WO2010022225A1 - Dock-and-lock (dnl) vaccines for cancer therapy - Google Patents

Dock-and-lock (dnl) vaccines for cancer therapy Download PDF

Info

Publication number
WO2010022225A1
WO2010022225A1 PCT/US2009/054441 US2009054441W WO2010022225A1 WO 2010022225 A1 WO2010022225 A1 WO 2010022225A1 US 2009054441 W US2009054441 W US 2009054441W WO 2010022225 A1 WO2010022225 A1 WO 2010022225A1
Authority
WO
WIPO (PCT)
Prior art keywords
antibody
cancer
seq
moiety
antigen
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2009/054441
Other languages
English (en)
French (fr)
Other versions
WO2010022225A9 (en
Inventor
Chien-Hsing Chang
David M. Goldenberg
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
IBC Pharmaceuticals Inc
Original Assignee
IBC Pharmaceuticals Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by IBC Pharmaceuticals Inc filed Critical IBC Pharmaceuticals Inc
Priority to CN200980141590.7A priority Critical patent/CN102186499B/zh
Priority to EP09808814A priority patent/EP2326346A4/en
Priority to CA2734265A priority patent/CA2734265C/en
Priority to AU2009282830A priority patent/AU2009282830B2/en
Priority to JP2011523987A priority patent/JP5870404B2/ja
Publication of WO2010022225A1 publication Critical patent/WO2010022225A1/en
Anticipated expiration legal-status Critical
Publication of WO2010022225A9 publication Critical patent/WO2010022225A9/en
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/0005Vertebrate antigens
    • A61K39/0011Cancer antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/0005Vertebrate antigens
    • A61K39/0011Cancer antigens
    • A61K39/001102Receptors, cell surface antigens or cell surface determinants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/0005Vertebrate antigens
    • A61K39/0011Cancer antigens
    • A61K39/001102Receptors, cell surface antigens or cell surface determinants
    • A61K39/001103Receptors for growth factors
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/0005Vertebrate antigens
    • A61K39/0011Cancer antigens
    • A61K39/001102Receptors, cell surface antigens or cell surface determinants
    • A61K39/001103Receptors for growth factors
    • A61K39/001104Epidermal growth factor receptors [EGFR]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/0005Vertebrate antigens
    • A61K39/0011Cancer antigens
    • A61K39/001102Receptors, cell surface antigens or cell surface determinants
    • A61K39/001103Receptors for growth factors
    • A61K39/001109Vascular endothelial growth factor receptors [VEGFR]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/0005Vertebrate antigens
    • A61K39/0011Cancer antigens
    • A61K39/001102Receptors, cell surface antigens or cell surface determinants
    • A61K39/001111Immunoglobulin superfamily
    • A61K39/001112CD19 or B4
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/0005Vertebrate antigens
    • A61K39/0011Cancer antigens
    • A61K39/001102Receptors, cell surface antigens or cell surface determinants
    • A61K39/001111Immunoglobulin superfamily
    • A61K39/001113CD22, BL-CAM, siglec-2 or sialic acid- binding Ig-related lectin 2
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/0005Vertebrate antigens
    • A61K39/0011Cancer antigens
    • A61K39/001102Receptors, cell surface antigens or cell surface determinants
    • A61K39/001111Immunoglobulin superfamily
    • A61K39/001114CD74, Ii, MHC class II invariant chain or MHC class II gamma chain
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/0005Vertebrate antigens
    • A61K39/0011Cancer antigens
    • A61K39/001102Receptors, cell surface antigens or cell surface determinants
    • A61K39/001116Receptors for cytokines
    • A61K39/001117Receptors for tumor necrosis factors [TNF], e.g. lymphotoxin receptor [LTR] or CD30
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/0005Vertebrate antigens
    • A61K39/0011Cancer antigens
    • A61K39/001102Receptors, cell surface antigens or cell surface determinants
    • A61K39/001124CD20
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/0005Vertebrate antigens
    • A61K39/0011Cancer antigens
    • A61K39/001102Receptors, cell surface antigens or cell surface determinants
    • A61K39/001126CD38 not IgG
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/0005Vertebrate antigens
