WO2010100428A2 - Compositions and methods - Google Patents

Compositions and methods Download PDF

Info

Publication number
WO2010100428A2
WO2010100428A2 PCT/GB2010/000391 GB2010000391W WO2010100428A2 WO 2010100428 A2 WO2010100428 A2 WO 2010100428A2 GB 2010000391 W GB2010000391 W GB 2010000391W WO 2010100428 A2 WO2010100428 A2 WO 2010100428A2
Authority
WO
WIPO (PCT)
Prior art keywords
nogo
ngrl
cells
neurite outgrowth
kinase
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/GB2010/000391
Other languages
English (en)
French (fr)
Other versions
WO2010100428A3 (en
Inventor
Yoshinori Takei
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Medical Research Council
Original Assignee
Medical Research Council
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Medical Research Council filed Critical Medical Research Council
Priority to DK10710598.3T priority Critical patent/DK2403515T3/da
Priority to AU2010219463A priority patent/AU2010219463A1/en
Priority to EP10710598.3A priority patent/EP2403515B1/en
Priority to CN201080009932.2A priority patent/CN102341117B/zh
Priority to ES10710598.3T priority patent/ES2493619T3/es
Priority to HK12106832.5A priority patent/HK1166017B/en
Priority to CA2750911A priority patent/CA2750911A1/en
Priority to US13/254,081 priority patent/US9089565B2/en
Priority to JP2011552505A priority patent/JP5670921B2/ja
Publication of WO2010100428A2 publication Critical patent/WO2010100428A2/en
Publication of WO2010100428A3 publication Critical patent/WO2010100428A3/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/43Enzymes; Proenzymes; Derivatives thereof
    • A61K38/45Transferases (2)
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/14Drugs for disorders of the nervous system for treating abnormal movements, e.g. chorea, dyskinesia
    • A61P25/16Anti-Parkinson drugs
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/28Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/10Transferases (2.)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/10Transferases (2.)
    • C12N9/12Transferases (2.) transferring phosphorus containing groups, e.g. kinases (2.7)
    • C12N9/1205Phosphotransferases with an alcohol group as acceptor (2.7.1), e.g. protein kinases
    • C12N9/1211Thymidine kinase (2.7.1.21)

