21 2005-04-21 Darwin Prockop Inhibitors of Dkk-1
US8637506B2 (en) 2003-09-22 2014-01-28 Enzo Biochem, Inc. Compositions and methods for bone formation and remodeling
US8343922B2 (en) 2004-05-19 2013-01-01 Enzo Biochem, Inc. Compositions and methods for the stimulation or enhancement of bone formation and the self-renewal of cells
AR060017A1 (es) * 2006-01-13 2008-05-21 Novartis Ag Composiciones y metodos de uso para anticuerpos de dickkopf -1
WO2008070112A1 (en) 2006-12-06 2008-06-12 The Board Of Trustees Of The University Of Arkansas Overexpression of wnt ligands and treatment of lytic bone diseases
AR075989A1 (es) 2009-04-10 2011-05-11 Lilly Co Eli Anticuerpo dkk -1 (dickkopf-1) humano disenado por ingenieria

Patent Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2002066509A2 (en) * 2001-02-16 2002-08-29 Genentech, Inc. Treatment involving dkk-1 or antagonists thereof
WO2002092015A2 (en) * 2001-05-17 2002-11-21 Genome Therapeutics Corporation Reagents and methods for modulating dkk-mediated interactions
WO2006015373A2 (en) * 2004-08-04 2006-02-09 Amgen Inc Antibodies to dkk-1
WO2008097510A1 (en) * 2007-02-08 2008-08-14 Merck & Co., Inc. Antibodies specific for dkk-1

Non-Patent Citations (177)

