WO2010056759A1 - Fibroblast growth factor-9 promotes hair follicle regeneration after wounding - Google Patents

Fibroblast growth factor-9 promotes hair follicle regeneration after wounding Download PDF

Info

Publication number
WO2010056759A1
WO2010056759A1 PCT/US2009/064049 US2009064049W WO2010056759A1 WO 2010056759 A1 WO2010056759 A1 WO 2010056759A1 US 2009064049 W US2009064049 W US 2009064049W WO 2010056759 A1 WO2010056759 A1 WO 2010056759A1
Authority
WO
WIPO (PCT)
Prior art keywords
subject
administering
another embodiment
disrupting
hair
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2009/064049
Other languages
English (en)
French (fr)
Inventor
George Cotsarelis
Ohsang Kwon
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
University of Pennsylvania Penn
Original Assignee
University of Pennsylvania Penn
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to BRPI0915262-8A priority Critical patent/BRPI0915262B1/pt
Application filed by University of Pennsylvania Penn filed Critical University of Pennsylvania Penn
Priority to AU2009314147A priority patent/AU2009314147B2/en
Priority to EP09826682.8A priority patent/EP2361119B1/en
Priority to KR1020177005200A priority patent/KR20170024148A/ko
Priority to CA2743610A priority patent/CA2743610C/en
Priority to KR1020117013171A priority patent/KR101711995B1/ko
Priority to JP2011536441A priority patent/JP5723780B2/ja
Priority to US13/129,100 priority patent/US8871711B2/en
Publication of WO2010056759A1 publication Critical patent/WO2010056759A1/en
Priority to IL212858A priority patent/IL212858A/en
Anticipated expiration legal-status Critical
Priority to US14/505,970 priority patent/US20150216934A1/en
Priority to IL249309A priority patent/IL249309A0/en
Priority to US16/004,277 priority patent/US20180280475A1/en
Priority to US16/260,034 priority patent/US20200197488A1/en
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/18Growth factors; Growth regulators
    • A61K38/1825Fibroblast growth factor [FGF]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/19Cytokines; Lymphokines; Interferons
    • A61K38/20Interleukins [IL]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/18Growth factors; Growth regulators
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K45/00Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
    • A61K45/06Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K8/00Cosmetics or similar toiletry preparations
    • A61K8/18Cosmetics or similar toiletry preparations characterised by the composition
    • A61K8/30Cosmetics or similar toiletry preparations characterised by the composition containing organic compounds
    • A61K8/64Proteins; Peptides; Derivatives or degradation products thereof
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61MDEVICES FOR INTRODUCING MEDIA INTO, OR ONTO, THE BODY; DEVICES FOR TRANSDUCING BODY MEDIA OR FOR TAKING MEDIA FROM THE BODY; DEVICES FOR PRODUCING OR ENDING SLEEP OR STUPOR
    • A61M37/00Other apparatus for introducing media into the body; Percutany, i.e. introducing medicines into the body by diffusion through the skin
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61NELECTROTHERAPY; MAGNETOTHERAPY; RADIATION THERAPY; ULTRASOUND THERAPY
    • A61N5/00Radiation therapy
    • A61N5/10X-ray therapy; Gamma-ray therapy; Particle-irradiation therapy
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00Drugs for dermatological disorders
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00Drugs for dermatological disorders
    • A61P17/14Drugs for dermatological disorders for baldness or alopecia
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61QSPECIFIC USE OF COSMETICS OR SIMILAR TOILETRY PREPARATIONS
    • A61Q7/00Preparations for affecting hair growth
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61MDEVICES FOR INTRODUCING MEDIA INTO, OR ONTO, THE BODY; DEVICES FOR TRANSDUCING BODY MEDIA OR FOR TAKING MEDIA FROM THE BODY; DEVICES FOR PRODUCING OR ENDING SLEEP OR STUPOR
    • A61M37/00Other apparatus for introducing media into the body; Percutany, i.e. introducing medicines into the body by diffusion through the skin
    • A61M2037/0007Other apparatus for introducing media into the body; Percutany, i.e. introducing medicines into the body by diffusion through the skin having means for enhancing the permeation of substances through the epidermis, e.g. using suction or depression, electric or magnetic fields, sound waves or chemical agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61NELECTROTHERAPY; MAGNETOTHERAPY; RADIATION THERAPY; ULTRASOUND THERAPY
    • A61N5/00Radiation therapy
    • A61N5/10X-ray therapy; Gamma-ray therapy; Particle-irradiation therapy
    • A61N2005/1092Details
    • A61N2005/1098Enhancing the effect of the particle by an injected agent or implanted device