Definitions

  • the invention relates to the field of neurological injury or disease, in particular the invention relates to the alleviation of inhibition of neuronal regeneration, such as neurite outgrowth.
  • Neurons extend neurites to communicate with other neurons or with their target tissues. This neuronal network in the adult central nervous system (CNS) regenerates only poorly after injury. This is a problem in the art, leading to poor patient outcomes following injury to the neuronal network.
  • MAG Myelin-associated glycoprotein
  • Nogo-A also known as Reticulon 4A
  • OMgp oligodendrocyte myelin glycoprotein
  • NgRl Nogo receptor 1
  • Nogo-A binds to NgRl through a domain called Nogo-66.
  • the Nogo-66 domain is composed of 66 amino acids and the Nogo-66 domain alone, without other regions of Nogo-A, is sufficient to inhibit neurite outgrowth.
  • MAG but neither Nogo-A nor OMgp, can inhibit neurite outgrowth not only through NgRl but also through NgR2, an NgRl homologous protein (6).
  • NgRl makes signalling complexes containing LINGO-I and either p75 NTR or TAJ/TROY (McGee,and Strittmatter Trends Ne ⁇ rosci 26, 193-198 (2003); Schwab et al. Trends MoI Med 12, 293-297 (2006)). Both p75 NTR and TAJ/TROY belong to the TNFalpha receptor family and they are proposed to be the major components initiating intracellular signals for inhibition of neurite outgrowth. It is uncertain whether NgR2 makes complexes containing LINGO-I and either p75 NTR or TAJ/TROY.
  • BDNF neurotrophin nerve growth factor family
  • Pre-treatment with BDNF increases the levels of intracellular cAMP in cultured neurons, allowing neurons to extend neurites even in the presence of the myelin-associated inhibitors (25).
  • BDNF is implicated in injury-induced neurite sprouting in the hippocampus (26).
  • a human neuroblastoma cell line SH-SY5Y shows BDNF-dependent neurite outgrowth after 5 days treatment with retinoic acid (RA) (18).
  • SH-SY5Y cells initiate differentiation into neuron-like cells and start expression of neuron-specific proteins in response to RA.
  • the neural cells differentiated from SH-SY5Y cells by RA show only limited morphological changes. BDNF treatment is required for efficient neurite outgrowth of the SH-SY5Y-derived neural cells, otherwise longer treatment with RA is required (27).
  • Caesin kinase Il has been studied in the context of neurones. Caesin kinase Il has been implicated in the phosphorylation of two different surface proteins in neurones. Neither protein is related to Nogo receptors. Furthermore, the studies in this area have been entirely dependent on the use of inhibitors of caesin kinase II. Thus, the function of intra-cellular CK2 has been studied in the art. Intra-cellular CK2 activity is known to be required for neurite outgrowth itself. Extra-cellular CK2 is known to exist. However, information on extra-cellular CK2 is largely unknown as noted above.
  • amyloid beta precursor protein and neuroglican C can be phosphorylated at the surfaces of neurones by endogenous extra-cellular CK2.
  • the effects of these phosphorylation (s) on neurite outgrowth (if any) are unknown.
  • Caesin kinase Il has been used to treat collagen/laminin in certain in vitro preparations. These treatments have never involved cells. These treatments have only ever involved in vitro preparations of matrix proteins such as collagen or laminin.
  • MAPl B is required for rearrangement of cytoskeleton, which is required for neurite outgrowth.
  • MAPl B phosphorylation is intra-cellular.
  • Other proteins associated with rearrangement of cytoskeleton have been known to be phosphorylated by CK2, intra-cellularly.
  • These intra-cellular phosphorylation events are required for neurite outgrowth itself. Since normal neurones, as well as N2A cells, can extend neurites without any stimulation, the inference is that these intra-cellular phosphorylation events are catalysed by a basal level of intra- cellular CK2 in neurones. The paper is not related to Nogo signaling.
  • the present invention seeks to overcome problem (s) associated with the prior art.
  • the present inventors have addressed these problems. Through detailed studies of Nogo signalling, the inventors have identified ways in which said signalling can be inhibited. Moreover, the inventors have identified a specific molecular target within the Nogo receptor which is key to the regulation of Nogo signalling. This target is serine 281 of the Nogo receptor. Phosphorylation of this residue abolishes binding of inhibitors of neurite outgrowth to the receptor, thereby alleviating the inhibition of neuroregeneration. Furthermore, the inventors teach and demonstrate effective ways in which this may be accomplished, such as by treatment with protein kinase A and/or caesin kinase II. The invention is based upon these surprising findings.
  • the invention provides a method for alleviating the inhibition of neurite outgrowth from a neurone, wherein said neurone comprises a Nogo receptor, said method comprising contacting said neurone with a composition capable of causing phosphorylation of a Nogo receptor, wherein said composition comprises protein kinase A or casein kinase II.
  • composition comprises protein kinase A and casein kinase II.
  • said phosphorylation is phosphorylation of an amino acid residue corresponding to serine 281 of said Nogo receptor.
  • Nogo receptor is human NgRl .
  • the invention relates to use of a protein kinase A polypeptide for the manufacture of a medicament for spinal cord injury.
  • the invention relates to protein kinase A polypeptide for use in the treatment of spinal cord injury.
  • the invention relates to use of a caesin kinase Il polypeptide for the manufacture of a medicament for spinal cord injury.
  • the invention relates to caesin kinase Il polypeptide for use in the treatment of spinal cord injury.
  • the invention in another aspect, relates to a composition comprising protein kinase A and casein kinase II, for use as a medicament.
  • the invention relates to use of a composition as described above for the manufacture of a medicament for spinal cord injury.
  • the invention relates to a composition as described above for use in the treatment of spinal cord injury.
  • the invention relates to use of a protein kinase A polypeptide or a caesin kinase Il polypeptide for the manufacture of a medicament for causing neurite outgrowth.
  • the invention relates to a protein kinase A polypeptide or a caesin kinase Il polypeptide for use in causing neurite outgrowth.
  • the invention in another aspect, relates to a method of treating spinal cord injury in a subject, said method comprising administering to said subject an effective amount of a composition capable of causing phosphorylation of a Nogo receptor, wherein said composition comprises protein kinase A or casein kinase II.
  • a composition capable of causing phosphorylation of a Nogo receptor, wherein said composition comprises protein kinase A or casein kinase II.
  • said administration is localised to the site of the injury.
  • Nogo signalling can inhibit neurite outgrowth (3, 4), differentiation (9, W), migration (12) and synapse formation (U) of neurons in the CNS.
  • Nogo signalling has been identified as a major inhibitor of the regeneration of the CNS, which does not occur under physiological condition.
  • phosphorylation of Nogo receptors e.g. by casein kinase Il (CK2), inhibits binding of the myelin-associated proteins which inhibit neuronal regeneration such as neurite outgrowth.
  • BDNF brain-derived neurotrophic factor
  • extra-cellular CK2 treatment overcomes inhibition of neurite outgrowth by the myelin-associated proteins. This is demonstrated for example in rat adult neurons.
  • the invention provides new strategies to control Nogo signalling and hence neuronal regeneration.
  • Nogo signalling inhibits neurite outgrowth from mammalian cells such as SH-SY5Y-derived neural cells, and that the inhibition is suppressed by extra- cellular treatment with CK2 without BDNF.
  • CK2 treatment inhibits binding of Nogo-66, MAG and OMgp to their receptors, allowing neurite outgrowth in the presence of these neurite outgrowth inhibitors.
  • BDNF-independent effects of the invention Suitably BDNF is not used in the methods of the invention.
  • BDNF is specifically omitted from the methods of the invention.
  • the compositions of the invention do not comprise BDNF.
  • Nogo Receptors may refer to any protein mediating Nog ⁇ - dependent inhibition of neurite outgrowth, and need not specifically refer only to receptors (NgRs) in the classic membrane-localised sense, but may also refer to any Nogo-binding protein mediating the Nogo signalling e.g. via proteins other than NgR family members; indeed, our results with normal neurones show that CK2 treatment can block such NgR-independent Nogo signalling as well as NgR-dependent signalling.
  • the term “Nogo Receptors” may be given its conventional meaning in the art herein unless the context indicates otherwise.
  • NgRl and its homologous proteins belong to a family of glycosylphosphatidylinositol (GPI)-linked proteins with eight leucine-rich repeat regions, which do not have intracellular domains. While NgRl can interact with Nogo-A, MAG and OMgp, NgR2 interacts with only MAG in a sialic acid-dependent manner. This interaction can inhibit neurite outgrowth, too. The ligand for NgR3 is unknown. NgRl makes a complex involving LINGO-I and neurotrophin receptor p75 NTR .
  • GPI glycosylphosphatidylinositol
  • TAJ/TROY an orphan tumour necrosis factor receptor family member broadly expressed in neurones, is involved in the complex, instead of p75 NTR . It is unknown whether NgR2 can make a complex with LINGO-I , p75 NTR or TAJ/TROY, as seen for NgRl .
  • Nogo signalling can be initiated by at least three ligands in oligodendrocytes, and it can transduce signals into neurones through at least two receptors. Relative contributions of specific ligand-receptor systems in Nogo signalling to inhibition of neurite outgrowth may vary among different neuronal cell types.
  • the present invention is concerned with Nogo receptors present on the cell surface.
  • the term "Nogo receptor” as used herein suitably refers to a Nogo receptor protein present at the cell surface of a target cell.
  • the target cell is a vertebrate target cell, more suitably a mammalian target cell, most suitably a human target cell.
  • the target cell is most suitably a human cell comprised by the subject to be treated, such as a human neurone, such as an adult human neurone.
  • the term "Nogo receptor” may refer to the polypeptide of any of the known Nogo receptors, such as NgRl , NgR2 or NgR3. Moreover, in targeting the Nogo receptor, it may be that more than one type of Nogo receptor is phosphorylated. This may bring advantages to the invention, such as alleviation of inhibition of neurite outgrowth independent of the particular Nogo receptor type or types which happen to be expressed on the particular target cell of choice. Moreover, it may be that by targeting a multiplicity of Nogo receptor proteins, that a stronger and/or faster effect is achieved.
  • Nogo receptor mutants may equally embrace any of the known NgR polypeptides, provided of course they have the specific mutation or substitution being discussed.
  • a Nogo receptor according to the invention is one or more of NgRl , NgR2 or NgR3or NgR3. More suitably, a Nogo receptor according to the invention is one or more of NgRl or NgR2.
  • NgRl NgR2
  • NgR3 NgR2
  • NgR2 NgR3or NgR3.
  • the invention is primarily concerned with vertebrate, such as mammalian applications. Therefore, suitably the Nogo receptor of the invention is a vertebrate, such as mammalian Nogo receptor. Most suitably, the Nogo receptor of the invention is a human Nogo receptor.
  • a human Nogo receptor has a polypeptide sequence corresponding to the human Nogo receptor amino acid sequence.
  • a Nogo receptor polypeptide according to the invention may be produced by any suitable means, such as recombinant production from a non-human host cell. However, for ease of understanding, a Nogo receptor polypeptide produced from a non-human cell will be regarded as a human Nogo receptor if the amino acid sequence corresponds to the human amino acid sequence.
  • Nogo receptor mutants are disclosed and discussed herein. It will be appreciated from the above discussion that such mutants may comprise one of a number of individual Nogo receptor subtypes such as NgRl , NgR2, NgR3, etc. For ease of understanding, particular amino acids or particular mutations are discussed in the context of a Nogo receptor reference sequence.
  • the Nogo receptor reference sequence is human NgRl amino acid sequence of NM023004: MKRASAGGSRLLAWVLWLQAWQVAAPCPGACVCYNEPKVTTSCPQQGLQAVPVGIPAASQR IFLHGNRISHVPAASFRACRNLTILWLHSNVLARIDAAAFTGLALLEQLDLSDNAQLRSVDPATF HGLGRLHTLHLDRCGLQELGPGLFRGLAALQYLYLQDNALQALPDDTFRDLGNLTHLFLHGNRI SSVPERAFRGLHSLDRLLLHQNRVAHVHPHAFRDLGRLMTLYLFANNLSALPTEALAPLRALQY LRLNDNPWVCDCRARPLWAWLQKFRGSSSEVPCSLPQRLAGRDLKRLAANDLQGCAVATGP YHPIWTGRATDEEPLGLPKCCQPDAADKASVLEPGRPASAGNALKGRVPPGDSPPGNGSGPR HINDSPFGTLPGSAEPPLTAVRPEGSEPPGFPTSGPRRRPGC
  • a functional test as to whether or not a particular polypeptide is to be considered an NgR family polypeptide.
  • the following functional criterion may also be used: binding to ligands such as those noted herein.
  • capacity to function in a neurite outgrowth assay may also be used, such as by overexpression in SH-SY5Y cells with RA treatment as described in the examples.
  • the polypeptide may be regarded as a Nogo receptor (NgR family polypeptide).