* Cited by examiner, † Cited by third party
Title
AGORAM ET AL., DRUG DISCOV TODAY, vol. 12, 2007, pages 1018 - 1024
AGORAM, BR J CLIN PHARMACOL, vol. 67, 2009, pages 153 - 160
ALEXANDER ET AL., MOL. CELL BIOL., vol. 7, 1987, pages 1436 - 44
ASHKENAZI ET AL., PNAS USA, vol. 88, 1991, pages 10535
BALINT ET AL., GENE, vol. 137, no. 1, 1993, pages 109 - 18
BARBAS ET AL., PROC NAT. ACAD. SCI, vol. 91, 1994, pages 3809 - 3813
BAUM ET AL., EMBO J., vol. 13, 1994, pages 3992 - 4001
BEMOIST; CHAMBON, NATURE, vol. 290, 1981, pages 304 - 10
BERGE, S.M. ET AL., J. PHARM. SCI., vol. 66, 1977, pages 1 - 19
BIANCHI; MCGREW, BIOTECH BIOTECHNOL BIOENG, vol. 84, no. 4, 2003, pages 439 - 44
BIRD ET AL., SCIENCE, vol. 242, 1988, pages 423 - 426
BIRD, SCIENCE, vol. 242, 1988, pages 423
BOWIE ET AL., SCIENCE, vol. 253, 1991, pages 164 - 170
BOYD ET AL., MOL. IMMUNOL., vol. 32, 1996, pages 1311 - 1318
BOYDEN, L.M ET AL., N ENGL J MED, vol. 346, 2002, pages 1513 - 1521
BRENNER ET AL., CURR. OP. STRUCT. BIOL., vol. 7, 1997, pages 369 - 376
BRINSTER ET AL., NATURE, vol. 296, 1982, pages 39 - 42
BRISCOE ET AL., AM. J. PHYSIOL., vol. 1233, 1995, pages 134
BRUGGERMANN ET AL., YEAR IN IMMUNOL., vol. 7, 1993, pages 33
BYRN ET AL., NATURE, vol. 344, 1990, pages 677
CADIGAN, K.M; Y.I. LIU, JOURNAL OF CELL SCIENCE, vol. 119, 2005, pages 395 - 402
CAPEL ET AL., IMMUNOMETHODS, vol. 4, 1994, pages 25 - 34
CARILLO ET AL., SIAM J. APPLIED MATH., vol. 48, 1988, pages 1073
CHAKRABORTY ET AL., J PHARMACOKINET BIOPHARM, vol. 27, 1999, pages 23 - 43
CHEN, INTERNAIONAL IMMUNOLOGY, vol. 5, 1993, pages 647 - 656
CHEUNG ET AL., VIROLOGY, vol. 176, 1990, pages 546 - 552
CHOTHIA ET AL., NATURE, vol. 342, 1989, pages 878 - 883
CHOTHIA; LESK, J. MOL. BIOL., vol. 196, 1987, pages 901 - 917
CHOU ET AL., ADV. ENZYMOL. RELAT. AREAS MOL. BIOL., vol. 47, 1978, pages 45 - 148
CHOU ET AL., ANN. REV. BIOCHEM., vol. 47, 1979, pages 251 - 276
CHOU ET AL., BIOCHEMISTRY, vol. 113, 1974, pages 211 - 222
CHOU ET AL., BIOCHEMISTRY, vol. 13, 1974, pages 222 - 245
CHOU ET AL., BIOPHYS. J., vol. 26, 1979, pages 367 - 384
CHU ET AL., GENE, vol. 13, 1981, pages 197
CLYNES ET AL., PROC. NATL. ACAD. SCI., vol. 95, 1998, pages 652 - 656
DAERON, ANNU. REV. IMMUNOL., vol. 15, 1997, pages 203 - 234
DAYHOFF ET AL., ATLAS OF PROTEIN SEQUENCE AND STRUCTURE, vol. 5, 1978, pages 345 - 352
DE GRAAF ET AL., METHODS MOL BIOL., vol. 178, 2002, pages 379 - 87
DE HAAS ET AL., J. LAB. CLIN. MED., vol. 126, 1995, pages 330 - 41
DEBOER ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 80, 1983, pages 21 - 25
DEVEREUX ET AL., NUCL ACID RES, vol. 12, 1984, pages 387
DIARRA DANIELLE ET AL: "Dickkopf-1 is a master regulator of joint remodeling", NATURE MEDICINE, NATURE PUBLISHING GROUP, NEW YORK, NY, US LNKD- DOI:10.1038/NM1538, vol. 13, no. 2, 1 February 2007 (2007-02-01), pages 156 - 163, XP002486201, ISSN: 1078-8956, [retrieved on 20070121] *
DIARRA ET AL., NAT MED, vol. 13, 2007, pages 156 - 163
EUR. J. IMMUNOL., vol. 29, 1999, pages 2613 - 2624
EVANS ET AL., J. MED. CHEM., vol. 30, 1987, pages 1229
FANSLOW ET AL., SEMIN. IMMUNOL., vol. 6, 1994, pages 267 - 78
FAUCHERE, ADV. DRUG RES., vol. 15, 1986, pages 29