Definitions

  • the invention relates to pharmaceutical compositions and methods for treating hair loss and regenerating hair follicles. Specifically, the invention relates to fibroblast growth factor-9 polypeptides and administering a fibroblast growth factor-9 polypeptide for treating hair loss or regenerating hair follicles.
  • Follicular neogenesis is defined as the generation of new hair follicles (HF) after birth. Humans are born with a full complement of HF, which can change in size and growth characteristics as in early baldness or can ultimately degenerate and disappear as in late stages of baldness or in permanent scarring (cicatricial) alopecias. Therefore, the generation of new HF is desirable in the treatment of common baldness as well as less common hair loss conditions, such as discoid lupus erythematosis, congenital hypotrichosis, lichen planopilaris and other scarring alopecias.
  • the present invention provides methods of treating hair loss, treating, inhibiting, or suppressing a degenerative skin disorder, and treating androgenetic alopecia (AGA) in a subject and generating new hair follicles (HF) and increasing the size of existing HF, comprising epidermal disruption or administration of wnt, and administration of a fibroblast growth factor-9 polypeptide or another compound that upregulates sonic hedgehog gene signaling.
  • AGA androgenetic alopecia
  • HF hair follicles
  • the present invention provides a method of treating hair loss in a subject comprising the steps of (a) disrupting the epidermis in the region of said hair loss in said subject and (b) administering a composition comprising a fibroblast growth factor-9 polypeptide to said subject.
  • the hair loss is due to androgenetic alopecia (AGA).
  • AGA is male pattern baldness.
  • the AGA is female pattern baldness.
  • the hair loss is the result of a skin injury.
  • the hair loss is in the scalp or eyebrow of said subject.
  • the hair loss is in scarred skin tissue of said subject.
  • the step of administering is performed 3-12 days after said step of disrupting.
  • the step of disrupting is performed by exposing the region of said hair loss to a mechanical, chemical, or optical stimulus.
  • the optical stimulus is radiation.
  • the administering step is via topical administration.
  • the administering step is via subepidermal administration.
  • the present invention provides a method for generating a hair follicle in the dermis of a subject with hair loss comprising the steps of (a) disrupting the epidermis in the region of said hair loss in said subject and (b) administering a composition comprising a fibroblast growth factor-9 polypeptide to said subject.
  • the present invention provides a method for increasing the size of a hair follicle in the dermis of a subject with hair loss comprising the steps of (a) disrupting the epidermis in the region of said hair loss in said subject and (b) administering a composition comprising a fibroblast growth factor-9 polypeptide to said subject.
  • the present invention provides a method for increasing hair follicle formation in the skin of a subject with hair loss comprising the steps of (a) disrupting the epidermis in the region of said hair loss in said subject and (b) administering a composition comprising a fibroblast growth factor-9 polypeptide to said subject.
  • the present invention provides a method for treating, inhibiting, or suppressing a degenerative skin disorder comprising the steps of (a) disrupting the epidermis in the region of said degenerative skin disorder in said subject and (b) administering a composition comprising a fibroblast growth factor-9 polypeptide to said subject.
  • the present invention provides a method for treating an androgenetic alopecia (AGA) in a scalp of a subject comprising the steps of (a) disrupting the epidermis in the region of said AGA in said subject and (b) administering a composition comprising a fibroblast growth factor-9 polypeptide to said subject.
  • AGA androgenetic alopecia
  • the present invention provides a method of treating hair loss in a subject comprising the step administering a composition comprising a fibroblast growth factor-9 polypeptide and a wnt polypeptide to said subject.
  • the present invention provides a method for generating a hair follicle in the dermis of a subject comprising the step of administering a composition comprising a fibroblast growth factor-9 polypeptide and a wnt polypeptide to said subject.
  • the present invention provides a method for increasing the size of a hair follicle in the dermis of a subject comprising the step of administering a composition comprising a fibroblast growth factor-9 polypeptide and a wnt polypeptide to said subject.
  • the present invention provides a method for increasing hair follicle formation in the skin of a subject comprising the step of administering a composition comprising a fibroblast growth factor-9 polypeptide and a wnt polypeptide to said subject.
  • the present invention provides a method for treating, inhibiting, or suppressing a degenerative skin disorder comprising the step of administering a composition comprising a fibroblast growth factor-9 polypeptide and a wnt polypeptide to said subject.
  • the present invention provides a method for treating an androgenetic alopecia (AGA) in a scalp of a subject comprising the step of administering a composition comprising a fibroblast growth factor-9 polypeptide and a wnt polypeptide to said subject.
  • AGA androgenetic alopecia
  • the present invention provides a method of treating hair loss in a subject comprising the steps of (a) disrupting the epidermis in the region of said hair loss in said subject and (b) administering a composition comprising a compound or factor that upregulates sonic hedgehog (SHH) to said subject.
  • the present invention provides a method for generating a hair follicle in the dermis of a subject comprising the steps of (a) disrupting the epidermis in the region of said hair loss in said subject and (b) administering a composition comprising a compound or factor that upregulates sonic hedgehog (SHH) to said subject.
  • the present invention provides a method for increasing the size of a hair follicle in the dermis of a subject comprising the steps of (a) disrupting the epidermis in the region of said hair loss in said subject and (b) administering a composition comprising a compound or factor that upregulates sonic hedgehog (SHH) to said subject.
  • the present invention provides a method for increasing hair follicle formation in the skin of a subject comprising the steps of (a) disrupting the epidermis in the region of said hair loss in said subject and (b) administering a composition comprising a compound or factor that upregulates sonic hedgehog (SHH) to said subject.
  • the present invention provides a method for treating, inhibiting, or suppressing a degenerative skin disorder comprising the steps of (a) disrupting the epidermis in the region of said hair loss in said subject and (b) administering a composition comprising a compound or factor that upregulates sonic hedgehog (SHH) to said subject.
  • the present invention provides a method for treating an androgenetic alopecia (AGA) in a scalp of a subject comprising the steps of (a) disrupting the epidermis in the region of said hair loss in said subject and (b) administering a composition comprising a compound or factor that upregulates sonic hedgehog (SHH) to said subject.
  • AGA androgenetic alopecia
  • FIG. 1 FGF9 is expressed during inductive period of hair follicle regeneration at Day 1 after scab detachment (SD). The ratio of FGF9 mRNA compared to control mRNA expression q-PCR of FGF9 mRNA expression in regenerated epidermis is presented.
  • Figure 2 ⁇ TCR immunostaining of regenerated epidermis (SD7, wholemount) (x200) and FGF9 immunostaining of SDl sample (frozen section) (x400).
  • Figure 3. ⁇ TCR & FGF9 immunostaining of regenerated epidermis for SDl sample.
  • Figure 4. ⁇ TCR & FGF9 immunostaining of E14 embryonic skin.
  • Figure 5. Specificity of anti-FGF9 neutralization antibody for E14.5 mouse embryonal whole lysate (lanes 1 and 2) and for recombinant hFGF9 (+).
  • Treatment schedule in which 50 ⁇ l of 10 ⁇ g/ml anti-FGF9 or IgG2a isotype control were injected subepidermally on scab detachment day (SD)1-SD4, and tissue was sampled at SD5.
  • Figure 7 Hair follicle number in anti-FGF9-treated mice vs controls at various stages of hair follicle development, as described in Paus R, et al. J Invest Dermatol 1999).
  • Figure 8. Model showing how hair germ counting was conducted per mm 2 at 3 different fields per each sample.
  • Figure 9 rhFGF9 treatment for three days in embryonic skin explant culture (E13.5).
  • Figure 10 Immunohistochemical staining showing alkaline phosphatase staining of the dermis in control and rhFGF9 (10, 20, 40 ng/ml)-treated embryonic skin explants.
  • FIG. Anti-FGF9 neutralizing antibody treatment for three days in embryonic skin explant culture (E13.5). Cultures were treated with 10, 20, or 40 ⁇ g/mL of anti-FGF9 neutralizing antibody or control for three days, and hair germ number/mm was evaluated as described in Figure 8.
  • FIG. 12 Immunohistochemical staining showing K17 staining of the epidermis in control and anti-FGF9 (10, 20, 40 ⁇ g/ml)-treated skin explants.
  • Figure 13 Immunohistochemical staining showing alkaline phosphatase staining of the dermis in control and anti-FGF9 (10, 20, 40 ⁇ g/ml)-treated embryonic skin explants.
  • Figure 14 Effect of 24 h treatment using rhFGF9 (10, 20, 40 ng/ml) on markers of embryonic hair follicle development sonic hedgehog (Shh), Ptchl, and Ptch2 by qPCR.
  • Figure 15. Effect of 24 h treatment using rhFGF9 (10, 20, 40 ng/ml) on markers of embryonic hair follicle development GIi 1 and Gli2 by qPCR.
  • Fgf9 is expressed during HFN initiation and is important to HFN.
  • A Fgf9 is highly expressed in regenerated epidermis prior to hair follicle formation at Day 1 and 3 after reepithelization with scab detachment (SD) and decreased to basal level at Day 5. The ratio of Fgf9 mRNA expression in regenerated epidermis was compared to the level of unwounded epidermis, Day 0. *: P ⁇ 0.05, **: P ⁇ 0.01, mean ⁇ standard deviation.
  • B Effect of FGF9 neutralization on HFNafter wounding in 3-week old mice.
  • FGF9 is expressed by activated DETC (A) Double immunostaining for FGF9 and ⁇ TCR. Fgf9expression in repopulated ⁇ TCR-positive DETCs after reepithelization. Dot line, basement membrane. Scale bar, 50 ⁇ m.(B) Fgf9 gene expression is highly upregulated in the isolated DETCs after activationwith mIL-2 and anti-CD3. [0043] Figure 18.
  • FIG. 21 FGF9 expression in DETCs.
  • A FGF9 is highly expressed in suprabasal dendritic cell.
  • Figure 22 FGF9 expression in FGF ⁇ ox/flox ;lck-cre mice compared to FGF ⁇ ⁇ 0X control.
  • the invention relates to pharmaceutical compositions and methods for treating hair loss and regenerating hair follicles. Specifically, the invention relates to fibroblast growth factor-9 polypeptides and administering a fibroblast growth factor-9 polypeptide for treating hair loss or regenerating hair follicles.
  • the present invention provides methods of treating hair loss, treating, inhibiting, or suppressing a degenerative skin disorder, and treating androgenetic alopecia (AGA) in a subject and generating new hair follicles (HF) and increasing the size of existing HF, comprising epidermal disruption or administration of wnt, and administration of a fibroblast growth factor-9 polypeptide or another compound that upregulates sonic hedgehog gene signaling.
  • AGA androgenetic alopecia
  • the present invention provides methods of treating hair loss, methods for generating a hair follicle, methods for increasing the size of a hair follicle, methods for treating an androgenetic alopecia (AGA), methods for arresting alopecia, methods of reversing alopecia, and methods of depilation comprising administering a composition comprising a neutralizing fibroblast growth factor-9 antibody to a subject.
  • AGA androgenetic alopecia
  • a composition or method of the present invention is utilized on human skin.
  • the composition or method is utilized on an area of unwanted hair growth.
  • the area is the face.
  • the area is the bikini area.
  • the area is the legs.
  • the area is the arms.
  • the area is the chest.
  • the methods of the present invention include contacting a subject with an inhibitor of FGF9, SHH, WNT, or other compositions for use in the present invention.
  • An "inhibitor" utilized in methods and compositions of the present invention is, in another embodiment, an antibody that binds the protein or biological factor that is the target of the inhibitor.
  • the inhibitor is a pharmacologic inhibitor.
  • the inhibitor is any other type of inhibitor known in the art. Each possibility represents a separate embodiment of the present invention.
  • the present invention provides a method of treating hair loss comprising the step of administering a composition comprising a fibroblast growth factor-9 polypeptide to a subject.
  • the present invention provides a method of treating hair loss in a subject comprising the steps of (a) disrupting the epidermis in the region of said hair loss in said subject and (b) administering a composition comprising a fibroblast growth factor-9 polypeptide to said subject.
  • the present invention provides a method of treating hair loss in a subject comprising the step administering a composition comprising a fibroblast growth factor-9 polypeptide and a wnt polypeptide to said subject.
  • the present invention provides a method of treating hair loss in a subject comprising the steps of (a) disrupting the epidermis in the region of said hair loss in said subject and (b) administering a composition comprising a compound or factor that upregulates sonic hedgehog (SHH) to said subject.
  • SHH sonic hedgehog
  • the present invention provides a method for treating an androgenetic alopecia (AGA) in a scalp of a subject comprising the steps of (a) disrupting the epidermis in the region of said AGA in said subject and (b) administering a composition comprising a fibroblast growth factor-9 polypeptide to said subject.
  • the present invention provides a method for treating an androgenetic alopecia (AGA) in a scalp of a subject comprising the step of administering a composition comprising a fibroblast growth factor-9 polypeptide and a wnt polypeptide to said subject.
  • the present invention provides a method for treating an androgenetic alopecia (AGA) in a scalp of a subject comprising the steps of (a) disrupting the epidermis in the region of said hair loss in said subject and (b) administering a composition comprising a compound or factor that upregulates sonic hedgehog (SHH) to said subject.
  • AGA androgenetic alopecia
  • SHH sonic hedgehog
  • the present invention provides a method for generating a hair follicle in the dermis of a subject with hair loss comprising the steps of (a) disrupting the epidermis in the region of said hair loss in said subject and (b) administering a composition comprising a fibroblast growth factor-9 polypeptide to said subject.
  • the present invention provides a method for generating a hair follicle in the dermis of a subject comprising the step of administering a composition comprising a fibroblast growth factor-9 polypeptide and a wnt polypeptide to said subject.
  • the present invention provides a method for generating a hair follicle in the dermis of a subject comprising the steps of (a) disrupting the epidermis in the region of said hair loss in said subject and (b) administering a composition comprising a compound or factor that upregulates sonic hedgehog (SHH) to said subject.
  • SHH sonic hedgehog
  • the present invention provides a method for increasing the size of a hair follicle in the dermis of a subject with hair loss comprising the steps of (a) disrupting the epidermis in the region of said hair loss in said subject and (b) administering a composition comprising a fibroblast growth factor-9 polypeptide to said subject.
  • the present invention provides a method for increasing the size of a hair follicle in the dermis of a subject comprising the step of administering a composition comprising a fibroblast growth factor-9 polypeptide and a wnt polypeptide to said subject.
  • the present invention provides a method for increasing the size of a hair follicle in the dermis of a subject comprising the steps of (a) disrupting the epidermis in the region of said hair loss in said subject and (b) administering a composition comprising a compound or factor that upregulates sonic hedgehog (SHH) to said subject.
  • SHH sonic hedgehog
  • the present invention provides a method for increasing hair follicle formation in the skin of a subject with hair loss comprising the steps of (a) disrupting the epidermis in the region of said hair loss in said subject and (b) administering a composition comprising a fibroblast growth factor-9 polypeptide to said subject.
  • the present invention provides a method for increasing hair follicle formation in the skin of a subject comprising the step of administering a composition comprising a fibroblast growth factor-9 polypeptide and a wnt polypeptide to said subject.
  • the present invention provides a method for increasing hair follicle formation in the skin of a subject comprising the steps of (a) disrupting the epidermis in the region of said hair loss in said subject and (b) administering a composition comprising a compound or factor that upregulates sonic hedgehog (SHH) to said subject.
  • the present invention provides a method for treating, inhibiting, or suppressing a degenerative skin disorder comprising the steps of (a) disrupting the epidermis in the region of said degenerative skin disorder in said subject and (b) administering a composition comprising a fibroblast growth factor-9 polypeptide to said subject.
  • the present invention provides a method for treating, inhibiting, or suppressing a degenerative skin disorder comprising the step of administering a composition comprising a fibroblast growth factor-9 polypeptide and a wnt polypeptide to said subject.
  • the present invention provides a method for treating, inhibiting, or suppressing a degenerative skin disorder comprising the steps of (a) disrupting the epidermis in the region of said hair loss in said subject and (b) administering a composition comprising a compound or factor that upregulates sonic hedgehog (SHH) to said subject.
  • the methods of the present invention treat, inhibit or suppress a degenerative skin disorder.
  • a degenerative skin disorder is Hyperkeratosis, hyperpigmentation, depigmentation, atrophy, or a combination thereof.
  • a degenerative skin disorder is calcinosis; circumscripta; cutis; Colloid milium; skin degeneration; Senile dermatosis NOS; or Subcutaneous calcification.
  • a degenerative skin disorder is granuloma annulare.
  • the degenerative skin disorder is localized granuloma annulare, which in one embodiment, is the most common form of granuloma annulare and in another embodiment, is characterized by the presence of small, firm red or yellow colored bumps (nodules or papules) that appear arranged in a ring on the skin.
  • the sizes of the lesions range from one to five centimeters.
  • the most commonly affected sites include the feet, hands, and fingers.
  • the degenerative skin disorder is generalized or disseminated, linear, perforating, or subcutaneous granuloma annulare.
  • the lesions associated with granuloma annulare may disappear without treatment (spontaneous remission) and reappear.
  • the methods of the present invention are suitable for the prophylaxis and treatment of dryness, roughness of the skin, the formation of dry lines, reduced rehydration by sebaceous glands and an increased susceptibility to mechanical stress (tendency to crack), for the treatment of photodermatoses, the symptoms of senile xerosis, photoaging and other degenerative conditions which are associated with a decomposition of the connective tissue (collagen and elastin fibres and also glucosaminoglycans/hyaluronane) of the skin.
  • Photoaging denotes the wrinkling, dryness and decreasing elasticity of the skin brought about by light and in particular UV radiation.
  • compositions according to the invention are the treatment and prevention of age- and/or UV-induced collagen degeneration and also the decomposition of elastin and glycosaminoglycans; of degenerative skin conditions such as loss of elasticity and also atrophy of the epidermal and dermal cell layers, of constituents of the connective tissue, of rete pegs and capillary vessels) and/or the skin adnexa; of environmentally- triggered negative changes in the skin and the skin adnexa, e.g.
  • the present invention provides a method of treating hair loss, generating a hair follicle, in creasing the size of a hair follicle, increasing hair follicle formation, treating, inhibiting or suppressing a degenerative skin disorder, treating androgenetic alopecia (AGA), comprising any combination of the following steps: (a) disrupting the epidermis in the region of said hair loss in said subject; (b) administering a fibroblast growth factor-9 polypeptide; (c) administering a wnt polypeptide; and (d) administering a compound or factor that upregulates Sonic Hedgehog (SHH), Patched-1 (Ptchl), Patched-2 (Ptch2), GIi 1, Gli2, or a combination thereof to said subject.
  • SHH Sonic Hedgehog
  • Ptchl Patched-1
  • Ptch2 Patched-2
  • the present invention provides a method of depilation comprising the step of administering a composition comprising a neutralizing fibroblast growth factor-9 antibody to a subject.
  • the antibody is administered at a concentration of 10 ⁇ g/mL.
  • the depilation is in the legs, arms, underarms, pubic area, back, face, nose, or ears of said subject.
  • the method further comprises the step of disrupting the epidermis in the region of said depilation prior to said administering step.