  • NgR family polypeptide the aim of the invention is to alleviate inhibition of neurite outgrowth and this should be borne in mind when assessing NgR protein(s) - it is the wild-type proteins which inhibit neurite outgrowth in this assay, in particular when not treated with kinase according to the invention.
  • the invention relates to Nogo receptor polypeptides characterised in that serine 281 is substituted for any other amino acid other than serine.
  • S281 is substituted for a non-phosphoacceptor amino acid, so that suitably S281 is not S, T, or Y.
  • the invention provides a NogoR having S281 A.
  • This has the advantage of being unphosphorylatable at this site.
  • the receptor has the biological property of being resistant to CKII / PKA inhibition of ligand binding.
  • such a mutant possesses the novel function of signalling in response to Nogo ligand(s) even in the presence of CKII/PKA.
  • the invention provides a NogoR having S281 D.
  • This has the advantage of simulating phosphorylation at S281.
  • the receptor has the biological property of being permanently switched 'off so that the inhibition of neurite outgrowth is permanently alleviated using this receptor. More specifically, this receptor does not bind Nogo ligand(s). In other words, such a mutant possesses the novel function of NOT binding (or signalling) in response to Nogo ligand(s), regardless of the presence of CKII/PKA.
  • Nogo receptor polypeptides (NogoR's) of the invention comprise the sequence of NM023004 except where indicated, e.g. at the residue corresponding to S281.
  • the invention also relates to NogoR's having at least 60% identity to NM023004, suitably at least 70% identity to NM023004, suitably at least 75% identity to NM023004, suitably at least 80% identity to NM023004, suitably at least 85% identity to NM023004, suitably at least 90% identity to NM023004, suitably at least 95% identity to NM023004, suitably at least 97% identity to NM023004, suitably at least 98% identity to NM023004, suitably at least 99% identity to NM023004, always with the feature that residue S281 is other than serine.
  • Truncated forms suitably correspond to this sequence across the length of such a truncated form.
  • a NogoR polypeptide according to the present invention comprises at least 30 amino acids, suitably at least 80 amino acids, suitably at least 130 amino acids, suitably at least 180 amino acids, suitably at least 230 amino acids, suitably at least 280 amino acids, suitably at least 330 amino acids, suitably at least 380 amino acids, suitably at least 382 amino acids (e.g. full length NgR2), suitably at least 402 amino acids (e.g. full length NgR3), suitably at Ieast417 amino acids (e.g. NgRl ).
  • Nogo receptor sequences may be modified for use in the present invention. Typically, modifications are made that maintain the region of the sequence comprising serine 281 (or the substitution at said address). Amino acid substitutions may be made, for example from 1 , 2 or 3 to 10, 20 or 30 substitutions provided that the modified sequence retains the required S281 residue. Amino acid substitutions may include the use of non- naturally occurring analogues, for example to increase half-life of a therapeutically administered polypeptide. The same applied to PKA or CKII polypeptides of the invention, in which case it is always required that the PKA/CKII kinase activity is retained following any mutants or substitutions introduced. '
  • Proteins of the invention are typically made by recombinant means, for example as described below. However they may also be made by synthetic means using techniques well known to skilled persons such as solid phase synthesis. Proteins of the invention may also be produced as fusion proteins, for example to aid in extraction and purification. Examples of fusion protein partners include glutathione-S-transferase (GST), 6xHis, GAL4 (DNA binding and/or transcriptional activation domains) and ⁇ - galactosidase. It may also be convenient to include a proteolytic cleavage site between the fusion protein partner and the protein sequence of interest to allow removal of fusion protein sequences.
  • GST glutathione-S-transferase
  • 6xHis 6xHis
  • GAL4 DNA binding and/or transcriptional activation domains
  • ⁇ - galactosidase It may also be convenient to include a proteolytic cleavage site between the fusion protein partner and the protein sequence of interest to allow removal of fusion protein
  • Proteins of the invention may be in a substantially isolated form. It will be understood that the protein may be mixed with carriers or diluents which will not interfere with the intended purpose of the protein and still be regarded as substantially isolated.
  • a protein of the invention may also be in a substantially purified form, in which case it will generally comprise the protein in a preparation in which more than 90%, e.g. 95%, 98% or 99% of the protein in the preparation is a protein of the invention.
  • the invention relates to a novel method of inhibiting Nogo signalling.
  • This novel method involves the phosphorylation of the Nogo receptor. Techniques disclosed herein also involve Nogo receptor mutants.
  • each of these slightly different technical variations is a part of the same common invention concerned with inhibition of Nogo signalling.
  • the invention has been principally described in connection with alleviating or reducing the inhibition of neurite outgrowth. This finds particular application in fields such as spinal cord injury. However, broader aspects of the invention may involve manipulation of other properties of neurones such as their migration or differentiation.
  • any process being controlled or affected by Nogo signalling may be modulated or controlled using techniques disclosed herein such as phosphorylation of the Nogo receptor.
  • the precise biomechanics of neurite outgrowth are still a subject of active research. It may be that the Nogo signalling techniques disclosed herein are affecting the regulation of neurite outgrowth in the sense of affecting controlling signals, or it may be that they are affecting the neurite outgrowth machinery such as proteins involved in fibre formation which may be intimately involved in producing the effect of neurite outgrowth.
  • the present invention does not concern itself with the precise biomechanics of neurite outgrowth. It is a key teaching of the invention that manipulation of the phosphorylation state of the Nogo receptor, or indeed the use of specific Nogo receptor mutants disclosed herein, are useful in modulation of neurite outgrowth. This teaching, and ways in which the invention is put into practice, are typically independent of the precise molecular mechanism which takes place at the point of physical neurite outgrowth itself.
  • a key application of the invention is in the treatment of spinal cord injury.
  • the invention finds application in promotion of regeneration following spinal cord injury.
  • the invention is useful if alleviating or reducing the inhibition of neurite outgrowth which is caused by signalling via the Nogo receptor. By suppressing or reducing signalling via the Nogo receptor, inhibition of neurite outgrowth is usefully diminished. This provides conditions which are advantageously permissive of neurite outgrowth and therefore of regeneration.
  • compositions of the invention Numerous examples presented herein involve canulation of the subject for application of the compositions of the invention. It should be noted that when the subject being treated is a human, canulation is advantageously avoided. Rather than canulation, a topical injection or series of injections of the compositions of the invention would be suitably employed.
  • the invention is generally applicable as follows: -add ng to ⁇ g of kinase such as CK2, optionally with 100 ⁇ M ATP, after injury eg. of the spinal cord
  • an injury may be made in the spinal cord and a canule put at the lesion.
  • a canule put at the lesion.
  • kinase such as CK2 may be applied on the area.
  • kinase such as CK2 It is also possible to apply kinase such as CK2 with injection, without canulation. This is preferred for human subjects. However, for experimental systems, canulation makes it easier to add kinase such as CK2 from time to time.
  • CK2 alone may be used, or CK2 in combination with chondroitinase ABC, which can digest chondroitin sulphate, another inhibitor of CNS regeneration.
  • PKA may be used, or PKA in combination with chondroitinase ABC.
  • the methods of the invention may be in vitro.
  • the methods of the invention may be in vivo for example in treatment of a subject such as a human subject.
  • serine 281 of the Nogo receptor is of paramount importance as a target for the present invention.
  • the inventors have disclosed a number of ways in which serine 281 of the Nogo receptor can be targeted and phosphorylated. Two of the most suitable ways of accomplishing this are the use of protein kinase A and/or caesin kinase Il to directly phosphorylate serine 281 of the Nogo receptor.
  • protein kinase A and caesin kinase Il are not necessarily physically related to one another, in the context of the present invention they form a single cohesive technical group of alternative ways in which the invention can be implemented.
  • caesin kinase Il and protein kinase A represent two equally valid ways of implementing the same single invention.
  • these two structurally distinct alternatives in the appended claims is entirely consistent with a single inventive concept.
  • these two enzymes share the same technical benefit in the context of the invention, which is namely to catalyse the phosphorylation of serine 281 of the Nogo receptor.
  • the application can be clearly seen to relate to a single inventive concept. Diverse ways of achieving the technical benefits of the invention are described in order to assist understanding, and in order to ensure that the skilled reader has no difficulty in the practice of the invention.
  • caesin kinase Il is vertebrate, more suitably mammalian caesin kinase II. More suitably, caesin kinase Il is human caesin kinase II.
  • Caesin kinase Il most commonly occurs as a hetero-tetramer.
  • This hetero-tetramer typically comprises a catalytic sub-unit consisting of two alpha polypeptides, and a regulatory sub-unit consisting of two beta polypeptides.
  • Such a complex is typically constitutively active in the sense of having kinase activity.
  • the catalytic sub-unit on its own ie, the homo-dimer of two alpha polypeptides
  • either the hetero-tetramer form of CK2 or the homo-dimer form of CK2 may be applied in the present invention, specifically the alpha-beta hetero-tetramer CK2 or alpha-homo dimer CK2.
  • CK2 is used in the form of a commercial preparation, such as from New England Bio Labs. This is suitably the holo enzyme form of CK2.
  • the CK2 used is composed of two polypeptide chains, each polypeptide chain having the sequence of a human CK2 alpha subunit such as: gene name; CSNK2A1 , accession number NM001895.3, NMl 77559.2, NMl 77560.2 (3 subtypes) gene name; CSNK2A2, accession number NMOOl 896.2.
  • NM001895 and NMl 77559 can produce the same proteins, although they have different 5' non-coding regions.
  • NM 177560 encodes isoform b, which has shorter N terminal region.
  • protein kinase A is vertebrate, more suitably mammalian protein kinase A. More suitably, protein kinase A is human protein kinase A.
  • the protein kinase A used may be composed of 2 alpha subunits and 2 beta subunits.
  • the beta subunit homo-dimer is the inhibitory domain and cAMP is required for dissociation of the beta homo-dimer from alpha homo-dimer.
  • the protein kinase A used is composed of 2 alpha polypeptide chains having the sequence of a human PKA alpha subunit (i.e. a PKA alpha subunit homo- dimer): gene name PRKACA, accession number NM002730.3, NM207518.1 (2 subtypes).
  • a human PKA alpha subunit i.e. a PKA alpha subunit homo- dimer
  • PRKACA accession number NM002730.3, NM207518.1 (2 subtypes).
  • NM 002730 encodes isoform 1 , which is ubiquitously expressed.
  • NM207518 encodes spermatogenic cell-specific PKA, isoform 2.
  • the isoform 1 sequence is used such as:
  • alpha-homodimer PKA is used.
  • protein kinase A may not have a physiological role in neurite outgrowth.
  • PKA may not come into contact with a Nogo receptor and/or may not phosphorylate it.
  • PKA does in fact catalyse this key phosphorylation event.
  • treatment using PKA offers a further advantage in avoiding disturbance of any natural biological processes. From ⁇ comparison of the enzymes which might be used to target serine 281 , without wishing to be bound by theory, it appears that CK2 may be a more likely biological candidate for "natural" phosphorylation of the Nogo receptor.
  • CK2 is an effective catalyst for bringing about the phosphorylation of serine 281 of the Nogo receptor.
  • sub-units of the particular kinases of interest described herein may be equally applied in the present invention.
  • a sub-unit may be a subset of the collection of proteins which typically make up the active enzyme in vivo, or a sub-unit may refer to a fragment or a truncated form of one of the polypeptides of the kinase of interest.
  • a polypeptide which happens to be truncated, or mutated is intended to be within the scope of the invention. Mutations may be made for example to enhance activity or provide independence from known cofactors of the enzyme being used. If a skilled reader wishes to determine whether or not a particular fragment or truncation of an enzyme of interest falls within the scope of the invention, it is essential that the enzyme used retains its functional catalytic activity. More specifically, a kinase used in the present invention is of interest only if it is capable of catalysing incorporation of phosphate into the Nogo receptor, such as at residue 281 of the Nogo receptor.