FEDI PAOLO ET AL: "Isolation and biochemical characterization of the human Dkk-1 homologue, a novel inhibitor of mammalian Wnt signaling", JOURNAL OF BIOLOGICAL CHEMISTRY, AMERICAN SOCIETY FOR BIOCHEMISTRY AND MOLECULAR BIOLOGY, INC, US LNKD- DOI:10.1074/JBC.274.27.19465, vol. 274, no. 27, 2 July 1999 (1999-07-02), pages 19465 - 19472, XP002173440, ISSN: 0021-9258 *
FISHWILD ET AL., NATURE BIOTECHNOLOGY, vol. 14, 1996, pages 845 - 851
GALFRE; MILSTEIN, METHODS ENZYMOL, vol. 73, 1981, pages 3 - 46
GLINKA ET AL: "Dickkopf-1 is a member of a new family of secreted proteins and functions in head induction", NATURE, NATURE PUBLISHING GROUP, LONDON, GB LNKD- DOI:10.1038/34848, vol. 391, no. 6665, 22 January 1998 (1998-01-22), pages 357 - 362, XP002096088, ISSN: 0028-0836 *
GONG ET AL., CELL, vol. 107, 2001, pages 513 - 523
GONG, Y. ET AL., CELL, vol. 107, 2001, pages 513 - 523
GRAHAM ET AL., VIROLOGY, vol. 52, 1973, pages 456
GRIBSKOV ET AL., METH. ENZYM., vol. 183, 1990, pages 146 - 159
GRIBSKOV ET AL., PROC. NAT. ACAD. SCI., vol. 84, 1987, pages 4355 - 4358
GROSSCHEDL ET AL., CELL, vol. 38, 1984, pages 647 - 58
GUYER ET AL., IMMUNOL, vol. 117, 1976, pages 587
HAMMER ET AL., SCIENCE, vol. 235, 1987, pages 53 - 58
HANAHAN, NATURE, vol. 315, 1985, pages 115 - 22
HARDING; LONBERG, ANN. N.Y ACAD. SCI, vol. 764, 1995, pages 536 - 546
HARDING; LONBERG, ANN. N.Y ACAD. SCI., vol. 764, 1995, pages 536 - 546
HAWKINS ET AL., J. MOL. BIOL., vol. 226, 1992, pages 889 - 896
HENIKOFF ET AL., PROC. NATL. ACAD. SCI. USA, vol. 89, 1992, pages 10915 - 10919
HIGGINS, D.G; SHARP, P.M., CABIOS, vol. 5, 1989, pages 151 - 153
HINTON ET AL., J BIOL CHEM, vol. 279, 2004, pages 6213 - 6216
HOLLENBAUGH ET AL.: "Construction of Immunoglobulin Fusion Proteins", CURRENT PROTOCOLS IN IMMUNOLOGY, 1992, pages 10.19.1 - 10.19.11
HOLM ET AL., NUCL. ACID. RES., vol. 27, 1999, pages 244 - 247
HOLMEN ET AL., J BONE MINER RES, vol. 19, 2004, pages 2033 - 2040
HOOGENBOOM ET AL., J. MOL. BIOL., vol. 227, 1991, pages 381
HOPP ET AL., BIO/TECHNOLOGY, vol. 6, 1988, pages 1204
HOPPE ET AL., FEBS LETTERS, vol. 344, 1994, pages 191
HSE ET AL., J. BIOL. CHEM., vol. 272, 1997, pages 9062 - 9070
HUSTON ET AL., PROC. NATL. ACAD. SCI. USA, vol. 85, 1988, pages 5879
HUSTON ET AL., PROC. NATL. ACAD. SCI. USA, vol. 85, 1988, pages 5879 - 5883
IDUSOGIE ET AL., J. IMMUNOLOGY, vol. 164, 2000, pages 4178 - 4184
IVARNES, NATURE, vol. 3I8, 1985, pages 533 - 38
J.J. KILLION; I.J. FIDLER, IMMUNOMETHODS, vol. 4, 1994, pages 273
JACKSON ET AL., J. IMMUNOL., vol. 154, no. 7, 1995, pages 3310 - 9
JAKOBOVITS ET AL., NATURE, vol. 362, 1993, pages 255 - 258
JAKOBOVITS ET AL., PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 2551 - 2555
JEFFERIS ET AL., IMMUNOLOGICAL REVIEWS, vol. 163, 1998, pages 59 - 76
JEFFERIS; LUND, CHEM. IMMUNOL., vol. 65, 1997, pages 111 - 128
JONES ET AL., NATURE, vol. 321, 1986, pages 522 - 25
JUNES, CURR. OPIN. STRUCT. BIOL., vol. 7, 1997, pages 377 - 87
K. KEINANEN; M.L. LAUKKANEN, FEBS LETT, vol. 346, 1994, pages 123
KARLSSON, R. ROOS; H. FAGERSTAM; L. PETERSSON, B., METHODS ENZYMOLOGY, vol. 6, 1994, pages 99 - 110