  • the step of contacting is performed 3-12 days after said step of disrupting.
  • the step of disrupting is performed by exposing the region of said hair loss to a mechanical, chemical, or optical stimulus.
  • the optical stimulus is radiation.
  • the administering step is via topical administration. In another embodiment, the administering step is via subcutaneous administration.
  • the present invention provides a method of reversing alopecia comprising the step of administering a composition comprising a fibroblast growth factor-9 polypeptide to a bald or balding subject.
  • the present invention provides a method of arresting alopecia comprising the step of administering a composition comprising a fibroblast growth factor-9 polypeptide to a bald or balding subject.
  • the present invention provides a method of treating a wound in a subject comprising the step of administering a composition comprising a fibroblast growth factor-9 polypeptide to a bald or balding subject.
  • the present invention provides a method of treating an injury in a subject comprising the step of administering a composition comprising a fibroblast growth factor-9 polypeptide to a bald or balding subject.
  • the methods of the present invention comprise the step of administering a composition comprising a fibroblast growth factor-9 polypeptide, alone or in composition with one or more additional compounds.
  • FGF9 refers to Fgf-9, FGF-9, Fibroblast growth factor 9, GAF, glia activating factor, Glia-activating factor precursor, or HBGF-9.
  • the FGF9 protein of the methods of the present invention has the sequence: IFPNGTIQGTRKDHSRFGILEFISIA VGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECV FREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRP
  • the FGF9 protein has a sequence as set forth in GenBank Accession No. P31371, BAF83481, NP_002001, CAC17692, EAX08316, AAI03980, AAI03979, AAT74624 or AAH69692.
  • the FGF9 protein is encoded by a genomic nucleic acid molecule having a sequence as set forth in GenBank Accession No. AL139378.15, AY682094.1, or CH471075.1 or encoded by an mRNA molecule having a sequence as set forth in GenBank Accession No.
  • AK290792.1, BC069692.1, BC103978.1, BC103979.1, CR746503.1, or D14838.1 In another embodiment, a biologically active fragment of an FGF9 protein is utilized in a method of the present invention. In another embodiment, a homolog of an FGF9 protein is utilized in a method of the present invention. Each possibility represents a separate embodiment of the present invention. [0081] In one embodiment, administration of recombinant human FGF9 increased levels of sonic hedgehog (SHH) gene expression (Figure 14). Shh
  • the methods of the present invention comprise the step of administering a composition comprising a sonic hedgehog (SHH) polypeptide, alone or in composition with one or more additional compounds.
  • the methods of the present invention comprise the step of administering a compound or factor that increases
  • SHH expression.
  • SHH refers to TPT; HHGl; HLP3; HPE3; SMMCI;
  • the SHH protein of the methods of the present invention has the sequence:
  • the SHH protein has a sequence as set forth in GenBank Accession No. BAA34689.1; AAB67604.1;
  • the SHH protein is encoded by a nucleic acid having a sequence as set forth in GenBank Accession No. AB020410.1; AC002484.1 ; AC078834.5; AY422195.1;
  • SHH binds to the patched (PTC) receptor, which functions in association with smoothened (SMO), to activate the transcription of target genes. In the absence of SHH, PTC represses the constitutive signaling activity of SMO. In another embodiment, SHH also regulates the gli oncogene.
  • PTC patched
  • SMO smoothened
  • SHH is an intercellular signal essential for a variety of patterning events during development: signal produced by the notochord that induces ventral cell fate in the neural tube and somites, and the polarizing signal for patterning of the anterior-posterior axis of the developing limb bud.
  • SHH displays both floor plate- and motor neuron-inducing activity.
  • administering increased levels of Patched homolog 1 (Drosophila), (PTCHl; Figure 14), which in one embodiment, is a human gene.
  • Ptchl encodes a member of the patched gene family.
  • Ptchl is the receptor for sonic hedgehog (SHH), which in one embodiment, is a secreted molecule implicated in the formation of embryonic structures and in tumorigenesis.
  • SHH sonic hedgehog
  • Ptchl functions as a tumor suppressor.
  • mutations of Ptchl have been associated with syndrome, esophageal squamous cell carcinoma, trichoepitheliomas, transitional cell carcinomas of the bladder, as well as holoprosencephaly.
  • alternative splicing of Ptchl results in multiple transcript variants encoding different isoforms.
  • the methods of the present invention comprise the step of administering a composition comprising a Patched- 1 (PTCHl) polypeptide, alone or in composition with one or more additional compounds.
  • the methods of the present invention comprise the step of administering a compound or factor that increases PTCHl expression.
  • PTCHl refers to PTC; BCNS; HPE7; PTCl; PTCH; NBCCS; PTCHI l; FLJ26746; or FLJ42602.
  • the PTCHl protein of the methods of the present invention has the sequence:
  • the PTCHl protein has a sequence as set forth in GenBank Accession No. CAH73817.1; CAH73818.1 ; CAH73819.1; AAR21238.1; AAR21239.1; AAR21240.1; EAW92631.1; EAW92632.1; BAD74184.1; BAD74185.1; BAD74186.1; BAD74187.1; BAD74188.1; BAD92732.1; BAF47711.1; BAE45300.1; BAE45302.1; BAE45304.1; BAF47712.1; BAC85893.1; AAH43542.1; AAC50496.1; AAC50550.1; or AAI52920.1.
  • the PTCHl protein is encoded by a nucleic acid having a sequence as set forth in GenBank Accession No. AL161729.27; AY395758.1; AY395768.1; AY395772.1; CH471174.1; AB189436.1; AB189437.1; AB189438.1; AB189439.1; AB189440.1; AB209495.1; AB212827.1; AB212828.1; AB214500.1; AB233422.1; AB233424.1; AB239329.1; AI358880.1; AI494442.1; AK124593.1; AK130256.1; BC043542.1; BF195352.1; BM974119.1; BX117041.1; CR744004.1; DB093644.1; U43148.1; U59464.1; or BC152919.1.
  • a biologically active fragment of an PTCHl protein is utilized in a method of the present invention.
  • a homolog of an PTCHl protein is utilized in a method of the present invention.
  • administration of recombinant human FGF9 increased levels of Patched homolog 2 (Drosophila), (PTCH; Figure 14) PTCH2
  • the methods of the present invention comprise the step of administering a composition comprising a Patched-2 (PTCH2) polypeptide, alone or in composition with one or more additional compounds.
  • the methods of the present invention comprise the step of administering a compound or factor that increases PTCH2 expression.
  • ptch2 encodes a member of the patched gene family.
  • the patched protein is the receptor for sonic hedgehog, a secreted molecule implicated in the formation of embryonic structures and in tumorigenesis.
  • ptch2 is mutated in a medulloblastoma and in a basal cell carcinoma, suggesting that it plays a role in the development of some tumors.
  • Alternative transcript variants have been described, but their biological function has not been determined.
  • the PTCH2 polypeptide for use in the methods of the present invention has the sequence:
  • FDFIVRYFFAALTVLTLLGLLHGLVLLPVLLSILGPPPEVIQMYKESPEILSPPAPQ GGGLRVGSLQVNISYWKELLWCQDLRPEEI (GenBank Accession No: Q5JR97; SEQ ID No: 4).
  • the PTCH2 protein has a sequence as set forth in GenBank Accession No. CAL23127.1; CAI13000.1; AAR05447.1; EAX07017.1; AAD25953.1; AAC79847.1; AAD17260.1 ; AAQ88919.1; AAQ89375.1; or AAI52912.1.
  • the PTCH2 protein is encoded by a nucleic acid having a sequence as set forth in GenBank Accession No. AL136380.22; AL592166.16; AY438664.1; CH471059.2; AF087651.1; AF091501.1; AF119569.1; AK307168.1; AY358555.1; AY359016.1; or BC 152911.1.
  • a biologically active fragment of a PTCH2 protein is utilized in a method of the present invention.
  • a homolog of a PTCH2 protein is utilized in a method of the present invention. Each possibility represents a separate embodiment of the present invention.
  • the methods of the present invention comprise the step of administering a composition comprising a glioma-associated oncogene homolog 1 (zinc finger protein) (GLIl) polypeptide, alone or in a composition with one or more additional compounds.
  • glil encodes a protein which is a member of the Kruppel family of zinc finger proteins.
  • the methods of the present invention comprise the step of administering a compound or factor that increases GLIl expression.
  • the GLIl polypeptide for use in the methods of the present invention has the sequence: [0092] MFNSMTPPPISSYGEPCCLRPLPSQGAPSVGTEGLSGPPFCHQANLMSGPHSYGP ARETNSCTEGPLFSSPRSAVKLTKKRALSISPLSDASLDLQTVIRTSPSSLV AFINSRCTSP GGSYGHLSIGTMSPSLGFP AQMNHQKGPSPSFGVQPCGPHDSARGGMIPHPQSRGPFPT CQLKSELDMLVGKCREEPLEGDMSSPNSTGIQDPLLGMLDGREDLEREEKREPESVYET DCRWDGCSQEFDSQEQLVHHINSEHIHGERKEFVCHWGGCSRELRPFKAQYMLVVHM RRHTGEKPHKCTFEGCRKSYSRLENLKTHLRSHTGEKP YMCEHEGCSKAFSNASDRAK
  • the GLIl protein is encoded by a nucleic acid having a sequence as set forth in GenBank Accession No. AC022506.38; AF316573.1; CH471054.1 ; AK297899.1; BC013000.2; or X07384.1.
  • a biologically active fragment of a GLIl protein is utilized in a method of the present invention.
  • a homolog of a GLIl protein is utilized in a method of the present invention. Each possibility represents a separate embodiment of the present invention.
  • the methods of the present invention comprise the step of administering a composition comprising a glioma-associated oncogene homolog 2 (zinc finger protein) (GLI2) polypeptide, alone or in a composition with one or more additional compounds.
  • the methods of the present invention comprise the step of administering a compound or factor that increases GLO expression.
  • GLO may be referred to as HPE9; THPl; or THP2.
  • gU2 encodes a protein which belongs to the C2H2-type zinc finger protein subclass of the GIi family. Members of this subclass are characterized as transcription factors which bind DNA through zinc finger motifs. These motifs contain conserved H-C links.
  • GLO polypeptide for use in the methods of the present invention has the sequence:
  • NSLTLPSIPAGISNMAVGDMSSMLTSLAEESKFLNMMT (GenBank Accession No: P10070; SEQ ID No: 6).
  • the GLO protein has a sequence as set forth in GenBank Accession No. AAA35898.1; BAA25665.1; BAA25666.1; BAA25667.1; BAA25668.1; BAD92591.1; BAG61875.1; AAS72889.1; AAS72890.1; AAS72891.1; AAIl 1411.1; BAA03568.1; BAA03569.1; AAY58315.1; AAY58316.1; AAY58317.1; or AAY87165.1.
  • the GLI2 protein is encoded by a nucleic acid having a sequence as set forth in GenBank Accession No. AC016764.8; AC017033.5 (60664..181887); M20672.1; M20673.1; AB007295.1; AB007296.1; AB007297.1; AB007298.1; AB209354.1; AJ707583.1; AK300071.1; AY493737.1; AY493738.1; AY493739.1; BC111410.1; D14827.1; D14828.1; DQ004396.1; DQ004397.1; DQ004398.1; or DQ086814.1.
  • a biologically active fragment of a GLO protein is utilized in a method of the present invention.
  • a homolog of a GLO protein is utilized in a method of the present invention.
  • the methods of the present invention comprise the step of administering a composition comprising a Wnt polypeptide.
  • the Wnt polypeptide of methods and compositions of the present invention has, in another embodiment, the sequence: MNRKARRCLGHLFLSLGMVYLRiGGFSSvv ALGASIICNKIPGLAPRQRAICQSRPDAII
  • the Wnt polypeptide has a sequence selected from the sequences set forth in GenBank entries NM_004625, D83175, U53476, and NP_004616.
  • the Wnt polypeptide is a Wnt7 protein.
  • the Wnt polypeptide is a Wnt7a polypeptide.
  • the Wnt polypeptide is Wntl protein.
  • the Wnt polypeptide is a Wnt3 polypeptide.
  • the Wnt polypeptide is a Wnt3a polypeptide.
  • the Wnt polypeptide is a WntlO polypeptide.
  • the Wnt polypeptide is a Wntl Oa protein. In another embodiment, the Wnt polypeptide is a WntlOb polypeptide. In another embodiment, the Wnt polypeptide is encoded by a nucleic acid molecule having a sequence set forth in the one of the above GenBank entries. In another embodiment, a biologically active fragment of a Wnt polypeptide is utilized in a method of the present invention. In another embodiment, a biologically active fragment of a Wnt7 protein is utilized in a method of the present invention. In another embodiment, a biologically active fragment of a Wnt polypeptide is utilized in a method of the present invention. In another embodiment, a biologically active fragment of a Wnt7a polypeptide is utilized in a method of the present invention. In another embodiment, a biologically active fragment of a Wnt7a polypeptide is utilized in a method of the present invention. Each possibility represents a separate embodiment of the present invention.
  • methods of the present invention stimulate one or more members of the SHH signaling pathway, which in one embodiment is N-Shh (cleavage product), N-Shh-Chol, which in one embodiment, inhibits Patched- 1 and Patched-2, which in one embodiment, inhibit Smoothened, which in one embodiment, stimulates GLI-I, which in one embodiment, stimulates transcription of other genes (in one embodiment, GLI-I, PTCl, HNF3 ⁇ ) and GLI-2, and GLI-3, which in one embodiment inhibit transcription of other genes.
  • N-Shh cleavage product
  • N-Shh-Chol which in one embodiment, inhibits Patched- 1 and Patched-2
  • Smoothened which in one embodiment, stimulates GLI-I, which in one embodiment, stimulates transcription of other genes (in one embodiment, GLI-I, PTCl, HNF3 ⁇ ) and GLI-2, and GLI-3, which in one embodiment inhibit transcription of other genes.
  • FGF9 stimulation and the resulting increase in SHH will relieve the tonic inhibition of Patched proteins on
  • methods of the present invention stimulate one or more members of the WNT signaling pathway, which in one embodiment is Frizzled, SFRP, Dishevelled (Dsh), TCF, LRP, APC, ⁇ -catenin, Axin.
  • Dickkopf GSK3, Naked, Porcupine, or FRAT/GBP.
  • the wnt pathway is stimulated before the hedgehog pathway.
  • the two pathways are stimulated in an overlapping fashion.
  • the two pathways are stimulated simultaneously.
  • homologues and variants of transcripts and proteins of the present invention are administered in methods of the present invention.
  • homologues and variants of transcripts and proteins of the present invention are targeted in methods of the present invention.
  • Each possibility represents a separate embodiment of the present invention.
  • homology when in reference to any protein or peptide, refer in one embodiment, to a percentage of amino acid residues in the candidate sequence that are identical with the residues of a corresponding native polypeptide, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent homology, and not considering any conservative substitutions as part of the sequence identity. Methods and computer programs for the alignment are well known in the art.
  • “homology” refers to identity of greater than 70%. In another embodiment, “homology” refers to identity of greater than 75%. In another embodiment, “homology” refers to identity of greater than 80%. In another embodiment, “homology” refers to identity of greater than 82%. In another embodiment, “homology” refers to identity of greater than 85%. In another embodiment, “homology” refers to identity of greater than 87%. In another embodiment, “homology” refers to identity of greater than 90%.
  • “homology” refers to identity of greater than 92%. In another embodiment, “homology” refers to identity of greater than 95%. In another embodiment, “homology” refers to identity of greater than 97%. In another embodiment, “homology” refers to identity of greater than 98%. In another embodiment, “homology” refers to identity of greater than 99%. In another embodiment, “homology” refers to identity of 100%.
  • Protein and/or peptide homology for any amino acid sequence listed herein is determined, in one embodiment, by methods well described in the art, including immunoblot analysis, or via computer algorithm analysis of amino acid sequences, utilizing any of a number of software packages available, via established methods. Some of these packages may include the FASTA, BLAST, MPsrch or Scanps packages, and may employ the use of the Smith and Waterman algorithms, and/or global/local or BLOCKS alignments for analysis, for example. Each method of determining homology represents a separate embodiment of the present invention.
  • the term "peptide” includes native peptides (either degradation products, synthetically synthesized peptides or recombinant peptides) and peptidomimetics (typically, synthetically synthesized peptides), such as peptoids and semipeptoids which are peptide analogs, which may have, for example, modifications rendering the peptides more stable while in a body or more capable of penetrating into bacterial cells.
  • Methods for preparing peptidomimetic compounds are well known in the art and are specified, for example, in Quantitative Drug Design, CA. Ramsden Gd., Chapter 17.2, F. Choplin Pergamon Press (1992), which is incorporated by reference as if fully set forth herein.
  • Natural aromatic amino acids, Trp, Tyr and Phe may be substituted for synthetic non- natural acid such as TIC, naphthylelanine (NoI), ring-methylated derivatives of Phe, halogenated derivatives of Phe or o-methyl-Tyr.
  • the peptides of the present invention may also include one or more modified amino acids or one or more non-amino acid monomers (e.g. fatty acids, complex carbohydrates etc).
  • amino acid or “amino acids” is understood to include the 20 naturally occurring amino acids; those amino acids often modified post-translationally in vivo, including, for example, hydroxyproline, phosphoserine and phosphothreonine; and other unusual amino acids including, but not limited to, 2-aminoadipic acid, hydroxylysine, isodesmosine, nor-valine, nor-leucine and ornithine.
  • amino acid includes both D- and L-amino acids.
  • naturally occurring amino acids and non-conventional or modified amino acids as are known in the art can be used with the present invention.
  • the present invention provides a kit, comprising a tools and/or a compound suitable for performing a method of the present invention.
  • the present invention provides a device, comprising a tool suitable for epidermal disruption and a means of delivering a compound or factor that upregulates expression of SHH.
  • a vector or plasmid encoding a polypeptide of the present invention, which in one embodiment, is a fibroblast growth factor-9 polypeptide, shh, wnt, ptchl, ptch, glil, or gli2, or a composition comprising such a vector.
  • an isolated nucleic acid that encodes a polypeptide of the present invention for use in the methods of the present invention is provided.
  • an "isolated nucleic acid” refers to a nucleic acid segment or fragment which has been separated from sequences which flank it in a naturally occurring state, e.g., a DNA fragment which has been removed from the sequences which are normally adjacent to the fragment, e.g., the sequences adjacent to the fragment in a genome in which it naturally occurs.
  • the term also applies to nucleic acids which have been substantially purified from other components which naturally accompany the nucleic acid, e.g., RNA or DNA or proteins, which naturally accompany it in the cell.
  • the term therefore includes, for example, a recombinant DNA which is incorporated into a vector, into an autonomously replicating plasmid or virus, or into the genomic DNA of a prokaryote or eukaryote, or which exists as a separate molecule (e.g., as a cDNA or a genomic or cDNA fragment produced by PCR or restriction enzyme digestion) independent of other sequences. It also includes a recombinant DNA which is part of a hybrid gene encoding additional polypeptide sequence.
  • the present invention provides a cell comprising an isolated nucleic acid or vector of the present invention.
  • two polynucleotides of the present invention are operably linked.
  • polynucleotides encoding FGF9 and WNT may be operably linked.
  • "operably linked" indicates that a single-stranded or double-stranded nucleic acid moiety comprises the two polynucleotides arranged within the nucleic acid moiety in such a manner that they are expressed together.
  • a promoter operably linked to the coding region of a gene is able to promote transcription of the coding region.
  • a polynucleotide of the present invention comprises a promoter/regulatory sequence, which in one embodiment, the promoter/regulatory is positioned at the 5' end of the desired protein coding sequence such that it drives expression of the desired protein in a cell.
  • the nucleic acid encoding the desired protein and its promoter/regulatory sequence comprise a "transgene.”
  • promoter/regulatory sequence refers to a nucleic acid sequence which is required for expression of a gene product operably linked to the promoter/regulatory sequence.
  • this sequence may be the core promoter sequence and in other instances, this sequence may also include an enhancer sequence and other regulatory elements which are required for expression of the gene product.
  • the promoter/regulatory sequence may, for example, be one which expresses the gene product in a tissue specific manner.
  • a promoter used in the present invention may be constitutive or inducible.
  • a promoter for use in the methods of the present invention may be tissue-specific. Such promoters are well known in the art.
  • the present invention provides a delivery vehicle for administration of a polypeptide of the present invention. Examples of such delivery vehicles are known in the art and may include recombinant viruses or bacteria engineered to express said polypeptide.
  • viruses or bacteria are attenuated.
  • viruses for use in the methods of the present invention may include retroviruses, adenoviruses, adeno-associated viruses, etc.
  • the virus may be of any known serotype or subgroup.