  • kinase or fragment of interest may be easily tested, for example by combining the kinase or fragment of interest with Nogo receptor in conditions permissive of phosphorylation, and assaying the Nogo receptor thereafter in order to determine if phosphorylation did indeed take place.
  • the activity of the kinase of interest may be assessed functionally, for example by applying it to cells and testing its alleviation of the inhibition of neurite outgrowth.
  • enzymes or fragments capable of producing this functional alleviation of inhibition of neurite outgrowth are of interest or application in the invention.
  • the exemplary ways in which this functional assay may be carried out are presented in the examples section.
  • references to kinases of interest in the invention such as "protein kinase A” or “caesin kinase II” should be taken to include any sub-units, fragments, mutants or truncations of those kinases, always provided that they retain kinase catalytic activity for the Nogo receptor as explained above, most suitably in the functional assay for alleviation of inhibition of neurite outgrowth.
  • the protein kinase A or caesin kinase Il used in the invention comprises full length polypeptide. More suitably the protein kinase A or caesin kinase Il used in the invention comprises polypeptide corresponding to the human wild type enzyme/s. Most suitably the protein kinase A or caesin kinase Il used in the invention is as disclosed in the examples section.
  • the protein kinase A or caesin kinase Il used in the invention comprises E-coli expressed recombinant protein.
  • the protein kinase A or caesin kinase Il used in the invention is exogenous i.e. is not made in the cells local to the site of administration but is rather supplied externally or exogenously such as in a composition of the invention.
  • compositions of the invention comprise one or more catalysts such as enzymes capable of bringing about phosphorylation of NogoR serine 281.
  • a catalyst such as enzymes capable of bringing about phosphorylation of NogoR serine 281.
  • PKA phosphorylation of NogoR serine 281.
  • a enzyme is PKA.
  • a enzyme is CKII.
  • compositions of the invention may comprise PKA and CKII.
  • CK2 is suitably present at 500 -1200 U/ml CK2 final concentration, or an equivalent amount if the composition is dried/lyophilised or concentrated e.g. for storage.
  • the invention provides a composition comprising 10-100 ⁇ M ATP, 5- 0.5 ⁇ g CK2, 1-10 mM MgCI2 or Mg-acetate and 10-50 mM KCI or K-acetate.
  • compositions containing only CK2 alpha subunit homo- dimer as the enzyme comprise only Mg and ATP as further components.
  • K ion is optional (in fact K ion is not required); thus suitably compositions containing only CK2 alpha subunit homo- dimer as the enzyme comprise only Mg and ATP as further components.
  • Using a CK2 alpha and beta hetero-tetramer has the advantage that the beta subunit enhances substrate-specificity of CK2 phoshorylation and K ion promotes this effect of beta subunit.
  • K ion is included in order to obtain this advantage.
  • the invention provides ⁇ composition comprising 10-100 ⁇ M ATP, 5- 0.05 ⁇ g PKA and 1-10 mM MgCI2 or Mg-acetate.
  • Polypeptides of the invention may preferably be combined with various components to produce compositions of the invention.
  • the compositions are combined with a pharmaceutically acceptable carrier or diluent to produce a pharmaceutical composition (which may be for human or animal use).
  • Suitable carriers and diluents include isotonic saline solutions, for example phosphate-buffered saline.
  • composition of the invention may be administered by direct injection.
  • composition may be formulated for administration to sites of nervous tissue, such as spinal cord, and may therefore be formulated to be compatible with cerebrospinal fluid or other such tissue.
  • each protein may be administered at a particular activity dose rather than a specific mg/kg body weight amount.
  • Exemplary activity levels for administration are given in the examples section.
  • volumes for mice, typically we inject around 2 ⁇ l in the CNS.
  • Doses of active ingredients are as discussed herein.
  • injection is used to deliver a composition of the invention such as CKII and/or PKA.
  • compositions of the invention may be administered topically eg. during spinal decompression surgery.
  • injection may be used as an alternative method for the administration.
  • compositions of the invention can be administered by periodic injection, over an effective period, such as up to 1 month or longer such as up to 3 months.
  • Matrix such as matrigel (BD Bioscience) may advantageously be used to keep the reagent at the administrated region.
  • any slow release substances and/or devices could be used to control the dosage/release periods.
  • compositions of the invention comprise ATP. This has the advantage of supplying ATP to help promote phosphorylation of the Nogo receptor.
  • compositions comprising either
  • the composition comprises a source of 5 mM Mg2+ ion.
  • Mg2+ ion may be supplied as MgCI2, or MgAc (Magnesium acetate) such as
  • composition of the invention comprises CK2
  • said composition further comprises potassium ion.
  • Potassium ion is not typically needed for compositions comprising PKA, but may optionally be included for example when the composition comprising PKA also comprises CKII.
  • Potassium ion is suitably supplied as 25-50 mM K ion, such as KCI or potassium acetate (CH3COOK). Potassium ion such as KCI is not essential, but advantageously has promoting effects on kinase activity of alpha-beta hetero-tetramer CK2.
  • Cyclic AMP may optionally be included in compositions of the invention, particularly when said compositions comprise PKA. Specifically, when only the alpha form of PKA is used, cAMP is optional. However, when the beta form of PKA is used, cAMP is desirable to include in the compositions of the invention and has the advantage of enhancing/enabling PKA activity.
  • cAMP is suitably supplied as di-butylic cAMP or as conventional cAMP. Either compound is available commercially such as via Sigma Inc. or Merck Inc. Use of di- butylic cAMP has the advantage of being cell permeable. Moreover, conventional cAMP does not penetrate plasma membranes.
  • compositions of the invention are suitably applied extracellularly, suitably conventional cAMP is used as cAMP according to the present invention since this offers the advantage of minimising or eliminating any side-effects on intracellular signalling, and offers the advantage of confining the cAMP added to the extracellular environment thereby helping to retain it localised with the enzyme(s) of compositions of the invention.
  • the invention finds particular application in spinal cord injury.
  • Nogo receptor is targeted. This has the advantage of providing methods and compositions which act in a ligand-independent manner.
  • chondroitinase such as chondroitinase ABC
  • chondroitinase ABC can be applied to promote conditions permissive of neurite outgrowth.
  • chondroitinase targets a pathway distinct from the Nogo pathway. Therefore it is advantageous to combine chondroitinase with treatments or compositions of the invention in order to provide a dual targeted approach to promotion of neurite outgrowth.
  • An exemplary anti-LINGO antibody may be as supplied by Biogen Inc. Such a combination has the advantage of targeting a different physical molecule, yet still within the same overall signalling complex. Therefore, combinations such as this offer the advantage of signalling fidelity, ie, targeting only a single pathway, combined with the advantage of targeting multiple different molecules, and thereby aiming to achieve a more robust blockade of signal.
  • rehabilitation which can be effective to promote proper connection of neurones.
  • Such combination may also advantageously decrease aberrant connection.
  • compositions of the invention may find application in administration during or after surgery such as neurosurgery.
  • surgery is an example of injury to adult nervous tissue.
  • the kinase(s), ATP and any necessary metal ions may be applied during surgery.
  • Cethrin may also be comprised in a composition of the invention. Typically this is used at 0.3, 1 , 3, 6 or 9 mg per dose.
  • composition (s) of the invention has the advantage of helping the added reagents to remain or persist in the lesion.
  • Inhibitors of inflammation may be comprised in a composition of the invention, and/or may be applied as soon as possible after the injury/surgery.
  • Transplantation of stem cells may be carried out, suitably after inflammation has passed (otherwise transplanted cells might be killed by the host immune system).
  • transplanted cells might be killed by the host immune system.
  • cells are transplanted after 5 days from the injury, i.e. transplanting the cells after inflammation.
  • inflammation inhibitors such as C3 toxin
  • Rho inhibitors such as C3 toxin
  • ES cells may usefully be combined with the invention.
  • Concerning ES cells forced activation of Nogo signalling can inhibit neuronal differentiation but promote glial differentiation of neuronal stem cells. So, if Nogo is active in the injured area, differentiation of transplanted cells may be advantageously promoted by the inhibition of Nogo signalling.
  • neurite outgrowth is inhibited in healthy adult nervous tissue. It is an aim of the invention to remove or to alleviate this inhibition. The net result of this is a promotion or enhancement of regeneration such as via neurite outgrowth. This might be referred to as stimulation of neurite outgrowth. Indeed, for the majority of applications, there may be no substantial difference between stimulation of neurite outgrowth and alleviation of inhibition of neurite outgrowth. However, due to the insights and understandings gained by the inventors of this cryptic system, the invention is consistently described in terms of alleviation of inhibition of neurite outgrowth. This is because it is established that certain Nogo family ligands are inhibitors of neurite outgrowth.
  • the invention may advantageously be combined with one or more stimulator(s) of neurite outgrowth, thereby simultaneously provoking outgrowth as well as removing or alleviating the inhibition, and leading to a more pronounced or enhanced regrowth or regeneration.
  • the invention relates to PKA for use as a medicament.
  • the invention relates to CK2 for use as a medicament.
  • the invention relates to a new extracellular use for CK2.
  • PKA protein kinase A
  • CK2 protein kinase A
  • PKA protein kinase A
  • the invention relates to alleviation of inhibition of neurite outgrowth after spinal cord injury, in particular by inhibition of Nogo signalling.
  • the invention may be applied to neurodegenerative disease generally, such as Alzheimer's disease and/or Parkinson's disease.
  • neurodegenerative disease generally, such as Alzheimer's disease and/or Parkinson's disease.
  • NogoR can bind to amyloid B and to its precursor APP.
  • the invention may also be applied to more acute neurological disorders such as stroke.
  • the invention finds application in any disorder of myelination, such as multiple sclerosis.
  • the invention may be applied to multiple sclerosis.
  • Schizophrenia is another example of a nervous disorder connected with a defect of myelination.
  • the invention may be applied to schizophrenia.
  • the invention relates to a method for increasing myelination in a system, said method comprising phosphorylating a Nogo receptor in said system, suitably by addition of PKA and/or CKII to said system.
  • the invention also relates to a method of inhibiting binding of inhibitors of neurite outgrowth such as Nogo ligand(s) to the Nogo receptor, said method comprising inducing phosphorylation of said Nogo receptor, such as at serine 281.
  • BDNF promotes neurite outgrowth of RA-treated SH-SY5Y, and induces phosphorylation of NgRl .
  • A SH-SY5Y cells were incubated with indicated reagents. Cell images were taken with phase contrast microscopy.
  • B Number of cells extending neurite-like structures of more than 40 ⁇ m and total cell number were counted from images taken in (A). More than 300 cells were examined in each sample. The proportion of cells extending neurite-like structures of more than 40 ⁇ m was indicated as a percentage of total cell number. An average of three experiments is shown. Error bars indicate S. E. between experiments. Data were analysed with student's t test.
  • (E) RA-treated SH- SY5Y cells were incubated with BDNF in the presence or absence of one of the following: PKC inhibitor - 500 nM G56983 or G56976; PKA inhibitor - 2 ⁇ M KT5720 or a PKA inhibitor peptide 14-22; or either 500 nM or 1 ⁇ M of a casein kinase inhibitor, for 24 hours.
  • PKC inhibitor - 500 nM G56983 or G56976 PKA inhibitor - 2 ⁇ M KT5720 or a PKA inhibitor peptide 14-22
  • 500 nM or 1 ⁇ M of a casein kinase inhibitor for 24 hours.
  • Whole cell extracts prepared from these cells were analysed by SDS-PAGE. lmmunoblotting was performed with anti-NgRl antibody.
  • CK2 promotes neurite outgrowth of RA-treated SH-SY5Y cells without BDNF.
  • A RA-treated SH-SY5Y cells were incubated with the indicated reagents for 24 hours. Cell images were taken with phase contrast microscopy.