KELSEY ET AL., GENES AND DEVEL., vol. 1, 1987, pages 161 - 71
KIM ET AL., J. IMMUNOL., vol. 24, 1994, pages 249
KIRKLAND ET AL., J. IMMUNOL., vol. 137, 1986, pages 3614 - 3619
KOHLER; MILSTEIN, NATURE, vol. 256, 1975, pages 495
KOLLIAS ET AL., CELL, vol. 46, 1986, pages 89 - 94
KORTT ET AL., BIOMOL. ENG., vol. 18, 2001, pages 95 - 108
KORTT ET AL., PROT. ENG., vol. 10, 1997, pages 423
KOSTELNY ET AL., J. IMMUNOL., vol. 148, 1992, pages 1547 - 1553
KRIANGKUM ET AL., BIOMOL. ENG., vol. 18, 2001, pages 31 - 40
KRUMLAUF ET AL., MOL. CELL. BIOL., vol. 5, 1985, pages 1639 - 48
KRUPNIK V E ET AL: "Functional and structural diversity of the human Dickkopf gene family", GENE, ELSEVIER, AMSTERDAM, NL LNKD- DOI:10.1016/S0378-1119(99)00365-0, vol. 238, no. 2, 1 October 1999 (1999-10-01), pages 301 - 313, XP002140768, ISSN: 0378-1119 *
KYTE ET AL., J. MOL. BIOL., vol. 157, 1982, pages 105 - 131
LANDSCHULZ ET AL., SCIENCE, vol. 240, 1988, pages 1759
LANTTO ET AL., METHODS MOL. BIO1, vol. 178, 2002, pages 303 - 16
LEDER ET AL., CELL, vol. 45, 1986, pages 485 - 95
LITTLE, R.D. ET AL., AM J HUM GENET, vol. 70, 2002, pages 11 - 19
LOBO ET AL., J PHARM SCI, vol. 93, 2004, pages 2645 - 2668
LONBERG ET AL., NATURE, vol. 368, 1994, pages 856 - 859
LONBERG; HUSZAR, INTERN. REV. IMMUNOL., vol. 13, 1995, pages 65 - 93
LUND ET AL., J. IMMUNOLOGY, vol. 157, 1996, pages 4963 - 9
M. OWAIS ET AL., ANTIMICROB. AGENTS CHEMOTHER., vol. 39, 1995, pages 180
MACDONALD, HEPATOLOGY, vol. 7, 1987, pages 425 - 515
MAGER; JUSKO, J PHARMACOKINET PHARMACODYN, vol. 28, 2001, pages 507 - 532
MARKS ET AL., BIO/TECHNOLOGY, vol. 10, 1992, pages 779 - 783
MARKS ET AL., BIOTECHNOLOGY, vol. 10, 1992, pages 779
MARKS ET AL., J. MOL. BIOL., vol. 222, 1991, pages 581
MASON ET AL., SCIENCE, vol. 234, 1986, pages 1372 - 78
MCCAFFERTY ET AL., NATURE, vol. 348, 1990, pages 552 - 554
MENDEZ ET AL., NATURE GENETICS, vol. 15, 1997, pages 146 - 156
MENO-TETANG; LOWE, BASIC CLIN PHARMACOL TOXICOL, vol. 96, 2005, pages 182 - 192
MOGRAM ET AL., NATURE, vol. 315, 1985, pages 338 - 40
MOLDENHAUER ET AL., SCAND. J. IMMUNOL., vol. 32, 1990, pages 77 - 82
MOREL ET AL., MOLEC. IMMUNOL., vol. 25, 1988, pages 7 - 15
MORGAN ET AL., IMMUNOLOGY, vol. 86, 1995, pages 319 - 324
MORRISON ET AL., PROC. NATL. ACAD. SCI USA, vol. 81, 1985, pages 6851 - 6855
MOULT, CURR. OP. IN BIOTECH., vol. 7, 1996, pages 422 - 427
MYERS, E.W.; MULLER W., CABIOS, vol. 4, 1988, pages 11 - 17
NEEDLEMAN ET AL., J. MOL. BIOL., vol. 48, 1970, pages 443 - 453
NG ET AL., PHARM RES, vol. 23, 2006, pages 95 - 103
NIEHRS C: "Function and biological roles of the Dickkopf family of Wnt modulators.", ONCOGENE 4 DEC 2006 LNKD- PUBMED:17143291, vol. 25, no. 57, 4 December 2006 (2006-12-04), pages 7469 - 7481, XP002592181, ISSN: 0950-9232 *
NUSSE, R, DEVELOPMENT, vol. 130, no. 22, 2003, pages 5297 - 305
ORNITZ ET AL., COLD SPRING HARBOR SYMP. QUANT. BIOL., vol. 50, 1986, pages 399409
P.G. BLOEMAN ET AL., FEBS LETT., vol. 357, 1995, pages 140
PEPPARD; ORLANS, IMMUNOLOGY, vol. 40, 1980, pages 683 - 686
PINKERT ET AL., GENES AND DEVEL., vol. 1, 1987, pages 268 - 76
PINSON, K.I., NATURE, vol. 407, no. 6803, 2000, pages 535 - 8