  • any one of a number of different vectors can be used in the methods of the present invention, such as viral vectors, plasmid vectors, linear DNA, etc., as known in the art, to introduce an exogenous nucleic acid fragment encoding a therapeutic agent into target cells and/or tissue.
  • vectors can be inserted, for example, using infection, transduction, transfection, calcium-phosphate mediated transfection, DEAE-dextran mediated transfection, electroporation, liposome-mediated transfection, biolistic gene delivery, liposomal gene delivery using fusogenic and anionic liposomes (which are an alternative to the use of cationic liposomes), direct injection, receptor-mediated uptake, magnetoporation, ultrasound, or any combination thereof, as well as other techniques known in the art (for further detail see, for example, "Methods in Enzymology” Vol. 1-317, Academic Press, Current Protocols in Molecular Biology, Ausubel F. M. et al.
  • polynucleotide segments encoding sequences of interest can be ligated into an expression vector system suitable for transducing mammalian cells and for directing the expression of recombinant products within the transduced cells.
  • the introduction of the exogenous nucleic acid fragment is accomplished by introducing the vector into the vicinity of the micro-organ.
  • exogenous nucleic acid fragment refers to a substance that originated outside, for example a nucleic acid that originated outside of a cell or tissue.
  • a vector for use in the methods of the present invention is a non- immunogenic gene transfer agent such as a nonviral vector (e.g. DNA plasmids or minicircle DNA), a "gutless" viral vector i.e. without endogenous genes (which in one embodiment, is due to a deletion, while in another embodiment, due to an insertion, substitution or deletion in a gene that prevents gene expression), a helper-dependent adenovirus (HDAd) vector, or adeno associated virus AAV (which in one embodiment is single stranded and in another embodiment, double stranded).
  • a nonviral vector e.g. DNA plasmids or minicircle DNA
  • a "gutless" viral vector i.e. without endogenous genes
  • a helper-dependent adenovirus (HDAd) vector e.g., a helper-dependent adenovirus (HDAd) vector
  • HDAd helper-dependent adenovirus
  • the formulation is so chosen such that recombinant gene expression results in lack of toxicity or immune-mediated rejection of the gene product by the tissue.
  • the vector is virally derived, and in another embodiment, the vector is a plasmid.
  • the virally-derived vector is derived from adenovirus, which in one embodiment, is helper-dependent adenovirus, while in another embodiment, the virally-derived vector is derived from adenovirus-associated vector.
  • the term "vector” or "expression vector” refers to a carrier molecule into which a nucleic acid sequence can be inserted for introduction into a cell where it can be replicated.
  • the nucleic acid molecules are transcribed into RNA, which in some cases are then translated into a protein, polypeptide, or peptide. In other cases, RNA sequences are not translated, for example, in the production of antisense molecules or ribozymes.
  • expression vectors can contain a variety of "control sequences" which refer to nucleic acid sequences necessary for the transcription and possibly translation of an operably linked coding sequence in a particular host cell.
  • a vector further includes an origin of replication.
  • the vector may be a shuttle vector, which in one embodiment can propagate both in prokaryotic and eukaryotic cells, or in another embodiment, the vector may be constructed to facilitate its integration within the genome of an organism of choice.
  • the vector in other embodiments may be, for example, a plasmid, a bacmid, a phagemid, a cosmid, a phage, a virus or an artificial chromosome.
  • the vector is a viral vector, which in one embodiment may be a bacteriophage, mammalian virus, or plant virus.
  • the viral vector is derived from a virus such as vaccinia virus, lenti virus, polio virus, hepatitis virus, papilloma virus, cytomegalovirus, simian virus, or herpes simplex virus.
  • the vector comprising a nucleic acid sequence may comprise naked recombinant DNA or plasmids. Transfer of the construct may be performed by any method which physically or chemically permeabilizes the cell membrane.
  • the vector is a mini-circle DNA, which in one embodiment, is a supercoiled DNA molecule for non- viral gene transfer, which has neither a bacterial origin of replication nor an antibiotic resistance marker.
  • compositions of the present invention comprise the indicated agent, while in another embodiment, compositions of the present invention consist essentially of the indicated agent, while in another embodiment, compositions of the present invention consist of the indicated agent.
  • the term "comprise” refers to the inclusion of the indicated active agent, such as human fibroblast growth factor-9 polypeptide, shh, wnt, etc, as well as inclusion of other active agents, and pharmaceutically acceptable carriers, excipients, emollients, stabilizers, etc., as are known in the pharmaceutical industry.
  • the term “consisting essentially of” refers to a composition, whose only active ingredient is the indicated active ingredient, however, other compounds may be included which are for stabilizing, preserving, etc. the formulation, but are not involved directly in the therapeutic effect of the indicated active ingredient.
  • the term “consisting essentially of” may refer to components which facilitate the release of the active ingredient.
  • the term “consisting” refers to a composition, which contains the active ingredient and a pharmaceutically acceptable carrier or excipient.
  • methods of the present invention treat, inhibit or suppress hair loss.
  • methods of the present invention generate hair follicles or increase hair follicle size, in one embodiment, in a subject with hair loss.
  • hair loss is due to androgenetic alopecia (AGA).
  • hair loss is due to male pattern baldness.
  • hair loss is due to female pattern baldness.
  • hair loss is the result of a skin injury.
  • the methods of the present invention treat, inhibit, or suppress a disease or disorder in a subject.
  • the subject has a disease or disorder comprising balding.
  • the subject does not have a disease or disorder comprising balding.
  • the disease or disorder is androgenetic alopecia (AGA).
  • the disease or disorder is male pattern baldness.
  • the disease or disorder is female pattern baldness.
  • the disease or disorder is a discoid lupus erythematosis.
  • the disease or disorder is a congenital hypotrichosis.
  • the disease or disorder is a lichen planopilaris.
  • the disease or disorder is a scarring (or, in another embodiment, cicatricial) alopecia, which in one embodiment, is hair loss due to scarring of the scalp area.
  • scarring alopecia typically involves the top of the scalp and occurs predominantly in women. The condition frequently occurs in African-American women and is believed to be associated with persistent tight braiding or "corn-rowing" of scalp hair. A form of scarring alopecia also may occur in post-menopausal women, associated with inflammation of hair follicles and subsequent scarring.
  • the disease or disorder is any other disease or disorder comprising balding known in the art.
  • the present invention provides methods for treating Alopecia areata, which in one embodiment, is an autoimmune disorder that causes patchy hair loss that can range from diffuse thinning to extensive areas of baldness with "islands" of retained hair.
  • the present invention provides methods for treating Trichotillomania, which in one embodiment, compulsive hair pulling. Hair loss due to trichotillomania is typically patchy, as compulsive hair pullers tend to concentrate the pulling in selected areas.
  • the present invention provides methods for treating Triangular alopecia, which in one embodiment, is a loss of hair in the temporal areas that sometimes begins in childhood. Hair loss may be complete, or a few fine, thin-diameter hairs may remain.
  • the present invention provides methods for treating Telogen effluvium, which in one embodiment, is a common type of hair loss caused when a large percentage of scalp hairs are shifted into "shedding" phase. The causes of telogen effluvium may be hormonal, nutritional, drug-associated, or stress-associated.
  • the present invention provides methods for treating Loose- anagen syndrome, which in one embodiment, is a condition occurring primarily in fair-haired persons in which scalp hair sits loosely in hair follicles and is easily extracted by combing or pulling. In one embodiment, the condition may appear in childhood.
  • the present invention provides methods for treating Tinea Capitis (Scalp Ringworm), which in one embodiment, is caused by a fungal infection, and in one embodiment, is characterized by patches of scaling that can spread and result in broken hair, redness, swelling, and oozing on the scalp.
  • the present invention provides methods for treating hair loss associated with particular conditions, which in one embodiment, is cancer, thyroid disease, inadequate protein in diet, low serum iron levels, or associated with particular environmental stimuli, which in one embodiment, is chemotherapy, or, in another embodiment, radiotherapy.
  • the present invention provides a method of treating any disease, disorder, or symptom associated with balding.
  • the present invention provides a method of treating any disease, disorder, or symptom associated with degenerative skin disorder.
  • the present invention provides a method of treating any disease, disorder, or symptom associated with alopecia.
  • Each disease, disorder, or symptom represents a separate embodiment of the present invention.
  • treating refers to either therapeutic treatment or prophylactic or preventative measures, wherein the object is to prevent or lessen the targeted pathologic condition or disorder as described hereinabove.
  • treating may include directly affecting or curing, suppressing, inhibiting, preventing, reducing the severity of, delaying the onset of, reducing symptoms associated with the disease, disorder or condition, or a combination thereof.
  • "treating” refers inter alia to delaying progression, expediting remission, inducing remission, augmenting remission, speeding recovery, increasing efficacy of or decreasing resistance to alternative therapeutics, or a combination thereof.
  • preventing refers, inter alia, to delaying the onset of symptoms, preventing relapse, decreasing the number or frequency of relapse episodes, increasing latency between symptomatic episodes, or a combination thereof.
  • suppressing or “inhibiting”, refers inter alia to reducing the severity of symptoms, reducing the severity of the current episode, reducing the number of symptoms, reducing the incidence of symptoms, reducing the latency of symptoms, ameliorating symptoms, reducing secondary symptoms, reducing secondary infections, or a combination thereof.
  • symptoms are primary, while in another embodiment, symptoms are secondary.
  • primary refers to a symptom that is a direct result of the alopecia
  • secondary refers to a symptom that is derived from or consequent to a primary cause.
  • the compositions and strains for use in the present invention treat primary or secondary symptoms or secondary complications related to alopecia, in one embodiment, seborrheic dermatitis.
  • symptoms may be any manifestation of alopecia, comprising hair loss, balding, temporary hair loss, patchy hair loss, degenerative skin disorders or a combination thereof.
  • the methods of the present invention are for treating a subject with hair loss.
  • the hair loss is in the scalp of the subject.
  • the hair loss is in the eyebrow of the subject.
  • the hair loss is in scarred skin tissue of the subject, which in one embodiment, may be scalp, eyebrow, arm, or leg of a subject.
  • any other hair-bearing area or region of the skin is treated by a method of the present invention.
  • Each possibility represents a separate embodiment of the present invention.
  • methods of the present invention comprise the step of disrupting the epidermis in the region of said hair loss prior to said administering step.
  • the epithelium is disrupted.
  • the first step e.g. epidermal disruption
  • the second step e.g. addition of an active compound, factor, cell, etc.
  • the interval is 4-12 days.
  • the interval is 5-12 days.
  • the interval is A- 11 days.
  • the interval is 6-11 days.
  • the interval is 6-10 days.
  • the interval is 6-9 days.
  • the interval is 6-8 days.
  • the interval is 7-8 days.
  • the interval is 5-11 days.
  • the interval is 5-10 days.
  • the interval is 7-10 days.
  • the interval is about 1 week.
  • compositions for use in the methods of the present invention are applied as the scabbing starts to heal, which in one embodiment is 3-12 days after epidermal disruption.
  • the compositions for use in the methods of the present invention are applied one day after scab detachment, in another embodiment, two days after scab detachment, in another embodiment, three days after scab detachment, in another embodiment, four days after scab detachment, in another embodiment, five days after scab detachment, in another embodiment, six days after scab detachment, in another embodiment, seven days or more after scab detachment.
  • the compositions for use in the present invention are administered on days 1-4 after scab detachment. Each possibility represents a separate embodiment of the present invention.
  • the step of disrupting is performed by exposing the region of said hair loss to a mechanical, chemical, or optical stimulus.
  • the optical stimulus is radiation.
  • the step of disrupting the epidermis in methods of the present invention is performed, in another embodiment, by abrading the skin region of interest.
  • the term “abrading” refers to an act of creating an abrasion.
  • abrading refers to rubbing.
  • abrading refers to wearing away by friction.
  • epidermal abrasion causes, under the conditions utilized herein, de novo HF neo- genesis.
  • the epidermal layer is disrupted.
  • "abrasion” refers to a wound consisting of superficial damage to the skin.
  • abrasion refers to an area of the scalp or skin from which the epidermis is removed. In another embodiment, “abrasion” refers to an area of the scalp or skin from which the epidermis and dermis are removed.
  • epidermal disruption by a method of the present invention converts the skin region of interest back to an embryonic-like state, in which the follicle regenerates.
  • a subsequent window of opportunity is created, during which the number and size of new HF in the skin region of interest can be manipulated.
  • the administration of a compound or factor that promotes a differentiation of an uncommitted epidermal cell into a HF cell during this window causes regeneration of larger and more numerous HF.
  • the morphology of HF in abraded skin is similar to that of embryonic HF, and the markers expressed are similar as well.
  • the excisional wounds of methods of the present invention are created using a surgical tool.
  • the surgical tool is a dermal biopsy punch.
  • the excisional wounds are induced by freezing or cryoinjury. The use of freezing or cryoinjury is well known in the art, and is used, for example by dermatologists to injure skin.
  • the freezing or cryoinjury results in a blister.
  • the blister is used as a "chamber" to introduce drugs and or cells into the reepithelialized area.
  • the epidermal disruption in methods of the present invention further removes dermal tissue from the skin region of interest.
  • the epidermal disruption does not remove dermal tissue from the skin region of interest.
  • "Disrupting" an epidermis or epidermal layer refers, in another embodiment, to removing part of the epidermis or epidermal layer.
  • the term refers to disturbing the intactness of the epidermis or epidermal layer. In another embodiment, the term refers to perforating the epidermis or epidermal layer. In another embodiment, only part of the epidermal layer need be removed. In another embodiment, the entire epidermal layer is removed. In another embodiment, the term refers to abrading the epidermis or epidermal layer. In another embodiment, the term refers to wounding the epidermis or epidermal layer. Each possibility represents a separate embodiment of the present invention.
  • the epidermal disruption is performed with a tool that comprises sandpaper.
  • the epidermal disruption is performed with a laser.
  • the laser is a Fraxel laser.
  • the laser is a CO 2 laser.
  • the laser is an excimer laser.
  • the laser is any other type of laser capable of inducing trans-epithelial injury.
  • the epidermal disruption is performed with a felt wheel.
  • the epidermal disruption is performed with a surgical tool.
  • the epidermal disruption is performed with any other tool known in the art that is capable of epidermal disruption.
  • the epidermal disruption comprises use of a micro-dermabrasion device.
  • the epidermal disruption comprises a burn treatment.
  • the epidermal disruption comprises a disruption of a follicle of said epidermis and a disruption of an interfollicular region of said epidermis.
  • the epidermal disruption comprises a disruption of a follicle of said epidermis and does not comprise a disruption of an interfollicular region of said epidermis.
  • the epidermal disruption comprises a light-based method. In another embodiment, the epidermal disruption comprises irradiation with visible light. In another embodiment, the epidermal disruption comprises irradiation with infrared light. In another embodiment, the epidermal disruption comprises irradiation with ultraviolet radiation. In another embodiment, the epidermal disruption comprises orthovoltage irradiation. In another embodiment, the epidermal disruption comprises X-ray irradiation. In another embodiment, the epidermal disruption comprises any other type of irradiation known in the art. [00155] In another embodiment, the epidermal disruption is performed by mechanical means. In another embodiment, "mechanical means" refers to abrading. In another embodiment, the term refers to wounding.
  • the term refers to ultrasound. In another embodiment, the term refers to radio-frequency. In another embodiment, the term refers to an electrical process or the use of an electrical current. In another embodiment, the term refers to electoporation. In another embodiment, the term refers to excision. In another embodiment, the term refers to tape-stripping. In another embodiment, the term refers to microdermabrasion. In another embodiment, the term refers to the use of peels. In another embodiment, the term refers to any other type of mechanical means known in the art. Each possibility represents a separate embodiment of the present invention.
  • the epidermal disruption comprises chemical treatment. In another embodiment, the chemical is phenol. In another embodiment, the chemical is trichloracetic acid. In another embodiment, the chemical is ascorbic acid. In another embodiment, the chemical is any other chemical capable of epidermal disruption that is known in the art. [00157] In another embodiment, epidermal trauma is utilized in a method of the present invention.
  • WIHN refers to HF neogenesis induced by disruption of the epithelial layer.
  • the term refers to HF neogenesis induced by abrasion.
  • the term refers to HF neogenesis induced by wounding.
  • the term refers to HF neogenesis induced by disruption of the epithelial layer, followed by administration of a compound or factor that promotes a differentiation of an uncommitted epidermal cell into a HF cell.
  • the epidermal disruption of methods of the present invention creates an abrasion at least about 1-1.5 centimeters (cm) in width. In another embodiment, the abrasion is at least about 1 cm in width. In another embodiment, the abrasion is at least about 1.5 cm in width. In another embodiment, the abrasion is at least about 2 cm in width. Each type of abrasion represents a separate embodiment of the present invention.
  • the excisional wounds of methods of the present invention are not surgically closed. In another embodiment, the excisional wounds are allowed to heal by secondary intention. In another embodiment, the skin region of interest is not contacted with a bandage or dressing following the epidermal disruption.
  • the skin region of interest is not contacted with an ointment following the epidermal disruption.
  • the skin region of interest is allowed to heal for a period of time without being contacted by any substance, device, ointment, etc., that is ordinarily administered to an abrasion or wound to facilitate healing.
  • the skin region of interest is allowed to heal for a period of time without being contacted by any substance, device, ointment, etc., that is ordinarily administered to an abrasion or wound to prevent infection.
  • the "period of time" is the time it takes the epidermal disruption to heal.
  • the period of time is any time or range of times between 2 days and 3 weeks.
  • following refers to a period of time of about 2 days. In another embodiment, “following” refers to a period of time of about 3 days. In another embodiment, “following” refers to a period of time of about 4 days. In another embodiment, “following” refers to a period of time of about 5 days. In another embodiment, “following” refers to a period of time of about 7 days. In another embodiment, “following” refers to a period of time of about 10 days. In another embodiment, “following” refers to a period of time of about 2 weeks. In another embodiment, “following” refers to a period of time of about 3 weeks. Each possibility represents a separate embodiment of the present invention.
  • a method of the present invention further comprises the step of depilating the skin in the region in which hair growth or follicle formation is desired. In one embodiment, said step of depilating is performed prior to said step of epidermal disruption.