  • C Myc-tagged wild type and mutant versions of NgRl were over-expressed in SH-SY5Y cells.
  • the cells were treated with RA, CK2 and ATP. Over-expressed NgRl- Myc was detected with anti-Myc antibody.
  • D SH-SY5Y cells over-expressing 281 S/A mutant NgRl-Myc were incubated with RA and NEP 1-40.
  • E SH-SY5Y cells over- expressing 281S/D mutant NgRl-Myc were treated as (C).
  • CK2 phosphorylates NgRl , and inhibits binding of the myelin-associated proteins to NgRl .
  • A Myc-tagged wild type, 281S/A or 281S/D mutant NgRl were over- expressed in COS7 cells. The over-expressed cells were incubated with either the combination of ATP and CK2, or NEP 1-40 for 30 min at 37°C. After washing with PBS, cells were incubated with Hisx ⁇ -tagged Nogo-GFP for 3 hours at 4°C. The cells were fixed and immunofluorescence was performed with anti-Myc and anti-GFP antibodies.
  • B COS7 cells over-expressing Myc-tagged wild type NgRl were treated as described in (A).
  • Myc-tagged proteins were immunoprecipitated and analysed with SDS-PAGE. Proteins were blotted onto a PVDF membrane and the membrane was exposed to X-ray film to detect incorporated 32 P. After autoradiography, the membrane was used for immunoblotting with anti-Myc antibody.
  • E and F COS7 cells over-expressing Myc-tagged wild type, 28 IS/A or 281S/D mutant NgRl , were treated as described in (A). After washing with PBS, cells were incubated with either His-tagged OMgp (E) or HA-tagged MAG (F) for 3 hours at 4°C. The cells were fixed and immunofluorescence was performed with either anti-Myc and anti-His antibodies (E) or anti-Myc and anti-HA antibodies (F).
  • Fig. 4 The CK2 target motif containing serine 281 in human NgRl is conserved in vertebrate NgRl and NgR2.
  • A Amino acid sequences of C-terminal flanking region in NgRl of human (GenBank accession number NM 023004), mouse (NM 022982), rat (AF462390), danio (NM 203478) and chicken (XM415292) were compared. Amino acids identical to human NgRl are indicated in red.
  • C Whole cell extract was prepared from COS7 cells over-expressing Myc-tagged NgR2 after incubation with a- 32 P-ATP in the presence or absence of CK2. Myc-tagged NgR2 was immunoprecipitated from the whole cell extract and analysed by SDS-PAGE. Proteins were blotted onto a PVDF membrane and the membrane was treated as described in Fig. 3c.
  • DRG neurones from postnatal day 5 rats were cultured with or without the Nogo-66 fragment in the presence of the indicated reagents. After 24 hours from addition of the indicated reagents, cells were fixed and ⁇ -tubulin III was detected by immunofluorescence.
  • B The number of cells extending neurites of more than 20 ⁇ m and total ⁇ -tubulin III positive cell number were counted from images taken in (A). The population of cells extending neurite-like structures of more than 20 ⁇ m was indicated as a percentage of total cell number. An average of three experiments is shown.
  • CG neurones from postnatal day 8 rats were cultured with or without the indicated myelin associated inhibitors for 24 hours in the presence or absence of CK2. Cells were fixed and ⁇ -tubulin III was detected by immunofluorescence.
  • G CG neurones over-expressing either wild type NgRl-Myc or 281 S/A mutant NgRl-Myc were cultured with or without the Nogo fragment in the presence or absence of CK2 for 24 hours. Over-expressed NgRl-Myc was detected by immunofluorescence.
  • H The number of Myc-positive cells extending neurites of more than 20 ⁇ m and total Myc-positive cell number were counted from images taken in (G). Calculation was done as (B).
  • Figure 6 shows Amino acid sequences of vertebrate NgRIs.
  • NCBI accession numbers of NgRIs are rat; AF 462390, human; NM 023004, mouse; NM 022982, danio; NM 203478, chicken; XM 415292 .
  • Red characters show homologous amino acids to human NgRl .
  • Green characters show similar amino acids to human NgRl .
  • NF N-terminal flanking region, LRR; leucine rich repeat motif, CF; C-terminal flanking region.
  • Figure 7 shows: A, The RA-treated SH-SY5Y cells were cultured with the indicated reagents for 24 hours. After fixation, beta-tubulin III was detected with anti-beta-tubulin III antibody.
  • B Wild type or 281 S/A mutant NgRl-Myc was over-expressed in SH-SY5Y cells. After 5 days treatment with RA, these cells were incubated with 500 U/ml PKA and 500 nM (74 kBq/ml) ATP. Then, NgRl-Myc was immuno-precipitated and analysed with SDS-PAGE.
  • Figure 8 shows Amino acid sequences of human NgRs. NCBI accession numbers of NgRs are as for Figure 4B. Red characters show homologous amino acids to human NgRl . The closed triangle shows the position of serine281 in human NgRl .
  • FIG. 9 shows photographs and a sequence alignment.
  • A Full length of PirB was expressed in COS7 cells with streptoavidine-binding peptide (SBP) tag at the C terminal.
  • SBP streptoavidine-binding peptide
  • the COS 7 cells were incubated with 2000 U/ml PKA, 5 mM MgSO4 and 100 ⁇ M 32P-ATP in OptiMEM (Invitrogen) at 37°C for 1 hour. After the incubation, the cells were washed and proteins were extracted with 0.5% Triton X-100, 20 mM Tris HCI (pH8.0) and 150 mM NaCI.
  • SBP-tagged PirB was precipitated from the extract with streptoavidin-magnetic beads (Invitrogen).
  • Figure 10 shows photographs and a bar chart.
  • A Organotypic culture of Entorhinal- hippocampal slices was prepared from 129X1 /SvJ JmsSlc (albino) mice postnatal day 5 and 6. Culture media were changed every 2 days. On the day in vitro (DIV) 10, On the day in vitro (DIV) 10, the entorhinal-hippocampal projection was transected with sterile scalpel brade. The lesioned slices were cultured for 8 days with or without 1250 U/ml PKA and 100 ⁇ M ATP. On the DIVl 7, a small aliquot of DiI paste (Invitrogen) was applied on the entorhinal side of the transection.
  • DiI paste Invitrogen
  • a human neuroblastoma cell line, SH-SY5Y was purchased from ATCC.
  • Ham's Fl 2 medium, Neurobasal-A medium, mouse anti-GFP monoclonal antibody and B27 supplement were purchased from Invitrogen.
  • Retinoic acid, creatine and creatine phosphokinase, mouse anti-Myc monoclonal antibody and poly-D-Lysine were purchased from Sigma.
  • Rat neurons and NSF-I supplement were purchased from LONZA.
  • Anti-LINGO-1 was purchased from Millipore.
  • Anti-Nogo A and anti-NgR were purchased from Santa Cruz. ATP was purchased from
  • CK2 and lambda protein phosphatase were purchased from New England Biolab.
  • Collagen IV, OMgp-His and Nogo-Fc was purchased from R&D.
  • Rabbit anti- Myc polyclonal antibody was purchased from Cell Signaling.
  • a- 32 P-ATP was purchased from GE healthcare.
  • Cell culture SH-SY5Y cells were cultured in Ham's Fl 2 medium with 10% foetal bovine serum at 37°C in 5% CO2 and 95% air. Passage numbers between 15 and 21 were used in experiments described in this paper. Further passages induce spontaneous differentiation and cells tend to extend neurites without BDNF (data not shown).
  • RA treatment the cells are seeded (20,000 cells/well) on collagen IV coated 4 well chamber slides. After 24 hours culture, medium was changed to Ham's F12 medium containing 10 ⁇ M RA and 10% foetal bovine serum. Medium was changed to fresh medium on day 3 and cells were used for experiments after 5 days culture. Encinas et al.
  • the DRG neurons from postnatal day 5 rats were resuspended in Neurobasal- A media containing 2 mM glutamine and 2% NSF-I supplement, and seeded (5,000 cells/well) on poly-D-Lysine coated 8 well chamber slides. After 4 hours from seeding, medium was replaced with fresh medium.
  • the CG neurons from postnatal day 8 rats were resuspended in Neurobasal-A medium containing 25 mM KCI, 2 mM glutamine and 2% B27 supplement, and seeded (10,000 cells/well) on poly-D-Lysine coated 8 well chamber slides. After 4 hours from seeding, medium was replaced with fresh medium.
  • CK2 treatment of DRG neurons from postnatal day 5 rats medium was changed to neurobasal-A medium containing 2 mM glutamine 10 mM KCI, 5 mM MgCb and 2% NSF-I supplement with 500 U/ml CK2, after 4 hours incubation from seeding.
  • control no treatment
  • medium was changed to the medium without CK2.
  • neurobasal-A medium containing 2 mM glutamine, 2% B27 supplement and 25 mM KCI was used.
  • CK2 treatment of COS7 cells cells were washed with serum-free Ham's Fl 2 medium and incubated with or without both 500 ⁇ M ATP and 1200 U/ml CK2 in serum- free Ham's Fl 2 medium containing 25 mM KCI and 5 mM MgCb for 30 min at 37°C.
  • Hisx ⁇ , Nogo-A and EGFP region of the vector was cut out from the vector and integrated into pBEn-SBP-SET vector (Stratagene), then transfected to ArcticExpress (DE3JRIL E. coli (Stratagene). Expression of Hisx6-Nogo-A fragment-EGFP protein was induced by 1 mM IPTG overnight at 18°C. Hisx ⁇ Nogo-A fragment-GFP was purifed with a TALON column (TAKARA).
  • cDNA of MAG was amplified by PCR with the first strand DNA as template and a termination codon was added at the 3' end of the MAG cDNA by PCR.
  • the MAG cDNA was integrated into pDisplay vector (Invitrogen).
  • the plasmid was transfected into COS7 cells.
  • the transfected cells were maintained with DMEM containing 10% serum and 600 ⁇ g/ml of geneticin (Invitrogen).
  • the cells were cultured with VP-SFM medium (Invitrogen) with 2 mM L-glutamine for 3 days.
  • HA-tagged MAG was purified from the conditioned medium with HA-tag protein purification kit (Sigma).
  • NgR2 cDNA was amplified by PCR with the first strand DNA as template.
  • the PCR product was ligated into pCR Blunt vector (Invitrogen). Sequence of the NgR2 cDNA inserted in pCR Blunt was confirmed.
  • IMAGE clone encoding full length NgRl was purchased from Gene Service Inc.
  • the cDNAs of NgRl (NM 023004, Nt. 184-1543) and NgR2 (NM 17857, Nt. 1-1200), respectively, were transferred into pDisplay vector with Sail and Kpnl site. The region encoding NgR, Myc tag and transmembrane domain is cut out from the vector with Kpnl and Notl .
  • the Kpnl-Notl fragments were integrated into pCEP4 (Invitrogen). Electroporation with Nucleofector (amaxa) was used for transfection.
  • the NgR/pDisplay were transfected into COS7 and NgRl-Myc- transmembrane domain/pCEP4 was transfected into SH-SY5Y cells.
  • NeuroMag kit (OZ Bioscience) was used for transfection into rat neurons.
  • Neurons cultured for 24 hours on 8 well chamber slides coated with laminin and with or without the Nogo-66 fragment were used for transfection. After the transfection, neurons were cultured for another 24 hours and CK2 was added into culture media to a final concentration of 500 U/ml. Neurons were cultured with CK2 for 24 hours and fixed.
  • the PVDF membrane was incubated in blocking buffer (5% skimmed milk, 0.4% Triton X-100 in PBS) for 1 hour, first antibody diluted in the blocking buffer and appropriate secondary antibody labelled with horse radish peroxidase. Bound antibodies were visualised with ECL or ECL Plus kit (GE healthcare).
  • the fixed cells were washed with PBS and incubated with 3% BSA and 0.5% Triton X-100 in PBS at room temperature for 30 min and with first antibody, 3% BSA and 0.5% Triton X- 100 in PBS at 37°C for 2 hours. After washing with PBS, cells were further incubated with appropriate secondary antibody, 3% BSA and 0.5% Triton X-100 in PBS at 37°C for 30 min. After washing with PBS 3 times, cells were mounted with VECTASHIELD mounting medium with DAPI (VECTOR) and observed with confocal laser scanning microscopy.
  • Example 1 Nogo signalling inhibits neurite outgrowth from RA-treated SH-SY5Y ceils
  • SH-SY5Y cells showed limited morphological changes after RA treatment for 5 days, but efficient neurite outgrowth was observed after sequential treatment with RA for 5 days and BDNF for 1 day (Fig. IA), as previously reported by Encinas et al. (18).
  • NEPl -40 a competitive inhibitor of Nogo-66 binding to NgRl (28)
  • Fig. I A and B a competitive inhibitor of Nogo-66 binding to NgRl (28)
  • Nogo signalling inhibits neurite outgrowth from the SH- SY5Y-derived neural cells, and that BDNF suppresses the effects of Nogo signalling.
  • RA-treated SH-SY5Y cells were incubated with BDNF in the presence of kinase inhibitors.
  • PKC inhibitors G06983 and G56976, nor PKA inhibitors KT 5720 and a PKA inhibitor peptide show effects on the level of the upper band of NgRl .
  • a CK2 inhibitor decreased the upper band (Fig. I E).
  • BDNF is known to activate CK2 in neural cells (29).
  • Example 2 RA-treated SH-SY5Y cells extend neurites after extra-cellular treatment with
  • NgRl is a glycosylphosphatidylinositol-anchored membrane protein, which does not have a cytoplasmic domain ⁇ 30, 31).
  • the phosphorylation sites in NgRl after BDNF treatment are extra-cellular, and they could be phosphorylated by extra-cellular treatment with CK2.
  • CK2 Neither addition of ATP alone nor CK2 alone to the culture medium induced neurite outgrowth from SH-SY5Y-derived neural cells.
  • the cells showed significant neurite outgrowth after simultaneous incubation with both CK2 and ATP for 24 hours (Fig. 2A and B).
  • extra-cellular treatment with CK2 suppresses inhibitory effects of Nogo signalling on neurite outgrowth from the SH-SY5Y-derived neural cells, without BDNF.
  • Example 3 Serine 281 in human NgRI is a key target for CK2 mediated suppression of Nogo signalling
  • Human NgRl contains 5 candidate sites for phosphorylation by CK2, threonine 173 , serine 192 , serine 281 , threonine 325 and serine 345 , and these candidate sites were substituted to alanine.
  • the kinase used in this example is CK2.