RAVETCH; KINET, ANNU. REV. IMMUNOL., vol. 9, 1991, pages 457 - 92
READHEAD ET AL., CELL, vol. 48, 1987, pages 703 - 12
RIECHMANN ET AL., NATURE, vol. 332, 1988, pages 323 - 27
RIZO; GIERASCH, ANN. REV. BIOCHEM., vol. 61, 1992, pages 387
ROBINSON, E.D., COMB. THEOR, vol. 11, 1971, pages 105
SANI, NATURE, vol. 314, 1985, pages 283 - 86
SANTOU, N.; NES, M., MOL. BIOL. EVOL., vol. 4, 1987, pages 406 - 425
SCHIER ET AL., GENE, vol. 169, 1995, pages 147 - 155
SCHREIER ET AL., J. BIOL. CHEM., vol. 269, 1994, pages 9090
SIPPL ET AL., STRUCTURE, vol. 4, 1996, pages 15 - 19
SONGSIVILAI; LACHMANN, CLIN. EXP. )MMUNOL., vol. 79, 1990, pages 315 - 321
SONGSIVILAI; LACHMANN, CLIN. EXP. IMMUNOL., vol. 79, 1990, pages 315 - 321
STAHLI ET AL., METHODS IN ENZYMOLOGY, vol. 9, 1983, pages 242 - 253
SWIFT ET AL., CELL, vol. 38, 1984, pages 63946
TABRIZI ET AL., DRUG DISCOV TODAY, vol. 11, 2006, pages 81 - 88
TAO ET AL., J. IMMUNOLOGY, vol. 143, 1989, pages 2595 - 2601
TAYLOR ET AL., INTERNATIONAL IMMUNOLOGY, vol. 6, 1994, pages 579 - 591
TAYLOR ET AL., NUCLEIC ACIDS RESEARCH, vol. 20, 1992, pages 6287 - 6295
TERPOS E: "Antibodies to dickkopf-1 protein", EXPERT OPINION ON THERAPEUTIC PATENTS, INFORMA HEALTHCARE, GB LNKD- DOI:10.1517/13543776.16.10.1453, vol. 16, no. 10, 1 October 2006 (2006-10-01), pages 1453 - 1458, XP002486202, ISSN: 1354-3776 *
THORNTON ET AL., NATURE, vol. 354, 1991, pages 105
TIAN, E. ET AL., N ENGL J MED, vol. 349, 2003, pages 2483 - 2494
TUAILLON ET AL., J. IMMUNOL., vol. 152, 1994, pages 2912 - 2920
UMANA ET AL., NATURE BIOTECH., vol. 17, 1999, pages 176 - 180
UMEZAWA ET AL., BIOCHEM. BIOPHYS. RES. COMMUN., vol. 153, 1988, pages 1038
V.V. RANADE, J. CLIN. PHARMACOL, vol. 29, 1989, pages 685
VEBER; FREIDINGER, TINS, 1985, pages 392
VERHOEYEN ET AL., SCIENCE, vol. 239, 1988, pages 1534 - 36
VILLA-KAMAROFF ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 75, 1978, pages 3727 - 31
VOSS ET AL., TRENDS BIOCHEM. SCI., vol. 11, 1986, pages 287
WAGNER ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 78, 1981, pages 1444 - 45
WANG ET AL., CLIN PHARMACOL THER, vol. 84, 2008, pages 548 - 558
WARD ET AL., NATURE, vol. 334, 1989, pages 544
WARD ET AL., NATURE, vol. 341, 1989, pages 544 - 546
WILBUR, W.J.; LIPMAN, D.J., PROC. NATL. ACAD. SCI. USA, vol. 80, 1983, pages 726 - 730
WINES ET AL., J. IMMUNOL., vol. 164, 2000, pages 5313 - 5318
WITTWE; HOWARD, BIOCHEM., vol. 29, 1990, pages 4175 - 4180
WRIGHT; MORRISON, TIBTECH, vol. 15, 1997, pages 26 - 32
WU ET AL., J PHARM SCI, vol. 95, 2006, pages 1258 - 1268
WYSS; WAGNER, CURRENT OPIN. BIOTECH., vol. 7, 1996, pages 409 - 416
YACCOBY SHMUEL ET AL: "Antibody-based inhibition of DKK1 suppresses tumor-induced bone resorption and multiple myeloma growth in vivo", BLOOD, AMERICAN SOCIETY OF HEMATOLOGY, US LNKD- DOI:10.1182/BLOOD-2006-09-047712, vol. 109, no. 5, 1 March 2007 (2007-03-01), pages 2106 - 2111, XP002486200, ISSN: 0006-4971, [retrieved on 20061026] *
YAMAMOTO ET AL., CELL, vol. 22, 1980, pages 787 - 97
YELTON ET AL., J. IMMUNOL., vol. 155, 1995, pages 1994 - 2004
ZHA G, MO CELL BLOL, vol. 24, no. 11, 2004, pages 4677 - 84
ZHANG, Y. ET AL., MOL CELL BIOI., 2004