  • the depilation is epilation. In another embodiment, the depilation comprises the step of waxing. In another embodiment, the depilation comprises the step of plucking. In another embodiment, the depilation comprises the use of an abrasive material. In another embodiment, the depilation comprises the use of a laser. In another embodiment, the depilation comprises the use of electrolysis. In another embodiment, the depilation comprises the use of a mechanical device.
  • the depilation comprises the use of thioglycolic acid. In another embodiment, the depilation comprises the use of any other method of depilation or epilation known in the art. Each possibility represents a separate embodiment of the present invention.
  • the additional step (depilation or administration of a retinoid) is performed prior to the step of disrupting the epidermis. In another embodiment, the additional step is performed following the step of disrupting the epidermis, but prior to the addition of the compound or factor that of the present invention. In another embodiment, the additional step is performed concurrently with the addition of the differentiation-promoting compound or factor. In another embodiment, the additional step is performed following the addition of the differentiation-promoting compound or factor. Each possibility represents a separate embodiment of the present invention.
  • a method of the present invention further comprises the step of administering a topical retinoid to the skin region of interest.
  • the topical retinoid induces resting (telogen) HF in the skin region of interest to enter anagen.
  • telogen resting
  • the additional step is performed between about two days and about three weeks before the step of abrading. In another embodiment, the additional step is performed about two days before the step of abrading. In another embodiment, the additional step is performed about three days before the step of abrading. In another embodiment, the additional step is performed about four days before the step of abrading. In another embodiment, the additional step is performed about one week before the step of abrading. In another embodiment, the additional step is performed about ten days before the step of abrading. In another embodiment, the additional step is performed about two weeks before the step of abrading. In another embodiment, the additional step is performed about three weeks before the step of abrading. Each possibility represents a separate embodiment of the present invention.
  • the methods of the present invention further comprise the step of administering an antagonist of an androgen or an antagonist of an androgen receptor. In another embodiment, the methods of the present invention further comprise the step of administering a 5 alpha-reductase type 2 inhibitor.
  • a method of the present invention further comprises the step of contacting the skin region of interest with an anti-androgen compound.
  • the anti-androgen compound is finasteride.
  • the anti-androgen compound is Fluridil®.
  • the anti-androgen compound is dutasteride.
  • the anti-androgen compound is spironolactone.
  • the anti- androgen compound is cyproterone acetate.
  • the anti-androgen compound is bicalutamide.
  • the anti-androgen compound is flutamide.
  • the anti-androgen compound is nilutamide.
  • the anti-androgen compound is an inhibitor of an androgen receptor.
  • the anti-androgen compound is any other anti-androgen compound known in the art. Each possibility represents a separate embodiment of the present invention.
  • a method of the present invention further comprises the step of contacting the skin region of interest with an estrogen compound. In another embodiment, a method of the present invention further comprises the step of contacting the skin region of interest with an estrogen receptor agonist. In another embodiment, a method of the present invention further comprises the step of contacting the skin region of interest with an estrogen analogue.
  • the estrogen analogue is estradiol. In another embodiment, the estrogen analogue is 17 beta-estradiol. In another embodiment, the estrogen analogue is 17 alpha-estradiol. In another embodiment, the estrogen analogue is ZYC3. In another embodiment, the estrogen compound, estrogen receptor agonist, or estrogen analogue is any other estrogen compound, estrogen receptor agonist, or estrogen analogue known in the art. Each possibility represents a separate embodiment of the present invention.
  • a method of the present invention further comprises the step of contacting the skin region of interest with an inhibitor of an EGF protein.
  • a method of the present invention further comprises the step of contacting the skin region of interest with an inhibitor of an EGFR.
  • a method of the present invention further comprises the step of contacting the skin region of interest with a compound that reduces an expression of an EGF protein or an EGFR.
  • the inhibitor of an EGF or an EGF receptor is panitumumab.
  • the inhibitor is AG1478.
  • the inhibitor is nimotuzumab.
  • the inhibitor is an antibody that binds EGF or EGFR.
  • the inhibitor is HuMax-EGFR® (Genmab, Copenhagen, Denmark).
  • the inhibitor is cetuximab.
  • the inhibitor is IMC 11F8.
  • the inhibitor is matuzumab.
  • the inhibitor is SC 100.
  • the inhibitor is ALT 110.
  • the inhibitor is PX 1032.
  • the inhibitor is BMS 599626.
  • the inhibitor is MDX 214.
  • the inhibitor is PX 1041.
  • the inhibitor is any other inhibitor of an EGF or an EGF receptor known in the art. Each possibility represents a separate embodiment of the present invention.
  • a method of the present invention further comprises the step of contacting the skin region of interest with an inhibitor of a tyrosine kinase activity of an EGF receptor.
  • the inhibitor is gefitinib.
  • the inhibitor is erlotinib.
  • the inhibitor is canertinib.
  • the inhibitor is leflunomide.
  • the inhibitor is A77 1726.
  • the inhibitor is pelitinib.
  • the inhibitor is ZD 1839.
  • the inhibitor is CL 387785.
  • the inhibitor is EKI 785.
  • the inhibitor is vandetanib.
  • the inhibitor is any other inhibitor of a tyrosine kinase activity of an EGF receptor known in the art. Each possibility represents a separate embodiment of the present invention.
  • a method of the present invention further comprises the step of contacting the skin region of interest with an EGF or EGFR antagonist.
  • the EGF or EGFR antagonist is a carboxypeptidase inhibitor from potato (PCI) protein or a homologue, fragment or mimetic thereof.
  • the EGF or EGFR antagonist is a sprouty protein or a homologue, fragment or mimetic thereof.
  • the EGF or EGFR antagonist is an Argos protein or a homologue, fragment or mimetic thereof.
  • the EGF or EGFR antagonist is a lefty protein or a homologue, fragment or mimetic thereof.
  • the EGF or EGFR antagonist is an antibody that recognizes EGF or EGFR, or a fragment or mimetic thereof.
  • the EGF or EGFR antagonist is small molecule inhibitor that binds and reduces the activity of EGF or EGFR.
  • the EGF or EGFR antagonist is CRM197.
  • the EGF or EGFR antagonist is EVIC-C225 (ImClone Systems, New York, NY).
  • the EGF or EGFR antagonist is any other antagonist of EGF or EGFR known in the art. Each possibility represents a separate embodiment of the present invention.
  • the EGF or EGFR antagonist is a carboxypeptidase inhibitor from potato (PCI) protein or a homologue, fragment or mimetic thereof.
  • the EGF or EGFR antagonist is a sprouty protein or a homologue, fragment or mimetic thereof.
  • the EGF or EGFR antagonist is an Argos protein or a homologue, fragment or mimetic thereof.
  • the EGF or EGFR antagonist is a lefty protein or a homologue, fragment or mimetic thereof.
  • the EGF or EGFR antagonist is an antibody that recognizes EGF or EGFR, or a fragment or mimetic thereof.
  • the EGF or EGFR antagonist is small molecule inhibitor that binds and reduces the activity of EGF or EGFR.
  • the EGF or EGFR antagonist is CRM197.
  • the EGF or EGFR antagonist is IMC-C225 (ImClone Systems, New York, NY).
  • the EGF or EGFR antagonist is any other antagonist of EGF or EGFR known in the art. Each possibility represents a separate embodiment of the present invention.
  • the EGFR of methods and compositions of the present invention has, in another embodiment, the sequence:
  • the EGFR has a sequence selected from the sequences set forth in GenBank entries NM_201282,
  • the EGFR is encoded by a nucleic acid molecule having a sequence set forth in the one of the above GenBank entries.
  • a biologically active fragment of an EGFR is utilized in a method of the present invention. Each possibility represents a separate embodiment of the present invention.
  • EGF of methods and compositions of the present invention has, in another embodiment, the sequence:
  • the EGF has a sequence selected from the sequences set forth in GenBank entries BC093731, AY548762, and X04571.
  • the EGF is encoded by a nucleic acid molecule having a sequence set forth in the one of the above GenBank entries.
  • a biologically active fragment of an EGF is utilized in a method of the present invention. Each possibility represents a separate embodiment of the present invention.
  • a method of the present invention further comprises the step of contacting the skin region of interest with a Hedgehog protein. In another embodiment, a method of the present invention further comprises the step of contacting the skin region of interest with a nucleotide encoding a Hedgehog protein. In another embodiment, a method of the present invention further comprises the step of contacting the skin region of interest with an activator of a Hedgehog protein.
  • the methods of the present invention further comprise the step of administering a 5 alpha-reductase type 2 inhibitor, which in one embodiment, is Finasteride or, in another embodiment, turosteride.
  • the methods of the present invention further comprise the step of administering a reductase inhibitor.
  • a reductase inhibitor which in one embodiment is an FCE - dual inhibitor, which in one embodiment is FCE 28260; FCE 28175, or FCE 27837; in another embodiment is an MK inhibitor, which in one embodiment, is MK 0434, MK 0963, or MK 386; in another embodiment, is an FK Nonsteroidal Inhibitor, which in one embodiment is FK 143; and in another embodiment is a LY Nonsteroidal Inhibitor, which in one embodiment, is LY 191704; and in another embodiment, is a SK&F Inhibitor, which in one embodiment, is SK&F 105657.
  • the methods of the present invention further comprise the step of administering an additional composition.
  • the composition is Dutasteride (Avodart®, GIl 98745), Finasteride (Propecia®, Proscar®), Turosteride, Azelaic acid, Zinc sulphate, CS 891, or a combination thereof.
  • the methods of the present invention further comprise the step of administering an antiandrogen, which in one embodiment is Spironolactone (Aldactone®), Flutamide (Euflex®, Eulexin®), Casodex, Inocoterone, an RU Antiandrogen, TZP-4238, Win 49596, Fluridil (Eucapil®), or a combination thereof.
  • an antiandrogen which in one embodiment is Spironolactone (Aldactone®), Flutamide (Euflex®, Eulexin®), Casodex, Inocoterone, an RU Antiandrogen, TZP-4238, Win 49596, Fluridil (Eucapil®), or a combination thereof.
  • the methods of the present invention further comprise the step of administering a K+ Channel Opener, which in one embodiment, is minoxidil (Rogaine®), Diazoxide, Cromakalim, Pinacidil, or a combination thereof.
  • a K+ Channel Opener which in one embodiment, is minoxidil (Rogaine®), Diazoxide, Cromakalim, Pinacidil, or a combination thereof.
  • the methods of the present invention further comprise the step of administering a vasodilator, which in one embodiment, is minoxidil (Rogaine®).
  • the methods of the present invention further comprise the step of administering an estrogen blocker, which in one embodiment, is an ICI Estrogen Blocker.
  • an estrogen blocker which in one embodiment, is an ICI Estrogen Blocker.
  • the subject of methods of the present invention is, in another embodiment, a human.
  • the subject is a rodent, in one embodiment, a mouse, in another embodiment, a rat.
  • the subject is a mammal.
  • the subject is a vertebrate.
  • the subject is feline, canine, ovine, or bovine.
  • the subject is a male.
  • the subject is a female.
  • the subject is any other subject known in the art. Each possibility represents a separate embodiment of the present invention.
  • the subject is an adult.
  • “adult” refers to an age greater than about 18 years. In another embodiment, “adult” refers to an age greater than about 20 years. In another embodiment, “adult” refers to an age greater than about 25 years. In another embodiment, “adult” refers to an age greater than about 30 years. In another embodiment, “adult” refers to an age greater than about 35 years. In another embodiment, “adult” refers to an age greater than about 40 years. In another embodiment, “adult” refers to an age greater than about 45 years.
  • the subject is elderly.
  • “elderly” refers to an age greater than about 45 years.
  • “elderly” refers to an age greater than about 50 years.
  • “elderly” refers to an age greater than about 55 years.
  • “elderly” refers to an age greater than about 60 years.
  • “elderly” refers to an age greater than about 65 years.
  • “elderly” refers to an age greater than about 70 years.
  • the first subject, or, where applicable, both the first subject and the second subject is a laboratory animal.
  • the subject(s) is/are mice.
  • the subject(s) is/are rats. In another embodiment, the subject(s) is/are gerbils. In another embodiment, the subject(s) is/are hamsters. In another embodiment, the subject(s) is/are guinea pigs. In another embodiment, the subject(s) is/are rabbits. In another embodiment, the subject(s) is/are pigs. In another embodiment, the subject(s) is/are dogs. In another embodiment, the subject(s) is/are cats. In another embodiment, the subject(s) is/are primates. In another embodiment, the subject(s) is/are any other laboratory animal known in the art. Each possibility represents a separate embodiment of the present invention.
  • the subject is contacted with FGF9, or in another embodiment, with a composition comprising FGF9.
  • FGF9 or a composition comprising FGF9 is administered to a subject.
  • Contacting refers, in another embodiment, to bringing skin, in one embodiment, scalp, eyebrow, etc, into to contact with a compound, factor, cell, etc.
  • the term refers to embedding the compound, factor, cell, etc into the skin region of interest.
  • the term refers to injecting the compound, factor, cell, etc into the skin region of interest.
  • term refers to any other type of contacting known in the art. Each possibility represents a separate embodiment of the present invention.
  • the step of contacting in methods of the present invention comprises directly contacting the skin region of interest with the compound, RNA, protein, etc.
  • the step of contacting comprises indirectly contacting the skin region of interest via contacting another site or tissue of the subject, after which the compound, RNA, or protein is transported to the skin region of interest by a biological process; e.g, diffusion, active transport, or circulation in a fluid such as the blood, lymph, interstitial fluid, etc.
  • a biological process e.g, diffusion, active transport, or circulation in a fluid such as the blood, lymph, interstitial fluid, etc.
  • other fibroblast growth factors may be used in the methods of the present invention.
  • FGFl, FGF2, FGF3, FGF4, FGF5, FGF6, FGF7, FGF8, FGF9, FGFlO, or a combination thereof may be used in the methods of the present invention.
  • FGFl through FGFlO all bind fibroblast growth factor receptors (FGFRs).
  • FGFl is known as acidic fibroblast growth factor, and FGF2 is also known as basic fibroblast growth factor.
  • FGFI l, FGF12, FGF13, or FGF14 may be used in the methods of the present invention.
  • FGFI l, FGF12, FGF13, and FGF14 are known as FGF homologous factors 1-4 (FHFl -FHF4), and in another embodiment, have distinct functional differences compared to the FGFs. In one embodiment, these factors possess remarkably similar sequence homology, they do not in one embodiment, bind FGFRs and are involved in intracellular processes unrelated to the FGFs. In one embodiment, this group is also known as "iFGF".
  • FGFl 6, FGF17, FGF18, FGF19, FGF20, FGF21, FGF22, or FGF23 may be used in the methods of the present invention.
  • FGF15/FGF19, FGF21 and FGF23 have systemic rather than local effects.
  • methods of the present invention comprise administering a pharmaceutical composition comprising FGF9 or an up-regulator of SHH and/or its analog, derivative, isomer, metabolite, pharmaceutically acceptable salt, pharmaceutical product, hydrate, N-oxide, or any combination thereof; and a pharmaceutically acceptable carrier.
  • a pharmaceutical composition comprising FGF9 or an up-regulator of SHH and/or its analog, derivative, isomer, metabolite, pharmaceutically acceptable salt, pharmaceutical product, hydrate, N-oxide, or any combination thereof.
  • compositions containing FGF9 or an up-regulator of SHH can, in another embodiment, be administered to a subject by any method known to a person skilled in the art, such as topically, parenterally, paracancerally, transmucosally, transdermally, intramuscularly, intravenously, intradermally, subcutaneously, subepidermally, intraperitonealy, intraventricularly, intra-arteriolly, intravascularly, intracranially, intravaginally, intrarectally, or intratumorally.
  • the dosage regimen will be determined by skilled clinicians, based on factors such as exact nature of the condition being treated, the severity of the condition, the age and general physical condition of the patient, body weight, and response of the individual patient, etc.
  • the pharmaceutical compositions are administered orally, and are thus formulated in a form suitable for oral administration, i.e. as a solid or a liquid preparation.
  • suitable solid oral formulations include tablets, capsules, pills, granules, pellets and the like.
  • Suitable liquid oral formulations include solutions, suspensions, dispersions, emulsions, oils and the like.
  • the FGF9 or other polypeptide as provided herein composition is formulated in a capsule.
  • the compositions of the present invention comprise, in addition to FGF9 or other polypeptide as provided herein an inert carrier or diluent, or a hard gelating capsule.
  • the pharmaceutical compositions are administered topically to body surfaces and are thus formulated in a form suitable for topical administration.
  • Suitable topical formulations include gels, ointments, creams, lotions, drops, gels; pastes; powders; aerosol sprays; syrups or ointments on sponges or cotton applicators; and solutions or suspensions in an aqueous liquid, non-aqueous liquid, oil-in-water emulsion, or water-in-oil liquid emulsion, and the like. Because of its ease of administration, a cream, lotion, or ointment represents the most advantageous topical dosage unit form, in which case liquid pharmaceutical carriers may be employed in the composition.
  • compositions may be prepared as rinse-off or leave-on products, as well as two stage treatment products for use with other skin cleansing or managing compositions.
  • the compositions are administered as a rinse-off product in a higher concentration form, such as a gel, and then a leave-on product in a lower concentration to avoid irritation of the skin.
  • a delayed release patch may be used for administration of FGF9.
  • the FGF9 composition or its physiologically tolerated derivatives such as salts, esters, N-oxides, and the like are prepared and applied as solutions, suspensions, or emulsions in a physiologically acceptable diluent with or without a pharmaceutical carrier.
  • Ointment preparations may be roughly classified into fat/oil type ointments, emulsified ointments, water-soluble ointments and suspended ointments according to the type of the base (vehicle) used therefor.
  • An ointment may comprise, for example, fats, fatty oils, lanolin, vaseline, paraffins, waxes, resins, plastics, glycols, higher alcohols, glycerol, water, emulsifiers, suspending agents or other appropriate additives as a diluent, carrier or as a vehicle.
  • Manufacture of an ointment comprises, for example, adding the compound of the present invention to the appropriate additives, diluents, carriers or vehicles followed by mixing to make the mixture homogeneous.
  • injectable, sterile solutions preferably oily or aqueous solutions, as well as suspensions, emulsions, or implants, including suppositories and enemas.
  • Ampoules are convenient unit dosages.
  • Such a suppository may comprise any agent described herein.
  • Such an aerosol may comprise any agent described herein.
  • a sweetened vehicle is employed when a syrup, elixir, or the like is used for enteral application.
  • pharmaceutically acceptable carriers are, in another embodiment, aqueous or non-aqueous solutions, suspensions, emulsions or oils.
  • non-aqueous solvents are propylene glycol, polyethylene glycol, and injectable organic esters such as ethyl oleate.
  • Aqueous carriers include, in another embodiment, water, alcoholic/aqueous solutions, emulsions or suspensions, including saline and buffered media.
  • oils are those of petroleum, animal, vegetable, or synthetic origin, for example, peanut oil, soybean oil, mineral oil, olive oil, sunflower oil, and fish- liver oil.
  • the pharmaceutical compositions are administered by subcutaneous implantation of a pellet.
  • the pellet provides for controlled release of the FGF9 over a period of time.
  • the pharmaceutical compositions are controlled-release compositions, i.e. compositions in which the FGF9 composition is released over a period of time after administration.