  • RA-treated SH-SY5Y cells over-expressing these NgRl mutants were treated with ATP and CK2 for 24 hours, cells carrying the serine 281 to alanine substitution (281 S/A) in NgRl failed to show significant neurite outgrowth (Fig. 2C).
  • Serine 281 in NgRl was substituted to aspartic acid (281S/D) and the mutant NgRl was over-expressed in RA-treated SH-SY5Y cells (Fig. 2E). Although, aspartic acid is negatively charged, like a phosphorylated serine residue, the cells over-expressing 281S/D mutant NgRl did not extend neurites after RA treatment without co-treatment with CK2 and ATP (Fig. 2E). This indicates that 281 S/D mutant NgRI is not a constitutively negative mutant of NgRl .
  • Example 4 CK2 inhibits binding of the myelln-associated inhibitors to wild type NgRI, but not to the mutant NgRl carrying a serine 281 substitution
  • the Nogo-66 fragment bound to COS7 cells over-expressing wild type NgRl (Fig.3A). However, the Nogo-66 fragment failed to bind to the cells after treatment with CK2 and ATP.
  • binding of the Nogo-66 fragment was not observed even without CK2 treatment (Fig. 3A right).
  • 281 S/D mutant NgRl can neither bind to Nogo-66 nor inhibit signalling through endogenous NgRl .
  • the interaction between the Nogo-66 fragment and over- expressed NgRl was also observed in immunoprecipitation assays (Fig. 3B). While treatment with either ATP or CK2 alone failed to inhibit the interaction, co-treatment with ATP and CK2 inhibited binding of the Nogo-66 fragment to the over-expressed NgRl .
  • cell surface proteins were biotinylated. Comparable levels of biotinylated NgRl-Myc, wild type, 281S/A and 281S/D, were detected by western blotting (Fig. 3C).
  • over-expressed NgRl is phosphorylated after the extra-cellular treatment with CK2.
  • COS7 cells over-expressing either wild type or 28 IS/A mutant NgRl were incubated with CK2 in the presence of a- 32 P-ATP and over-expressed NgRI s were immunoprecipitated.
  • both wild type and 281 S/A mutant NgRl were phosphorylated with CK2 treatment
  • phosphorylation of the 281 S/A mutant NgRl was much weaker than that of wild type NgRl (Fig. 3D).
  • Fig. 3E and F show that CK2 treatment inhibited binding of both OMgp and MAG to wild type NgRl , but not to 281 S/A mutant NgRl . Neither OMgp nor MAG bound to COS7 over-expressing 281S/D mutant NgRl . These results indicate that CK2 treatment can inhibit binding of Nogo-66, MAG and OMgp to NgRl and that serine 281 in NgRl is essential for the effect of CK2.
  • Example 5 Serine 281 of human NgRI is conserved in both vertebrate NgRI and NgR2
  • Fig. 4A shows that serine 281 is in the C-terminal flanking region of the leucine-rich repeats in human NgRl (30, 31 j, and that the target motif for CK2 including serine 281 is conserved in human, mouse, rat, danio and chicken.
  • NgRl of mouse, rat and chicken has another candidate target motif for CK2 in the C-terminal flanking region, at serine 304 .
  • the latter serine is not conserved in human and danio NgRl .
  • the CK2 target motif containing the serine 281 of human NgRl is conserved in human and mouse NgR2 (Fig. 4B). Serine 281 in human NgRl corresponds to serine 282 in human NgR2.
  • NgR3 has a candidate target site for CK2 phosphorylation in the C-terminal flanking region, similar to NgRl and NgR2, the site is 1 1 amino acids upstream of the serine 281 of NgRl .
  • the PKA target motif containing serine 281 in NgRl is conserved in the three NgRs. Consistent with the conserved CK2 target motif in NgR2, CK2 phosphorylates
  • NgR2 (Rg. 4C) and CK2 treatment inhibited binding of MAG to COS7 cells over- expressing NgR2 (Fig. 4D).
  • human NgR2 contains two CK2 target sites, serine 282 and threonine 366 , only the CK2 target site containing serine 282 is conserved in human NgRl .
  • Mass spectrometry detected phosphorylation of the peptide containing serine 282 of human NgR2, but not the peptide containing threonine 366 , after CK2 treatment (Fig. 4E).
  • Example 6 CK2 rescues rat neurons from inhibition of neurite outgrowth by Nogo, MAG or OMgp.
  • CK2 treatment can rescue neurons from inhibition of neurite outgrowth not only by the Nogo-66 fragment but also by MAG or OMgp (Fig. 5C-E).
  • Fig. 5F shows that not only DRG neurons from postnatal day 5 rats, but also cerebellar granule (CG) neurons from postnatal day 8 rats can extend neurites in the presence of Nogo-66, MAG or OMgp, when the neurons are treated with CK2 for 24 hours.
  • CG cerebellar granule
  • Example 7 CK2 fails to rescue neurons expressing 281 S/ A mutant NgRI from inhibition of neurite outgrowth by Nogo-66
  • Example 8 Method for alleviating inhibition of neurite outgrowth In a subject
  • a method for alleviating the inhibition of neurite outgrowth from a neurone is demonstrated.
  • the subject is a mouse.
  • Mouse neurones comprise a Nogo receptor.
  • a spinal cord injury model is used. Following induction of the experimental injury, said neurone is contacted with a composition capable of causing phosphorylation of a Nogo receptor. In this step, one of the following two compositions is applied, typically by injection or via a canula introduced at the time of the experimental injury:
  • kinases For human applications, higher levels of kinases are used, typically 0.05-5 mg kinase, either PKA or CK2. Concentration of ions and ATP for human use are typically as above.
  • Nogo-A, MAG and OMgp are myelin-associated proteins that can bind to NgR (Gonzenbach, R. R., and Schwab, M. E. (2008). Disinhibition of neurite growth to repair the injured adult CNS: focusing on Nogo. Cell MoI Life Sci 65, 161-176.).
  • mouse PirB paired-lg-like receptor B, NMOl 1095
  • LILRBs leukocyte immunoglobulin-like receptor Bs
  • PirB is ⁇ functional receptor for myelin inhibitors of axonal regeneration. Science 322,
  • NgRs regions of the brain, it can cooperate with NgRs to inhibit neurite outgrowth (Atwal et al., ibid).
  • PirB was over-expressed in COS7 cells, and the cells, were incubated with catalytic subunit of protein kinase A (PKA) and ATP. PirB on the cell surface can be a substrate of PKA ( Figure 9A).
  • PKA protein kinase A
  • Mass spectrometry indicates that the phosphorylation site is serine 425 in the extracellular domain of PirB.
  • the invention relates to a method for alleviating the inhibition of neurite outgrowth from a neurone, wherein said neurone comprises a PirB/LILRB receptor, said method comprising contacting said neurone with a composition capable of causing phosphorylation of PirB/LILRB, wherein said composition comprises protein kinase A or casein kinase II.
  • said composition comprises protein kinase A and casein kinase II.
  • said phosphorylation is phosphorylation of an amino acid residue corresponding to serine 425 of said PirB/LILRB.
  • the invention provides a method for alleviating the inhibition of neurite outgrowth from a neurone, wherein said neurone comprises a Nogo receptor and a PirB/LILRB receptor, said method comprising contacting said neurone with a composition capable of causing phosphorylation of a Nogo receptor and a PirB/LILRB receptor, wherein said, composition comprises protein kinase A or casein kinase II.
  • said composition comprises protein kinase A and casein kinase II.
  • said phosphorylation is phosphorylation of an amino acid residue corresponding to serine 281 of said Nogo receptor and phosphorylation of an amino acid residue corresponding to serine 425 of said PirB/LILRB.
  • Neurones in the entorhin ⁇ l cortex form ⁇ strong projection to the dentate gyrus of the hippocampus during postnatal period.
  • the entorhinal cortex-hippocampus system is one of the first regions to be affected in Alzheimer's disease, and problems in the system is thought to be result in both impaired sense of direction and disorder of memory.
  • Organotypic slice culture of the brain preserves many features of the in vivo system, and it is widely used as a model of intact brain.
  • Entorhinal-hippocampal projection in the intact brain can be conserved in the organotypic slice culture in vitro.
  • Entorhinal-hippocampal slices prepared from mice postnatal day 5-7 show poor regeneration from lesion, after 6 days culture in vitro (Kluge, A., Hailer, N. P., Horvath, T. L., Bechmann, I., and Nitsch, R. (1998). Tracing of the entorhinal-hippocampal pathway in vitro. Hippocampus 8, 57-68. Prang, P., Del Turco, D., and Kapfhammer, J. P. (2001 ). Regeneration of entorhinal fibers in mouse slice cultures is age dependent and can be stimulated by NT-4, GDNF, and modulators of G- proteins and protein kinase C. Exp Neurol 169, 135-147.).
  • Chondroitin sulfate proteoglycans and myelin associated proteins are known to be the major inhibitors of the regeneration (Mingorance, A., Sole, M., Muneton, V., Martinez, A., Nieto-Sampedro, M., Soriano, E., and del Rio, J. A. (2006). Regeneration of lesioned entorhino-hippocampal axons in vitro by combined degradation of inhibitory proteoglycans and blockade of Nogo-66/NgR signaling. FASEB J 20, 491-493.).
  • entorhinal-hippocampal slices from mice postnatal day 5 or 6 were transected on day in vitro (DIV) 10, and they were incubated with or without PKA and ATP for 8 days.
  • DiI (1 ,1 '-dioctadecyl-3,3,3'3,-tetramethlindocarbocyanine perchlorate) is a lipophilic membrane stain that diffuses laterally to stain the entire cell, but it cannot move through cell-to-cell interaction. Therefore, projection of neurones can be traced with DiI.
  • exogenous addition of PKA according to the present invention is demonstrated to be a useful method to promote regeneration of the CNS, which is strictly inhibited under normal conditions.
  • Nogo signalling can be suppressed by phosphorylation of Nogo receptors.
  • the phosphorylation sites in Nogo receptors are extra-cellular (Figs. 3 and 4).
  • BDNF induces the ecto-domain phosphorylation of NgRl in neural cells differentiated from SH-SY5Y cells by RA (Fig. 1 ).
  • Ecto-domain phosphorylation of NgRs inhibits binding of myelin-associated inhibitors of neurite outgrowth, Nogo-66, MAG and OMgp (Fig. 3 and 4).
  • Ecto-domain phosphorylation has been reported in many types of cells, including neurons, immune cells, epithelial cells and endothelial cells (34). Ecto-domain phosphorylation can be catalysed by both ecto-protein kinases after substrate proteins are sorted to the plasma membrane, and intracellular kinases before the sorting (33, 35). While intracellular kinases use intracellular ATP as a source of phosphate group, ecto-protein kinases use extra-cellular ATP. The concentration of extra-cellular ATP under physiological conditions has been estimated at micro-molar level (36). When tissues are damaged, ATP can be released from dying or injured cells through damaged plasma membranes.
  • Inflammation which can be induced by tissue damage, can also induce release of ATP from a variety of cell types including neurons (37). Thus, the concentration of extra-cellular ATP could be increased by tissue damage.
  • in vitro function of ecto-domain phosphorylation has been reported (34), its in vivo function is still unclear.
  • Ecto-domain phosphorylation of collagen XVII can inhibit its shedding by metalloproteinases (38).
  • Ecto-domain phosphorylation of collagen XVII is catalysed by CK2, and its phosphorylation site is located in the target site for metalloproteinases (38).
  • NgRs are also known to be shed by metalloproteinases (39, 40) and they can be phosphor ⁇ lated by CK2 (Fig. 1-4), the phosphorylation site is not included in the shedding site.
  • the shedding site in NgRl is amino acid 358 (39), and the phosphorylation site is 281 (Figs. 3 and 4).
  • BDNF can induce phosphoryaltion of NgRl and overcome Nogo signalling in RA-treated SH-SY5Y cells (Fig. 1 ), it fails to attenuate effects of Nogo signalling on neurite outgrowth from rat primary neurons (Fig. 5).
  • endogenous ecto-CK2 activity has been reported to be associated with neural cells (34), incubation of neural cells with ATP alone failed to inhibit Nogo signalling (Fig. 2).
  • endogenous ecto-CK2 activity appears to be insufficient to inhibit Nogo signalling.
  • Extra-cellular treatment with exogenous CK2 rescues neurons from inhibition of neurite outgrowth by Nogo signalling (Fig. 5).
  • Extra-cellular treatment with exogenous CK2 phosphorylates serine 281 in NgRl , which can inhibit binding of Nogo, MAG and OMgp to NgRl (Fig. 3).
  • the CK2 phosphorylation site in NgRl , serine 281 is conserved in NgR2, and phosphorylation of NgR2 inhibits binding of MAG (Fig. 4).
  • NgRs Although signalling through NgRs is thought to be a main pathway of Nogo signalling, a recent paper indicates that neurons from NgRl-/- mice are still sensitive to inhibition of neurite outgrowth by Nogo signalling (8). This suggests that Nogo signalling could inhibit neurite outgrowth from neurons not only through NgRs but also through unknown Nogo receptors. While depletion of NgRl fails to rescue neurons from the inhibitory effects of the Nogo-66 fragment (8), extra-cellular treatment with CK2 can (Fig. 5). Therefore, it appears that CK2 treatment must block both NgR- dependent and any independent unknown pathways for inhibition of neurite outgrowth by the myelin-associated inhibitors, Nogo-66, MAG and OMgp.
  • BDNF induces phosphorylation of NgRl in RA-treated SH-SY5Y cells by a CK2-like activity, which overcomes inhibition of neurite outgrowth by Nogo signalling.
  • this inhibition of Nogo signalling by BDNF does not occur in rat neurons.
  • extra-cellular treatment with exogenous CK2 rescues neurons from inhibition of neurite outgrowth by Nogo signalling.
  • CK2 phosphorylates ecto- domains of both NgRl and NgR2, which blocks binding of both MAG to NgR2, and Nogo, MAG and OMgp to NgRl .