Cited By (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2012058393A3 (en) * 2010-10-27 2012-10-04 Amgen Inc. Dkk1 antibodies and methods of use
AU2011319843B2 (en) * 2010-10-27 2016-03-10 Amgen Inc. DKK1 antibodies and methods of use
AU2011319843C1 (en) * 2010-10-27 2017-02-02 Amgen Inc. DKK1 antibodies and methods of use
US9879072B2 (en) 2010-10-27 2018-01-30 Amgen Inc. DKK1 antibodies and methods of use
US10800839B2 (en) 2010-10-27 2020-10-13 Amgen Inc. DKK1 antibodies and methods of use
US12297260B2 (en) 2010-10-27 2025-05-13 Amgen Inc. DKK1 antibodies and methods of use
WO2015008052A1 (en) * 2013-07-15 2015-01-22 King's College London Dickkopf (dkk) proteins as biomarkers for cognitive decline associated with alzheimer's disease
US12084513B2 (en) 2017-11-14 2024-09-10 Chugai Seiyaku Kabushiki Kaisha Anti-C1S antibodies and methods of use
US12473353B2 (en) 2019-05-15 2025-11-18 Chugai Seiyaku Kabushiki Kaisha Antigen-binding molecule, a pharmaceutical composition, and a method

Also Published As

Publication number Publication date
MX2011012039A (es) 2011-12-14
JP2012526542A (ja) 2012-11-01
AU2010246981B2 (en) 2013-12-19
US8338576B2 (en) 2012-12-25
CO6460768A2 (es) 2012-06-15
TW201043247A (en) 2010-12-16
IL216304A0 (en) 2012-01-31
KR20120007078A (ko) 2012-01-19
KR101471239B1 (ko) 2014-12-09
CA2761696A1 (en) 2010-11-18
SA110310369B1 (ar) 2014-09-02
ZA201108310B (en) 2013-04-24
US20100291076A1 (en) 2010-11-18
BRPI1010540A2 (pt) 2016-03-15
SG175881A1 (en) 2011-12-29
US8586721B2 (en) 2013-11-19
AU2010246981A1 (en) 2011-12-08
TWI411444B (zh) 2013-10-11
AR076668A1 (es) 2011-06-29
EP2430048A1 (en) 2012-03-21
PE20120475A1 (es) 2012-05-05
RU2011145435A (ru) 2013-06-20
US20130071921A1 (en) 2013-03-21
NZ596274A (en) 2013-11-29
RU2548817C2 (ru) 2015-04-20
CN102666584A (zh) 2012-09-12

Similar Documents

Publication Publication Date Title
AU2010246981B2 (en) Blocking anti-Dkk-1 antibodies and their uses
US8101184B2 (en) Treatment methods using Dkk-1 antibodies
US9005614B2 (en) PRLR-specific antibody and uses thereof
EP2074149B1 (en) Compositions and methods relating to glucagon receptor antibodies
KR20110031152A (ko) Il-6에 대한 항체 및 그의 용도
AU2013202084B2 (en) PRLR-specific antibody and uses thereof
HK1175791A (en) Blocking anti-dkk-1 antibodies and their uses
HK1166804A (en) Prlr-specific antibody and uses thereof

Legal Events

Date Code Title Description
WWE Wipo information: entry into national phase

Ref document number: 201080031646.6

Country of ref document: CN

121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 10721057

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 596274

Country of ref document: NZ

Ref document number: 8667/DELNP/2011

Country of ref document: IN

WWE Wipo information: entry into national phase

Ref document number: 2761696

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 2012510415

Country of ref document: JP

Ref document number: 001952-2011

Country of ref document: PE

Ref document number: MX/A/2011/012039

Country of ref document: MX

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 11155162

Country of ref document: CO

WWE Wipo information: entry into national phase

Ref document number: 2010246981

Country of ref document: AU

WWE Wipo information: entry into national phase

Ref document number: 2010721057

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 2010246981

Country of ref document: AU

Date of ref document: 20100510

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 20117029598

Country of ref document: KR

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2011145435

Country of ref document: RU

Kind code of ref document: A

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: PI1010540

Country of ref document: BR

ENP Entry into the national phase

Ref document number: PI1010540

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20111111