  • Controlled- or sustained-release compositions include, in another embodiment, formulation in lipophilic depots (e.g. fatty acids, waxes, oils).
  • the composition is an immediate-release composition, i.e. a composition in which all the FGF9 composition is released immediately after administration.
  • Sustained or directed release compositions can be formulated, e.g., liposomes or those wherein the active compound is protected with differentially degradable coatings, e.g., by microencapsulation, multiple coatings, etc. It is also possible to freeze-dry the new compounds and use the lyophilisates obtained, for example, for the preparation of products for injection.
  • compositions of this invention are pharmaceutically acceptable.
  • pharmaceutically acceptable refers to any formulation which is safe, and provides the appropriate delivery for the desired route of administration of an effective amount of at least one compound for use in the present invention. This term refers to the use of buffered formulations as well, wherein the pH is maintained at a particular desired value, ranging from pH 4.0 to pH 9.0, in accordance with the stability of the compounds and route of administration.
  • FGF9 or upregulators of SHH used in the methods of this invention may be administered alone or within a composition.
  • compositions comprising FGF9 or upregulators of SHH in admixture with conventional excipients, i.e. pharmaceutically acceptable organic or inorganic carrier substances suitable for parenteral, enteral (e.g., oral) or topical application which do not deleteriously react with the active compounds may be used.
  • suitable pharmaceutically acceptable carriers include but are not limited to water, salt solutions, alcohols, gum arabic, vegetable oils, benzyl alcohols, polyethylene glycols, gelatine, carbohydrates such as lactose, amylose or starch, magnesium stearate, talc, silicic acid, viscous paraffin, white paraffin, glycerol, alginates, hyaluronic acid, collagen, perfume oil, fatty acid monoglycerides and diglycerides, pentaerythritol fatty acid esters, hydroxy methylcellulose, polyvinyl pyrrolidone, etc.
  • the pharmaceutical preparations can be sterilized and if desired mixed with auxiliary agents, e.g., lubricants, preservatives, stabilizers, wetting agents, emulsifiers, salts for influencing osmotic pressure, buffers, coloring, flavoring and/or aromatic substances and the like which do not deleteriously react with the active compounds.
  • auxiliary agents e.g., lubricants, preservatives, stabilizers, wetting agents, emulsifiers, salts for influencing osmotic pressure, buffers, coloring, flavoring and/or aromatic substances and the like which do not deleteriously react with the active compounds.
  • auxiliary agents e.g., lubricants, preservatives, stabilizers, wetting agents, emulsifiers, salts for influencing osmotic pressure, buffers, coloring, flavoring and/or aromatic substances and the like which do not deleteriously react with the active compounds.
  • they can also be combined where desired with other active
  • the additional compound is a moisturizer or an emollient, which in one embodiment is petrolatum, white petrolatum, hydrogenated vegetable oil, hydrophilic petrolatum, panthenol, primrose oil, omega-3 fish oils, omega-6 fish oils, linoleic acid, flax seed oil, ceramide, borage oil (linoleic acid), tocopherol (Vitamin E), tocopherol linoleate, dimethicone, glycerine or a combination thereof.
  • moisturizers improve the ability of the skin to absorb other administered compounds, including inter alia, the compounds for use in the present invention.
  • moisturizing agents minimize or prevent the skin from drying and cracking, thereby decreasing susceptibility of skin to environmental factors that generate free radicals, thereby preventing additional damage to the skin.
  • the additional compound is a topical steroid, which in one embodiment is hydrocortisone, in one embodment 1% hydrocortisone, triamcinolone, fluocinolone acetonide, halcinonide, halobetasol propionate, clobetasol propionate, betamethasone dipropionate, betamethasone valerate, and triamcinolone acetonide or a combination thereof; oral steroids; topical immunomodulators including, inter alia, tacrolimus, pimecrolimus, Ascomycin, cyclosporine, or a combination thereof; antihistamines, which in one embodiment is hydroxyzine or diphenhydramine hydrochloride, Ketotifen, Doxepin; biologies, which in one embodiment comprises Amevive (alefacept), Enbrel, Humira, Raptiva, Remicade, or a combination thereof; or a combination thereof.
  • the additional compound is an antibiotic, which in one embodiment comprise tetracycline, doxycline, minocycline, cloxacillin, cephalexin, penicillin, clindamycin or a combination thereof.
  • the additional compound is methotrexate, tar, coal tar, anthralin, dovonex, salicyclic acid, tazorac, moisturizers, aloe vera, soriatane, accutane, hydrea, mycophenolate mofetil, sulfasalazine, 6-thioguanine, or a combination thereof.
  • additional compounds comprise acyclovir, which in one embodiment is particularly effective in patients with eczema herpeticum.
  • additional compounds to treat seborrheic dermatitis comprise zinc pyrithione, selenium sulfide, sulfur, tar shampoo, flucinolone acetonide solution, triamcinolone acetonide lotion, ketoconazole cream, other imidazoles, or a combination thereof.
  • the additional compound is an anti-inflammatory agent, which in one embodiment comprises aspirin, ibuprofen, ketoprofen, naproxen, or a combination thereof.
  • the additional compound is a prostaglandin or prostaglandin inhibitor, which in one embodiment is an inhibitor of PGD2.
  • the additional compound is an exfoliant, which in one embodiment comprises an enzymatic exfoliant or a mono- or -poly-hydroxy acid.
  • the exfoliant is an alpha-hydroxy acid, beta-hydroxy acid, tannic acid, glycolic acid, lactic acid, citric acid, salicylic acid, or a combination thereof.
  • the additional compound is an analgesic, or anesthetic, while in another embodiment it is aloe vera gel, aloe vera, licorice extract, pilewort, Canadian willow root, zinc, allantoin, or a combination thereof.
  • the additional compound is an anti-oxidant.
  • fibroblast growth factor-9 protein is administered at a concentration of 10 ng/mL. In another embodiment, fibroblast growth factor-9 protein is administered at a concentration of 20 ng/mL. In another embodiment, fibroblast growth factor-9 protein is administered at a concentration of 40 ng/mL. In another embodiment, fibroblast growth factor-9 protein is administered at a concentration of 80 ng/mL. In another embodiment, fibroblast growth factor-9 protein is administered at a concentration of 5 ng/mL. In another embodiment, fibroblast growth factor-9 protein is administered at a concentration of 3 ng/mL.
  • fibroblast growth factor-9 protein is administered at a concentration of 1 ng/mL. In another embodiment, fibroblast growth factor-9 protein is administered at a concentration of between 1 and 50 ng/mL. In another embodiment, fibroblast growth factor-9 protein is administered at a concentration of between 1 and 15 ng/mL. Each dose represents a separate embodiment.
  • the doses utilized for the above described purposes will vary, but will be in an effective amount to exert the desired effect.
  • the term "pharmaceutically effective amount” refers to an amount of a FGF9 or other composition for use in the present invention, which will produce the desired alleviation in symptoms or other desired phenotype in a patient.
  • the doses utilized for any of the above-described purposes will generally be from 1 to about 1000 milligrams per kilogram of body weight (mg/kg), administered one to four times per day, or by continuous IV infusion.
  • a topical daily dose range in single or divided doses, for the conditions described herein is from about 1 mg to 20,000 mg, more preferably about 2,000 mg to 16,000 mg, and most preferably about 6,000 mg to 10,000 mg of the active components (i.e., excluding excipients and carriers).
  • the compositions When the compositions are dosed topically or intraocularly, they will generally be in a concentration range of from 0.1 to about 10% w/v, administered 1-4 times per day. In one embodiment, the compositions for use in the methods of the present invention are administered topically two times a day.
  • the concentrations of the compounds will depend on various factors, including the nature of the condition to be treated, the condition of the patient, the route of administration and the individual tolerability of the compositions.
  • the administering step is via topical administration. In another embodiment, the administering step is via subcutaneous administration.
  • the compound administered as part of methods of the present invention is administered systemically. In another embodiment, the compound is administered topically. In another embodiment, the compound is administered subepidermally. In another embodiment, the compound is administered subcutaneously. In another embodiment, the compound is administered transdermally. In another embodiment, the compound is administered to the site of the abrasion. In another embodiment, the compound is administered to the site of the wound induction. In another embodiment, the compound is administered to the site of the depilation. In another embodiment, the compound is administered during wound healing. In another embodiment, the compound is administered prior to HF neo-genesis. In another embodiment, the compound is administered during HF neo-genesis. Each possibility represents a separate embodiment of the present invention.
  • the route of administration may be directed to an organ or system that is affected by alopecia.
  • compounds may be administered topically to treat dermatologic conditions such as alopecia.
  • the route of administration may be directed to a different organ or system than the one that is affected by dermatologic conditions such as alopecia.
  • compounds may be administered parenterally to treat dermatologic conditions such as alopecia.
  • the present invention provides for the use of FGF9 or other composition for use in the present invention in various dosage forms suitable for administration using any of the routes listed hereinabove.
  • the methods of the present invention of testing a compound are repeated using a plurality of subjects, until a statistically significant sample has been tested.
  • FGF9 augments hair germ formation in embryonic tissue, but is not essential for hair germ formation.
  • FGF9 is necessary for hair follicle formation and/or size in adult tissue after epidermal disruption.
  • the signaling pathway for embryonic hair germ formation and for wound-induced hair follicle neogenesis share one or more components.
  • the signaling pathway for embryonic hair germ formation and for wound-induced hair follicle neogenesis is not identical.
  • FGF9 is essential for hair follicle formation in WIHF but not during ED 13.5.
  • the signaling pathway for hair growth signals differs in different parts of the body.
  • embryonic hair germ formation and wound-induced hair follicle neogenesis differ in their dependence on FGF9 due to the differences in their respective developmental stages and differences in location in the body.
  • the combination of FGF9 and wound healing increases its efficacy as a hair growth promoter.
  • FGF9 application alone causes epidermal thickening.
  • the invention provides a method of treating hair loss or regenerating hair follicles in a subject comprising the step of disrupting the epidermis in the region of said hair loss in said subject.
  • the method further comprises the step of recruiting the gamma-delta T cells to the wound epidermis.
  • the method further comprises the step of recruiting the gamma-delta T cells to the wound epidermis through cytokines.
  • mice were anesthetized with an injection of sodium pentobarbital before the hair on the back was clipped and depilated with Nair (Carter- Wallace, New York, NY), then epidermis was removed using a rotating felt wheel as described by Argyris T, J Invest Dermatol, 75: 360- 362, 1980). After scrubbing with 70% ethanol and drying under an incandescent lamp, the basal and supra-basal layers in an area of (1.5 cm) 2 cm of the inter-follicular epidermis were removed by careful abrasion with a felt wheel mounted on a Dremel Moto-tool (Racine, WI). After abrasion, the skin was shiny and smooth, and there was no blood.
  • Punch wound and excisional wound induction [00226] The backs of 21-day-old mice were depilated as described for Example 1 and sterilized with alcohol, followed by 1% iodine solution. Punch wounds, 4 mm in diameter, were induced using a dermal biopsy punch, down to, but not through, the muscle fascia. Excisional wounds were full thickness and 1 cm in diameter; skin and panniculus carnosus was excised using fine surgical scissors. Immunohistochemistry
  • HF whole mounts were obtained by incubating fresh skin with EDTA (2OmM in PBS) at 37 0 C overnight, then separating the epidermis and dermis. Epidermis was then fixed in 10% formalin for 10 min, room temperature (RT). Dermis was fixed in acetone overnight, RT. After rinsing with PBS, whole mounts were stained with antibodies for immunohistochemistry (schematically depicted in Figure 12) and were imaged using a Leica confocal microscope. Statistics
  • Hair follicle numbers are expressed as mean ⁇ s.d. The student's two-tailed t-test function in Excel was used to calculate P values. Embryonic mouse skin culture protocol
  • Two petri dishes with sterile PBS were prepared. Mothers were euthanized and embryos were dissected out in the sac. Embryos were placed into one petri dish. The embryos were dissected out of the sac and placed in a second clean petri dish with sterile PBS. The dish of embryos were placed on ice. Dorsal skin was dissected from the embryo under a dissecting scope, in a clean petri dish containing sterile PBS. [00233] The crown-rump length of the embryo was checked with a ruler to ensure it is El 3.5 stage. (-10-10.3 mm). The head of the embryo was removed with micro dissecting scissors.
  • a smaller pair of micro dissecting scissors were used to make incisions along both sides of the back, above the limbs.
  • a third incision was made across the back, anterior to the tail.
  • the skin was peeled from the tail towards the head.
  • the skin was laid onto the black side of nitrocellulose filter, as flat as possible.
  • the nitrocellulose filter was placed onto metal grid so that the skin is at the liquid-air interface.
  • the dish was incubated at 37°C.
  • FGF9 mRNA expression was evaluated in regenerated epidermis by quantitative real time-PCR. FGF9 was expressed at higher levels prior to the earliest stages of hair follicle regeneration at Day 1 after scab detachment (SD; which occurs at reepithelialization) compared to Day 5 after scab detachment when follicles have formed ( Figure 1). Skin ⁇ T-cells (detected by immunostaining using antibodies against ⁇ TCreceptor) repopulate the reepithelialized epidermis by SD7 ( Figure 2, left panel) and these cells express FGF9 protein at SDl (red dendritic cell in epidermis, Figure 2, right panel, and Figure 3).
  • FGF9 was selectively expressed prior to hair germ formation (during the undifferentiated period) rather than during differentiation.
  • Skin ⁇ T cells appeared to be the source of FGF9, which suggests inflammatory cells may have a role in Wound-induced hair follicle neogenesis (WIHN).
  • FGF9 EXPRESSED IN EMBRYONIC DAY 14 (E14) SKIN [00236] FGF9 (red staining) is expressed by ⁇ TC (green staining) in embryonic day 14 (E14) skin ( Figure 4). EXAMPLE 3
  • mice then received subepidermal injections of 50 ⁇ l of 10 ⁇ g/ml anti-FGF9 or
  • IgG2a isotype control on days SD1-SD4. Tissue samples were taken and analyzed at SD5.
  • Mouse FGF9 has 198 bp and greater than 99% homology with human FGF9 (with
  • FGF9 exists in both monomer (25-27kd) and dimer forms.
  • FGF9 plays a role in wound-induced hair follicle
  • embryonic skin explant cultures were treated for three days with recombinant human (rh)FGF9 (control, 10, 20, or 40 ng/mL) or with an anti-FGF9 neutralizing antibody (control, 10, 20, or 40 ⁇ g/mL) or IgG2a isotype control (10, 20, 40 ⁇ g/mL).
  • rh recombinant human
  • AP Alkaline phosphatase
  • K17 was used for epidermis immunostaining ( Figure 12).
  • RNeasy® fibrous tissue mini kit (Qiagen, 74704)
  • StepOneTM real-time PCR system (Applied Biosystems, P/N 4376373); Micro AmpTM 48- well optical adhesive film (Applied Biosystems, P/N 4375928); MicroAmpTM 48-well reaction plate (Applied Biosystems, P/N 4375816).
  • Embryonic skin culture E13.5 timed pregnant B57BL/6 female mice (Charles-River) were euthanized in CO 2 chamber. Embryos were dissected and placed in sterile cold PBS on ice. [00247] Preparation: Millipore nitrocellulose membrane (0.5 xl.O cm2); Autoclave metal grids; Culture dishes (Falcon center-well organ culture dish, 35-3037); 5% FBS-DMEM (Ix penicillin/streptomycin, not necessary to inactivate FBS). [00248] 2.5 mL of culture media was added and metal mesh and nitrocellulose membrane were set on the individual culture dishes. Embryonic back skin was dissected.
  • RNA concentration was measured by spectrophotometer and then converted to ⁇ g of total RNA to cDNA using High capacity cDNA reverse transcription kit (Applied Biosystems, P/N 4368814) with program in thermal cycler.
  • Real-time PCR [00252] PCR running program was set up and arranged the reaction plate layout with provided
  • StepOne software in comparative CT ( ⁇ CT) method The reaction mixture of target gene and
  • ⁇ -actin endogenous control were prepared together in triplicate.
  • cDNA template was diluted
  • reaction plate The plate is sealed tightly with optical adhesive film.
  • Lck-Cre uses the proximal promoter of the Lck (lymphocyte protein tyrosine kinase) gene, which is first expressed early in thymocyte development at the double negative stage. After T cells fully mature, the level of expression of this transgene decreases by approximately 10 fold.
  • Lck lymphocyte protein tyrosine kinase
  • K17-eGFP reporter mice (Bianchi et al., MoI Cell Biol., 2005 August; 25(16): 7249- 7259, incorporated herein by reference) are used to confirm the accumulation of FGF9- producing ⁇ T-cells around newly developing hair germs.
  • Fibroblast Growth Factor 9 (Fgf9) modulates hair follicle formation following wounding of adult mice. Forced overexpression of Fgf9 in the newly formed wound epidermis results in a 2-3-fold increase in the number of neogenic hair follicles.
  • ⁇ T cells which reside in the epidermis
  • Cre;floxed fgf9 transgenic mice results in a marked reduction of hair follicle neogenesis
  • mice lacking ⁇ T cells demonstrate severe impairment of follicular neogenesis.
  • these findings explain the robustness of hair follicle regeneration in mouse compared to human and highlight the important relationship between the immune system and tissue regeneration.
  • the isolated DETCs were cultured in RPMI- 1640 medium supplemented with 10% FCS, 25 mM HEPES, 100 U penicillin, lOO ⁇ g streptomycin, 2 mM glutamine, 100 ⁇ M nonessential amino acids, 1 mM sodium pyruvate, 50 ⁇ M 2-mercaptoethanol and 20 U/ml mIL-2.
  • the cells were harvested for 4 h in the growth factor-free media excluding FCS and mIL-2 and then incubated in the media described above supplemented with anti-CD3 ⁇ (10 ⁇ g/ml, eBioscience) at 37 0 C for 4, 24 and 48 h. Stimulation was arrested by the addition of ice-cold PBS and samples were placed on ice. Supernatants were removed and cells were collected with lysis buffer.
  • RNA isolation and subsequent cDNA generation were performed with Gene expression cells-to C T kit (Applied Biosystems).
  • Embryos at E13.5 were dissected out of the sac and the crown-lump length was checked to ensure exact developmental age. Dorsal skin was dissected and then cultured for up to 3 days as previously described. Recombinant human FGF- 9 (0-20 ng/ml, R&D systems) or EDAl (50 ng/ml, R&D systems) as a positive control were added into culture media. In addition, FGF9 neutralization experiment was paralleled with anti- FGF9 antibody incubation (0-40 ⁇ g/ml; MAB273, R&D systems). Epidermal-dermal separations were performed by incubating skin samples in 20 mM EDTA at 37 0 C for 5 min. Tissues were homogenized to isolated RNA or harvested for wholemount assay as described above. The number of hair follicles was counted per mm 2 at 3 different fields of each sample and the mean value was calculated.
  • Fgf9 expression significantly increases after wounding prior to hair follicle neogenesis: To define molecular events responsible for hair follicle neogenesis following wounding, we compared gene expression in wounded epidermis soon after reepithelialization (1 and 3 days after scab detachment "SD") to the initiation of hair follicle neogenesis (SD5). Microarray analyses showed that Fibroblast growth factor 9 (Fgf9) was significantly upregulated (4.2 fold) prior to hair follicle germ formation. We further analyzed Fgf9 gene expression changes in reepithelialized epidermis around the time of hair follicle neogenesis by quantitative RTPCR (Figure 16A).
  • Fgf9 gene expression increased significantly after reepithelialization until the initial stages of hair follicle neogenesis when expression decreased dramatically. These results show that Fgf9 is upregulated in the newly formed epidermis just prior to hair follicle neogenesis presumably at a time when cells are committing to the hair follicle lineage. [00274] Inhibition ofFg ⁇ decreases hair follicle neogenesis. Fgf9 is a secreted ligand with a known role in lung, kidney and gonad development, but it has not been previously implicated in hair follicle development or regeneration.
  • Fg ⁇ expression localizes to ⁇ T cells.
  • epithelialized skin of normal mice we immunostained tissue sections of healed skin prior to