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Engineering & Computer Science (AREA)
  • General Health & Medical Sciences (AREA)
  • Veterinary Medicine (AREA)
  • Medicinal Chemistry (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Chemical & Material Sciences (AREA)
  • Public Health (AREA)
  • Neurosurgery (AREA)
  • Neurology (AREA)
  • Biomedical Technology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Immunology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Epidemiology (AREA)
  • Hospice & Palliative Care (AREA)
  • Psychiatry (AREA)
  • Psychology (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Enzymes And Modification Thereof (AREA)
PCT/GB2010/000391 2009-03-06 2010-03-05 Compositions and methods Ceased WO2010100428A2 (en)

Priority Applications (9)

Application Number Priority Date Filing Date Title
DK10710598.3T DK2403515T3 (da) 2009-03-06 2010-03-05 Sammensætninger og fremgangsmåder til at forårsage neurit-udvækst
AU2010219463A AU2010219463A1 (en) 2009-03-06 2010-03-05 Protein kinase A and/or casein kinase II for alleviating the inhibition of neurite outgrowth
EP10710598.3A EP2403515B1 (en) 2009-03-06 2010-03-05 Compositions and methods for causing neurite outgrowth.
CN201080009932.2A CN102341117B (zh) 2009-03-06 2010-03-05 用于缓解神经突生长抑制的蛋白激酶a和/或酪蛋白激酶ii
ES10710598.3T ES2493619T3 (es) 2009-03-06 2010-03-05 Composiciones y métodos para provocar el crecimiento de neuritas
HK12106832.5A HK1166017B (en) 2009-03-06 2010-03-05 Compositions and methods for causing neurite outgrowth
CA2750911A CA2750911A1 (en) 2009-03-06 2010-03-05 Compositions and methods
US13/254,081 US9089565B2 (en) 2009-03-06 2010-03-05 Compositions and methods for causing neurite outgrowth
JP2011552505A JP5670921B2 (ja) 2009-03-06 2010-03-05 神経突起伸長阻害の軽減のためのプロテインキナーゼa及び/又はカゼインキナーゼii

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
GBGB0903913.2A GB0903913D0 (en) 2009-03-06 2009-03-06 Compositions and methods
GB0903913.2 2009-03-06

Publications (2)

Publication Number Publication Date
WO2010100428A2 true WO2010100428A2 (en) 2010-09-10
WO2010100428A3 WO2010100428A3 (en) 2010-10-21

Family

ID=40600640

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/GB2010/000391 Ceased WO2010100428A2 (en) 2009-03-06 2010-03-05 Compositions and methods

Country Status (10)

Country Link
US (1) US9089565B2 (OSRAM)
EP (1) EP2403515B1 (OSRAM)
JP (1) JP5670921B2 (OSRAM)
CN (1) CN102341117B (OSRAM)
AU (1) AU2010219463A1 (OSRAM)
CA (1) CA2750911A1 (OSRAM)
DK (1) DK2403515T3 (OSRAM)
ES (1) ES2493619T3 (OSRAM)
GB (1) GB0903913D0 (OSRAM)
WO (1) WO2010100428A2 (OSRAM)

Family Cites Families (12)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP1066378A2 (en) 1998-04-03 2001-01-10 Curagen Corporation Lyst protein complexes and lyst interacting proteins
US6903187B1 (en) * 2000-07-21 2005-06-07 Allergan, Inc. Leucine-based motif and clostridial neurotoxins
WO2003027228A2 (en) * 2001-07-17 2003-04-03 Incyte Genomics, Inc. Receptors and membrane-associated proteins
JP2003093056A (ja) 2001-09-26 2003-04-02 Japan Science & Technology Corp p53のSer46をリン酸化する酵素
US20070025877A1 (en) 2003-06-03 2007-02-01 Hansen Christian M User interface for portable medical diagnostic apparatus and method of using the same
GB0314943D0 (en) * 2003-06-25 2003-07-30 Proteome Sciences Plc Screening methods
CN1849132A (zh) * 2003-09-10 2006-10-18 伦敦大学国王学院 调节神经元生长的化合物以及它们的用途
EP1695061A4 (en) * 2003-12-16 2008-02-20 Childrens Medical Center METHOD OF TREATING NEUROLOGICAL DISORDERS
US20050214288A1 (en) * 2004-03-26 2005-09-29 Human Genome Sciences, Inc. Antibodies against Nogo receptor
WO2006017673A2 (en) 2004-08-03 2006-02-16 Biogen Idec Ma Inc. Taj in neuronal function
US7414637B2 (en) * 2004-09-10 2008-08-19 Telmap Ltd. Placement of map labels
CA2684321A1 (en) 2007-03-21 2008-09-25 Effat Emamian Compositions comprising pkac fragments and uses thereof for inhibiting akt1, p70s6k or abl activity

Non-Patent Citations (46)