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Veterinary Medicine (AREA)
  • General Health & Medical Sciences (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Engineering & Computer Science (AREA)
  • Medicinal Chemistry (AREA)
  • Chemical & Material Sciences (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Epidemiology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Dermatology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Zoology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Immunology (AREA)
  • Biomedical Technology (AREA)
  • Birds (AREA)
  • Medical Informatics (AREA)
  • Anesthesiology (AREA)
  • Hematology (AREA)
  • Heart & Thoracic Surgery (AREA)
  • Pathology (AREA)
  • Radiology & Medical Imaging (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Peptides Or Proteins (AREA)
  • Cosmetics (AREA)
PCT/US2009/064049 2005-03-29 2009-11-11 Fibroblast growth factor-9 promotes hair follicle regeneration after wounding Ceased WO2010056759A1 (en)

Priority Applications (13)

Application Number Priority Date Filing Date Title
US13/129,100 US8871711B2 (en) 2008-11-12 2009-11-11 Fibroblast growth factor-9 promotes hair follicle regeneration after wounding
AU2009314147A AU2009314147B2 (en) 2008-11-12 2009-11-11 Fibroblast growth factor-9 promotes hair follicle regeneration after wounding
EP09826682.8A EP2361119B1 (en) 2008-11-12 2009-11-11 Fibroblast growth factor-9 promotes hair follicle regeneration after wounding
KR1020177005200A KR20170024148A (ko) 2008-11-12 2009-11-11 손상된 모낭의 재생을 촉진하는 섬유모세포 성장 인자-9
CA2743610A CA2743610C (en) 2008-11-12 2009-11-11 Fibroblast growth factor-9 promotes hair follicle regeneration after wounding
KR1020117013171A KR101711995B1 (ko) 2008-11-12 2009-11-11 손상된 모낭의 재생을 촉진하는 섬유모세포 성장 인자-9
JP2011536441A JP5723780B2 (ja) 2008-11-12 2009-11-11 創傷形成後の毛包再生を促進する繊維芽細胞増殖因子‐9
BRPI0915262-8A BRPI0915262B1 (pt) 2008-11-12 2009-11-11 Composição compreendendo um polipeptídeo de fator-9 de crescimento de fibroblasto
IL212858A IL212858A (en) 2008-11-12 2011-05-12 Fibroblastic growth factor-9 to encourage hair follicle rejuvenation after skin injury
US14/505,970 US20150216934A1 (en) 2008-11-12 2014-10-03 Fibroblast growth factor-9 promotes hair follicle regeneration after wounding
IL249309A IL249309A0 (en) 2008-11-12 2016-11-30 Fibroblastic growth factor-9 to encourage regeneration of hair follicles after skin injury
US16/004,277 US20180280475A1 (en) 2008-11-12 2018-06-08 Fibroblast growth factor-9 promotes hair follicle regeneration after wounding
US16/260,034 US20200197488A1 (en) 2005-03-29 2019-01-28 Compositions and methods for treating hair loss

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US11402808P 2008-11-12 2008-11-12
US61/114,028 2008-11-12

Related Parent Applications (1)

Application Number Title Priority Date Filing Date
US16/222,705 Continuation US20200101000A1 (en) 2005-03-29 2018-12-17 Methods for generating new hair follicles, treating baldness, and hair removal

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US13/129,100 A-371-Of-International US8871711B2 (en) 2008-11-12 2009-11-11 Fibroblast growth factor-9 promotes hair follicle regeneration after wounding
US14/505,970 Continuation US20150216934A1 (en) 2005-03-29 2014-10-03 Fibroblast growth factor-9 promotes hair follicle regeneration after wounding

Publications (1)

Publication Number Publication Date
WO2010056759A1 true WO2010056759A1 (en) 2010-05-20

Family

ID=42170304

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2009/064049 Ceased WO2010056759A1 (en) 2005-03-29 2009-11-11 Fibroblast growth factor-9 promotes hair follicle regeneration after wounding

Country Status (9)

Country Link
US (4) US8871711B2 (https=)
EP (2) EP3144034A1 (https=)
JP (1) JP5723780B2 (https=)
KR (2) KR101711995B1 (https=)
AU (2) AU2009314147B2 (https=)
BR (1) BRPI0915262B1 (https=)
CA (1) CA2743610C (https=)
IL (2) IL212858A (https=)
WO (1) WO2010056759A1 (https=)

Cited By (10)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
GB2485475A (en) * 2010-11-10 2012-05-16 Pangaea Lab Ltd Topical growth factor application using controlled and multiple wounding of the skin
EP2735303A1 (en) * 2012-11-23 2014-05-28 Pilosciences Hair growth compositions and methods
US9220926B2 (en) 2005-03-29 2015-12-29 The Trustees Of The University Of Pennsylvania Methods for generating new hair follicles, treating baldness, and hair removal
EP3144034A1 (en) 2008-11-12 2017-03-22 The Trustees of the University of Pennsylvania Shh signaling pathway stimulating agents for treating hair loss
KR101841482B1 (ko) * 2016-02-25 2018-03-23 (주)피앤피바이오팜 안정성이 증가된 인간 섬유아세포 성장인자-9 변이체 및 이의 용도
CN110551692A (zh) * 2019-07-09 2019-12-10 吕贯廷 hFGF9基因修饰型间充质干细胞及其制备方法和用途
EP3710060A4 (en) * 2017-11-16 2021-05-19 Aivita Biomedical, Inc. USE OF CELL MEMBRANE-RELATED SIGNALING FACTORS
US11207511B2 (en) 2010-12-06 2021-12-28 Follica, Inc. Methods for treating baldness and promoting hair growth
WO2022165313A1 (en) 2021-02-01 2022-08-04 Regenxbio Inc. Gene therapy for neuronal ceroid lipofuscinoses
CN118286487A (zh) * 2024-04-01 2024-07-05 吉林农业大学 一种促进复杂感染伤口愈合的多功能纳米纤维膜的制备方法

Families Citing this family (11)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
AU2011293132C1 (en) 2010-08-27 2016-04-21 Sebacia, Inc. Compositions and methods for targeted thermomodulation
US9572880B2 (en) 2010-08-27 2017-02-21 Sienna Biopharmaceuticals, Inc. Ultrasound delivery of nanoparticles
CA2887687A1 (en) 2012-10-11 2014-04-17 Nanocomposix, Inc. Silver nanoplate compositions and methods
KR101578901B1 (ko) 2013-09-11 2015-12-28 (주)셀아이콘랩 발모 촉진 펩타이드, 이의 제조방법, 및, 이를 함유하는 탈모방지 또는 발모촉진용 조성물
WO2015164800A2 (en) * 2014-04-24 2015-10-29 University Of Central Florida Research Foundation, Inc. Compositions and methods for modulating polarization of monocytes
KR102535575B1 (ko) * 2016-02-26 2023-05-23 (주)피앤피바이오팜 고안정성 섬유아세포 성장인자-9 변이체를 유효성분으로 포함하는 헤어케어 화장품 조성물
CA3189833A1 (en) * 2020-05-12 2021-11-18 Chemistry Rx Methods for treating hair loss and compositions for same
CA3207296A1 (en) * 2021-01-06 2022-07-14 The Penn State Research Foundation Methods and materials for treating hair loss
US12268677B2 (en) 2022-04-27 2025-04-08 The Penn State Research Foundation 4-aminopyridine (4-AP) and bone morphogenetic protein 2 (BMP-2)
WO2024213518A1 (en) * 2023-04-12 2024-10-17 Estetra Srl Topical compositions for promoting hair growth
CN118161418B (zh) * 2024-05-14 2024-07-23 美归(成都)生物材料合伙企业(有限合伙) 保湿美白脂质体精华液及其制备方法

Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JP2003192541A (ja) * 2001-12-26 2003-07-09 Pola Chem Ind Inc 育毛促進剤及び育毛用の皮膚外用剤
WO2006105109A2 (en) * 2005-03-29 2006-10-05 The Trustees Of The University Of Pennsylvania Methods for generating new hair follicles, treating baldness, and hair removal
US20070092496A1 (en) * 2005-10-17 2007-04-26 Aderans Research Institute, Inc. Method of delivering cells to the skin
US20070243132A1 (en) * 2005-12-22 2007-10-18 Apollo Life Sciences Limited Transdermal delivery of pharmaceutical agents

Family Cites Families (11)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JPH04224522A (ja) 1990-04-27 1992-08-13 Merck & Co Inc 繊維芽細胞増殖因子含有組成物による禿頭症の治療又は予防方法
JPH10279501A (ja) 1997-02-10 1998-10-20 Rohto Pharmaceut Co Ltd 育毛剤
US20070009544A1 (en) * 1999-06-17 2007-01-11 Ronit Eisenberg Anti-allergic complex molecules
WO2001074164A1 (en) * 2000-03-31 2001-10-11 The General Hospital Corporation Methods of modulating hair growth
US7588937B2 (en) * 2001-10-03 2009-09-15 Wisconsin Alumni Research Foundation Method of in vitro differentiation of neural stem cells, motor neurons and dopamine neurons from primate embryonic stem cells
US20070299032A1 (en) 2003-11-11 2007-12-27 Shiseido Company, Ltd. Method and Composition for Thickening Hair
AR057628A1 (es) 2005-11-22 2007-12-05 Aderans Res Inst Inc Injertos capilares derivados de cabello extirpado
US7714014B2 (en) * 2005-12-09 2010-05-11 The Regents Of The University Of California Targeting GLI proteins in human cancer by small molecules
EP1986731A4 (en) 2006-02-09 2012-11-07 Aderans Res Inst Inc APPARATUS AND METHODS FOR DELIVERING FLUID AND MATERIAL TO A SUBJECT
US8273747B2 (en) 2006-11-02 2012-09-25 Curis, Inc. Small organic molecule regulators of cell proliferation
KR101711995B1 (ko) * 2008-11-12 2017-03-06 더 트러스티스 오브 더 유니버시티 오브 펜실베니아 손상된 모낭의 재생을 촉진하는 섬유모세포 성장 인자-9

Patent Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JP2003192541A (ja) * 2001-12-26 2003-07-09 Pola Chem Ind Inc 育毛促進剤及び育毛用の皮膚外用剤
WO2006105109A2 (en) * 2005-03-29 2006-10-05 The Trustees Of The University Of Pennsylvania Methods for generating new hair follicles, treating baldness, and hair removal
US20070092496A1 (en) * 2005-10-17 2007-04-26 Aderans Research Institute, Inc. Method of delivering cells to the skin
US20070243132A1 (en) * 2005-12-22 2007-10-18 Apollo Life Sciences Limited Transdermal delivery of pharmaceutical agents

Non-Patent Citations (13)

* Cited by examiner, † Cited by third party
Title
"Current Protocols in Molecular Biology", 1989, GREENE PUBLISHING ASSOCIATES
"Methods in Enzymology", vol. 1-317, ACADEMIC PRESS
"Molecular Cloning: A Laboratory Manual", 1989, COLD SPRING HARBOR LABORATORY PRESS
"Quantitative Drug Design", 1992, PERGAMON PRESS
ARGYRIS T, J INVEST DERMATOL, vol. 75, 1980, pages 360 - 362
AUSUBEL ET AL.: "Current Protocols in Molecular Biology", 1994, JOHN WILEY & SONS
BIANCHI ET AL., MOL CELL BIOL, vol. 25, no. 16, August 2005 (2005-08-01), pages 7249 - 7259
DIAMOND ET AL., J. INVEST. DERMATOL., vol. 115, 2000, pages 788 - 794
LEE ET AL., IMMUNITY, vol. 15, no. 5, November 2001 (2001-11-01), pages 763 - 74
MANIATIS ET AL.: "Molecular Cloning, A Laboratory Manual", 1990, COLD SPRING HARBOR
PAUS R ET AL., J INVEST DERMATOL, 1999
See also references of EP2361119A4
WHITE ET AL., DEVELOPMENT, vol. 133, 2006, pages 1507 - 1517

Cited By (17)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US9700502B2 (en) 2005-03-29 2017-07-11 The Trustees Of The University Of Pennsylvania Methods for generating new hair follicles, treating baldness, and hair removal
US9642789B2 (en) 2005-03-29 2017-05-09 The Trustees Of The University Of Pennsylvania Methods for generating new hair follicles, treating baldness, and hair removal
US9220926B2 (en) 2005-03-29 2015-12-29 The Trustees Of The University Of Pennsylvania Methods for generating new hair follicles, treating baldness, and hair removal
EP3144034A1 (en) 2008-11-12 2017-03-22 The Trustees of the University of Pennsylvania Shh signaling pathway stimulating agents for treating hair loss
GB2485475A (en) * 2010-11-10 2012-05-16 Pangaea Lab Ltd Topical growth factor application using controlled and multiple wounding of the skin
US11207511B2 (en) 2010-12-06 2021-12-28 Follica, Inc. Methods for treating baldness and promoting hair growth
US12263323B2 (en) 2010-12-06 2025-04-01 Follica, Inc. Methods for treating baldness and promoting hair growth
WO2014080015A3 (en) * 2012-11-23 2014-07-24 Pilosciences Hair growth compositions and methods
EP2735303A1 (en) * 2012-11-23 2014-05-28 Pilosciences Hair growth compositions and methods
KR101841482B1 (ko) * 2016-02-25 2018-03-23 (주)피앤피바이오팜 안정성이 증가된 인간 섬유아세포 성장인자-9 변이체 및 이의 용도
US12268770B2 (en) 2017-11-16 2025-04-08 Aivita Biomedical, Inc. Use of cell membrane-bound signaling factors
EP3710060A4 (en) * 2017-11-16 2021-05-19 Aivita Biomedical, Inc. USE OF CELL MEMBRANE-RELATED SIGNALING FACTORS
EP3970695A1 (en) * 2017-11-16 2022-03-23 Aivita Biomedical, Inc. Use of cell membrane-bound signaling factors
US11666522B2 (en) 2017-11-16 2023-06-06 Aivita Biomedical, Inc. Use of cell membrane-bound signaling factors
CN110551692A (zh) * 2019-07-09 2019-12-10 吕贯廷 hFGF9基因修饰型间充质干细胞及其制备方法和用途
WO2022165313A1 (en) 2021-02-01 2022-08-04 Regenxbio Inc. Gene therapy for neuronal ceroid lipofuscinoses
CN118286487A (zh) * 2024-04-01 2024-07-05 吉林农业大学 一种促进复杂感染伤口愈合的多功能纳米纤维膜的制备方法

Also Published As

Publication number Publication date
KR101711995B1 (ko) 2017-03-06
AU2009314147A1 (en) 2010-05-20
US8871711B2 (en) 2014-10-28
EP2361119B1 (en) 2018-09-19
IL212858A (en) 2016-12-29
US20180280475A1 (en) 2018-10-04
AU2009314147B2 (en) 2015-12-24
KR20110092301A (ko) 2011-08-17
IL249309A0 (en) 2017-01-31
EP2361119A4 (en) 2014-01-08
JP5723780B2 (ja) 2015-05-27
JP2012508750A (ja) 2012-04-12
EP2361119A1 (en) 2011-08-31
US20150216934A1 (en) 2015-08-06
US20200197488A1 (en) 2020-06-25
KR20170024148A (ko) 2017-03-06
US20110282267A1 (en) 2011-11-17
AU2016201796A1 (en) 2016-05-05
BRPI0915262A2 (pt) 2016-02-16
EP3144034A1 (en) 2017-03-22
CA2743610A1 (en) 2010-05-20
BRPI0915262B1 (pt) 2018-06-05
IL212858A0 (en) 2011-07-31
CA2743610C (en) 2021-04-27

Similar Documents

Publication Publication Date Title
CA2743610C (en) Fibroblast growth factor-9 promotes hair follicle regeneration after wounding
US5753612A (en) Pharmaceutical composition and method for inhibiting hair growth by administration of activin or activin agonists
US9220926B2 (en) Methods for generating new hair follicles, treating baldness, and hair removal
US5788967A (en) Composition and method for enhancing wound healing
US20130172252A1 (en) Methods for promoting hair growth
TW201210601A (en) Compounds and methods for skin repair
AU2003209338B2 (en) Methods and compositions for the promotion of hair growth utilizing actin binding peptides
AU2003209338A1 (en) Methods and compositions for the promotion of hair growth utilizing actin binding peptides
CN113876955A (zh) Pcsk9抑制剂在制备促进毛发生长产品中的应用
JP2000500162A (ja) 瘢痕の形成を減少するためのベータグリカンの使用
AU2012204059B2 (en) Methods for generating new hair follicles, treating baldness and hair removal
Messenger European Hair Research Society 12th Annual Meeting

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 09826682

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 2011536441

Country of ref document: JP

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 2743610

Country of ref document: CA

Ref document number: 2009314147

Country of ref document: AU

Ref document number: 212858

Country of ref document: IL

WWE Wipo information: entry into national phase

Ref document number: 2009826682

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 2009314147

Country of ref document: AU

Date of ref document: 20091111

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 20117013171

Country of ref document: KR

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 13129100

Country of ref document: US

ENP Entry into the national phase

Ref document number: PI0915262

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20110512

WWE Wipo information: entry into national phase

Ref document number: 249309

Country of ref document: IL