* Cited by examiner, † Cited by third party
Title
A. R. WALMSLEY; A. K. MIR; S. FRENTZEL: "Ectodomain shedding of human Nogo-66 receptor homologue-1 by zinc metalloproteinases", BIOCHEM BIOPHYS RES COMMUN, vol. 327, 2005, pages 112 - 116
A. R. WALMSLEY; G. MCCOMBIE; U. NEUMANN; D. MARCELLIN; R. HILLENBRAND; A. K. MIR; S. FRENTZEL: "Zinc metalloproteinase-mediated cleavage of the human Nogo-66 receptor", J CELL SCI, vol. 117, 2004, pages 4591 - 4602
ATWAL, J. K.; PINKSTON-GOSSE, J.; SYKEN, J.; STAWICKI, S.; WU, Y.; SHATZ, C.; TESSIER-LAVIGNE, M.: "PirB is a functional receptor for myelin inhibitors of axonal regeneration", SCIENCE, vol. 322, 2008, pages 967 - 970
B. S. BREGMAN; M. MCATEE; H. N. DAI; P. L. KUHN: "Neurotrophic factors increase axonal growth after spinal cord injury and transplantation in the adult rat", EXP NEUROL, vol. 148, 1997, pages 475 - 494
B. WANG; Z. XIAO; B. CHEN; J. HAN; Y. GAO; J. ZHANG; W. ZHAO; X. WANG; J. DAI: "Nogo-66 promotes the differentiation of neural progenitors into astroglial lineage cells through mTOR-STAT3 pathway", PLOS ONE, vol. 3, 2008, pages E1856
C. DINOCOURT; S. E. GALLAGHER; S. M. THOMPSON: "Injury-induced axonal sprouting in the hippocampus is initiated by activation of trkB receptors", EUR J NEUROSCI, vol. 24, 2006, pages 1857 - 1866
D. CAI; Y. SHEN; M. DE BELLARD; S. TANG; M. T. FILBIN: "Prior exposure to neurotrophins blocks inhibition of axonal regeneration by MAG and myelin via a cAMP- dependent mechanism", NEURON, vol. 22, 1999, pages 89 - 101
E. M. ALOY; O. WEINMANN; C. POT; H. KASPER; D. A. DODD; T. RULICKE; F. ROSSI; M. E. SCHWAB: "Synaptic destabilization by neuronal Nogo-A", BRAIN CELL BIOL, vol. 35, 2006, pages 137 - 156
E. M. SCHWIEBERT: "mechanical strain-induced Ca(2+) waves are propagated via ATP release and purinergic receptor activation", AM J PHYSIOL CELL PHYSIOL, vol. 279, 2000, pages C281 - 3
E. P. ZIMINA; A. FRITSCH; B. SCHERMER; A. Y. BAKULINA; M. BASHKUROV; T. BENZING; L. BRUCKNER-TUDERMAN: "Extracellular phosphorylation of collagen XVII by ecto-casein kinase 2 inhibits ectodomain shedding", J BIOL CHEM, vol. 282, 2007, pages 22737 - 22746
E. PASTRANA; M. T. MORENO-FLORES; J. AVILA; F. WANDOSELL; L. MINICHIELLO; J. DIAZ-NIDO: "BDNF production by olfactory ensheathing cells contributes to axonal regeneration of cultured adult CNS neurons", NEUROCHEM INT, vol. 50, 2007, pages 491 - 498
F. A. REDEGELD; C. C. CALDWELL; M. V. SITKOVSKY: "Ecto-protein kinases: ecto-domain phosphorylation as a novel target for pharmacological manipulation?", TRENDS PHARMACOL SCI, vol. 20, 1999, pages 453 - 459
F. WANG; Y. ZHU: "The interaction of Nogo-66 receptor with Nogo-p4 inhibits the neuronal differentiation of neural stem cells", NEUROSCIENCE, vol. 151, 2008, pages 74 - 81
GONZENBACH, R. R.; SCHWAB, M. E.: "Disinhibition of neurite growth to repair the injured adult CNS: focusing on Nogo", CELL MOL LIFE SCI, vol. 65, 2008, pages 161 - 176
H. Y. ZHU; H. F. GUO; H. L. HOU; Y. J. LIU; S. L. SHENG; J. N. ZHOU: "Increased expression of the Nogo receptor in the hippocampus and its relation to the neuropathology in Alzheimer's disease", HUM PATHOL, vol. 38, 2007, pages 426 - 434
J. H. PARK; D. A. GIMBEL; T. GRANDPRE; J. K. LEE; J. E. KIM; W. LI; D. H. LEE; S. M. STRITTMATTER: "Alzheimer precursor protein interaction with the Nogo-66 receptor reduces amyloid-beta plaque deposition", J NEUROSCI, vol. 26, 2006, pages 1386 - 1395
J. SAWYNOK; X. J. LIU: "Adenosine in the spinal cord and periphery: release and regulation of pain", PROG NEUROBIOL, vol. 69, 2003, pages 313 - 340
J. WALTER; A. CAPELL; A. Y. HUNG; H. LANGEN; M. SCHNOLZER; G. THINAKARAN; S. S. SISODIA; D. J. SELKOE; C. HAASS: "Ectodomain phosphorylation of beta-amyloid precursor protein at two distinct cellular locations", J BIOL CHEM, vol. 272, 1997, pages 1896 - 1903
J. WALTER; A. SCHINDZIELORZ; B. HARTUNG; C. HAASS: "Phosphorylation of the beta-amyloid precursor protein at the cell surface by ectocasein kinases 1 and 2", J BIOL CHEM, vol. 275, 2000, pages 23523 - 23529
K. VENKATESH; O. CHIVATAKARN; H. LEE; P. S. JOSHI; D. B. KANTOR; B. A. NEWMAN; R. MAGE; C. RADER; R. J. GIGER: "The Nogo-66 receptor homolog NgR2 is a sialic acid-dependent receptor selective for myelin-associated glycoprotein", J NEUROSCI, vol. 25, 2005, pages 808 - 822
KLUGE, A.; HAILER, N. P.; HORVATH, T. L.; BECHMANN, I.; NITSCH, R.: "Tracing of the entorhinal-hippocampal pathway in vitro", HIPPOCAMPUS, vol. 8, 1998, pages 57 - 68
L. B. JAKEMAN; P. WEI; Z. GUAN; B. T. STOKES: "Brain-derived neurotrophic factor stimulates hindlimb stepping and sprouting of cholinergic fibers after spinal cord injury", EXP NEUROL, vol. 154, 1998, pages 170 - 184
M. E. SCHWAB: "Repairing the injured spinal cord.", SCIENCE, vol. 295, 2002, pages 1029 - 1031
M. E. SCHWAB; P. CARONI: "Oligodendrocytes and CNS myelin are nonpermissive substrates for neurite growth and fibroblast spreading in vitro", J NEUROSCI, vol. 8, 1988, pages 2381 - 2393
M. ENCINAS; M. IGLESIAS; Y. LIU; H. WANG; A. MUHAISEN; V. CENA; C. GALLEGO; J. X. COMELLA: "Sequential treatment of SH-SY5Y cells with retinoic acid and brain-derived neurotrophic factor gives rise to fully differentiated, neurotrophic factor- dependent, human neuron-like cells", J NEUROCHEM, vol. 75, 2000, pages 991 - 1003
MCGEE; STRITTMATTER, TRENDS NEUROSCI, vol. 26, 2003, pages 193 - 198
MINGORANCE, A.; SOLE, M.; MUNETON, V.; MARTINEZ, A.; NIETO-SAMPEDRO, M.; SORIANO, E.; DEL RIO, J. A.: "Regeneration of lesioned entorhino-hippocampal axons in vitro by combined degradation of inhibitory proteoglycans and blockade of Nogo-66/NgR signaling", FASEB J, vol. 20, 2006, pages 491 - 493
N. R. MEHTA; P. H. LOPEZ; A. A. VYAS; R. L. SCHNAAR: "Gangliosides and Nogo receptors independently mediate myelin-associated glycoprotein inhibition of neurite outgrowth in different nerve cells", J BIOL CHEM, vol. 282, 2007, pages 27875 - 27886
O. CHIVATAKARN; S. KANEKO; Z. HE; M. TESSIER-LAVIGNE; R. J. GIGER: "The Nogo-66 receptor NgR is required only for the acute growth cone-collapsing but not the chronic growth-inhibitory actions of myelin inhibitors", J NEUROSCI, vol. 27, 2007, pages 7117 - 7124
P. LU; A. BLESCH; M. H. TUSZYNSKI: "Neurotrophism without neurotropism: BDNF promotes survival but not growth of lesioned corticospinal neurons", J COMP NEUROL, vol. 436, 2001, pages 456 - 470
P. R. BLANQUET: "Neurotrophin-induced activation of casein kinase 2 in rat hippocampal slices", NEUROSCIENCE, vol. 86, 1998, pages 739 - 749
PRANG, P.; DEL TURCO, D.; KAPFHAMMER, J. P: "Regeneration of entorhinal fibers in mouse slice cultures is age dependent and can be stimulated by NT-4, GDNF, and modulators of G-proteins and protein kinase C", EXP NEUROL, vol. 169, 2001, pages 135 - 147
R. H. FRYER; D. R. KAPLAN; L. F. KROMER: "Truncated trkB receptors on nonneuronal cells inhibit BDNF-induced neurite outgrowth in vitro", EXP NEUROL, vol. 148, 1997, pages 616 - 627
R. SALIE; J. D. STEEVES: "IGF-1 and BDNF promote chick bulbospinal neurite outgrowth in vitro", LNT J DEV NEUROSCI, vol. 23, 2005, pages 587 - 598
S. PAHLMAN; A. I. RUUSALA; L. ABRAHAMSSON; M. E. MATTSSON; T. ESSCHER: "Retinoic acid- induced differentiation of cultured human neuroblastoma cells: a comparison with phorbolester-induced differentiation", CELL DIFFER, vol. 14, 1984, pages 135 - 144
S. S. HANNILA; M. T. FILBIN: "The role of cyclic AMP signaling in promoting axonal regeneration after spinal cord injury", EXP NEUROL, vol. 209, 2008, pages 321 - 332
S. YAMAUCHI; Y. TOKITA; S. AONO; F. MATSUI; T. SHUO; H. ITO; K. KATO; K. KASAHARA; A. OOHIRA: "Phosphorylation of neuroglycan C, a brain-specific transmembrane chondroitin sulfate proteoglycan, and its localization in the lipid rafts", J BIOL CHEM, vol. 277, 2002, pages 20583 - 20590
SCHWAB ET AL., TRENDS MOL MED, vol. 12, 2006, pages 293 - 297
T. GRANDPRE; S. LI; S. M. STRITTMATTER: "Nogo-66 receptor antagonist peptide promotes axonal regeneration", NATURE, vol. 417, 2002, pages 547 - 551
T. OERTLE; M. E. VAN DER HAAR; C. E. BANDTLOW; A. ROBEVA; P. BURFEIND; A. BUSS; A. B. HUBER; M. SIMONEN; L. SCHNELL; C. BROSAMLE: "Nogo-A inhibits neurite outgrowth and cell spreading with three discrete regions", J NEUROSCI, vol. 23, 2003, pages 5393 - 5406
ULLOA ET AL., EMBO, vol. 12, 1993, pages 1633 - 1640
V. GIL; O. NICOLAS; A. MINGORANCE; J. M. URENA; B. L. TANG; T. HIRATA; J. SAEZ-VALERO; I. FERRER; E. SORIANO; J. A. DEL RIO: "Nogo-A expression in the human hippocampus in normal aging and in Alzheimer disease", J NEUROPATHOL EXP NEUROL, vol. 65, 2006, pages 433 - 444
W. A. BARTON; B. P. LIU; D. TZVETKOVA; P. D. JEFFREY; A. E. FOURNIER; D. SAH; R. CATE; S. M. STRITTMATTER; D. B. NIKOLOV: "Structure and axon outgrowth inhibitor binding of the Nogo-66 receptor and related proteins", EMBO J, vol. 22, 2003, pages 3291 - 3302
X. L. HE; J. F. BAZAN; G. MCDERMOTT; J. B. PARK; K. WANG; M. TESSIER-LAVIGNE; Z. HE; K. C. GARCIA: "Structure of the Nogo receptor ectodomain: a recognition module implicated in myelin inhibition", NEURON, vol. 38, 2003, pages 177 - 185
Y. JIN; FISCHER; A. TESSLER; J. D. HOULE: "Transplants of fibroblasts genetically modified to express BDNF promote axonal regeneration from supraspinal neurons foiiowing chronic spinal cord injury", EXP NEUROL, vol. 177, 2002, pages 265 - 275
Z. SU; L. CAO; Y. ZHU; X. LIU; Z. HUANG; A. HUANG; C. HE: "Nogo enhances the adhesion of olfactory ensheathing cells and inhibits their migration", J CELL SCI, vol. 120, 2007, pages 1877 - 1887

Also Published As

Publication number Publication date
DK2403515T3 (da) 2014-08-11
HK1166017A1 (en) 2012-10-19
ES2493619T3 (es) 2014-09-12
GB0903913D0 (en) 2009-04-22
US9089565B2 (en) 2015-07-28
US20110318326A1 (en) 2011-12-29
CN102341117B (zh) 2015-01-21
JP5670921B2 (ja) 2015-02-18
CA2750911A1 (en) 2010-09-10
EP2403515B1 (en) 2014-05-21
CN102341117A (zh) 2012-02-01
EP2403515A2 (en) 2012-01-11
WO2010100428A3 (en) 2010-10-21
JP2012519676A (ja) 2012-08-30
AU2010219463A1 (en) 2011-09-22

Similar Documents

Publication Publication Date Title
Yang et al. Ser1928 is a common site for Cav1. 2 phosphorylation by protein kinase C isoforms
Smyth et al. A 14‐3‐3 mode‐1 binding motif initiates gap junction internalization during acute cardiac ischemia
Castellani et al. Control of semaphorin signaling
Llorens et al. Developmental analysis of Lingo‐1/Lern1 protein expression in the mouse brain: interaction of its intracellular domain with Myt1l
Tanga et al. The PTN‐PTPRZ signal activates the AFAP1L2‐dependent PI3K‐AKT pathway for oligodendrocyte differentiation: targeted inactivation of PTPRZ activity in mice
US20070054848A1 (en) Composition and method for nerve regeneration
Murcia‐Belmonte et al. ERK1/2 signaling is essential for the chemoattraction exerted by human FGF2 and human anosmin‐1 on newborn rat and mouse OPCs via FGFR1
Li et al. Akt-phosphorylated mitogen-activated kinase-activating death domain protein (MADD) inhibits TRAIL-induced apoptosis by blocking Fas-associated death domain (FADD) association with death receptor 4
CN102100913B (zh) 脑损伤治疗的靶点和药物
Cheung et al. Inhibition of protein kinase C reduces ischemia‐induced tyrosine phosphorylation of the N‐methyl‐d‐aspartate receptor
Calderilla‐Barbosa et al. Phosphorylation of dystrophin Dp71d by Ca2+/calmodulin‐dependent protein kinase II modulates the Dp71d nuclear localization in PC12 cells
Denes et al. The neuroprotective peptide PACAP1-38 contributes to horizontal cell development in postnatal rat retina
Takei Phosphorylation of Nogo receptors suppresses Nogo signaling, allowing neurite regeneration
US9089565B2 (en) Compositions and methods for causing neurite outgrowth
US20170173053A1 (en) Method of Modulating Protein 14-3-3 Functionality By Facilitating or Inhibiting Phosphorylation
HK1166017B (en) Compositions and methods for causing neurite outgrowth
Hartmann Wnt signaling in cartilage development
Xu et al. AFAP120 regulates actin organization during neuronal differentiation
WO2006075172A2 (en) Methods for identifying compounds capable of modulating cftr/ck2 interaction and/or cftr phosphorylation by ck2
Scott The role of p75NTR in axonal regeneration and intraspinal plasticity following spinal deafferentation
Lee The Functions of Atypical PKC and the PAR Complex in Axon Growth Inhibition
Koraishy The crosstalk of Hgf and canonical Wnt signaling in kidney repair
Alabed The role of RhoA interacting proteins in the Nogo signalling pathway of axon outgrowth inhibition
WO2021029181A1 (ja) Clsp阻害物質による影響を受けないclsp誘導体及びclsp活性の増強/保護剤
Mao et al. Expression, function, and regulation of transcription factor MEF2 in neurons

Legal Events

Date Code Title Description
WWE Wipo information: entry into national phase

Ref document number: 201080009932.2

Country of ref document: CN

121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 10710598

Country of ref document: EP

Kind code of ref document: A2

WWE Wipo information: entry into national phase

Ref document number: 2010219463

Country of ref document: AU

WWE Wipo information: entry into national phase

Ref document number: 2750911

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 2011552505

Country of ref document: JP

WWE Wipo information: entry into national phase

Ref document number: 13254081

Country of ref document: US

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 6870/DELNP/2011

Country of ref document: IN

ENP Entry into the national phase

Ref document number: 2010219463

Country of ref document: AU

Date of ref document: 20100305

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 2010710598

Country of ref document: EP