    • A61K39/0011Cancer antigens
    • A61K39/001102Receptors, cell surface antigens or cell surface determinants
    • A61K39/001129Molecules with a "CD" designation not provided for elsewhere
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/0005Vertebrate antigens
    • A61K39/0011Cancer antigens
    • A61K39/00113Growth factors
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/0005Vertebrate antigens
    • A61K39/0011Cancer antigens
    • A61K39/00113Growth factors
    • A61K39/001135Vascular endothelial growth factor [VEGF]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/0005Vertebrate antigens
    • A61K39/0011Cancer antigens
    • A61K39/001136Cytokines
    • A61K39/001138Tumor necrosis factors [TNF] or CD70
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/0005Vertebrate antigens
    • A61K39/0011Cancer antigens
    • A61K39/001136Cytokines
    • A61K39/00114Interleukins [IL]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/0005Vertebrate antigens
    • A61K39/0011Cancer antigens
    • A61K39/001148Regulators of development
    • A61K39/001149Cell cycle regulated proteins, e.g. cyclin, CDC, CDK or INK-CCR
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/0005Vertebrate antigens
    • A61K39/0011Cancer antigens
    • A61K39/001148Regulators of development
    • A61K39/00115Apoptosis related proteins, e.g. survivin or livin
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/0005Vertebrate antigens
    • A61K39/0011Cancer antigens
    • A61K39/001148Regulators of development
    • A61K39/00115Apoptosis related proteins, e.g. survivin or livin
    • A61K39/001151Apoptosis related proteins, e.g. survivin or livin p53
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/0005Vertebrate antigens
    • A61K39/0011Cancer antigens
    • A61K39/001152Transcription factors, e.g. SOX or c-MYC
    • A61K39/001153Wilms tumor 1 [WT1]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/0005Vertebrate antigens
    • A61K39/0011Cancer antigens
    • A61K39/001154Enzymes
    • A61K39/001162Kinases, e.g. Raf or Src
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/0005Vertebrate antigens
    • A61K39/0011Cancer antigens
    • A61K39/001154Enzymes
    • A61K39/001163Phosphatases
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/0005Vertebrate antigens
    • A61K39/0011Cancer antigens
    • A61K39/001166Adhesion molecules, e.g. NRCAM, EpCAM or cadherins
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/0005Vertebrate antigens
    • A61K39/0011Cancer antigens
    • A61K39/001169Tumor associated carbohydrates
    • A61K39/00117Mucins, e.g. MUC-1
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/0005Vertebrate antigens
    • A61K39/0011Cancer antigens
    • A61K39/001176Heat shock proteins
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/0005Vertebrate antigens
    • A61K39/0011Cancer antigens
    • A61K39/00118Cancer antigens from embryonic or fetal origin
    • A61K39/001181Alpha-feto protein
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/0005Vertebrate antigens
    • A61K39/0011Cancer antigens
    • A61K39/00118Cancer antigens from embryonic or fetal origin
    • A61K39/001182Carcinoembryonic antigen [CEA]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/0005Vertebrate antigens
    • A61K39/0011Cancer antigens
    • A61K39/001184Cancer testis antigens, e.g. SSX, BAGE, GAGE or SAGE
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/0005Vertebrate antigens
    • A61K39/0011Cancer antigens
    • A61K39/001184Cancer testis antigens, e.g. SSX, BAGE, GAGE or SAGE
    • A61K39/001186MAGE
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/0005Vertebrate antigens
    • A61K39/0011Cancer antigens
    • A61K39/001184Cancer testis antigens, e.g. SSX, BAGE, GAGE or SAGE
    • A61K39/001188NY-ESO
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/0005Vertebrate antigens
    • A61K39/0011Cancer antigens
    • A61K39/001184Cancer testis antigens, e.g. SSX, BAGE, GAGE or SAGE
    • A61K39/001189PRAME
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/0005Vertebrate antigens
    • A61K39/0011Cancer antigens
    • A61K39/00119Melanoma antigens
    • A61K39/001191Melan-A/MART
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/0005Vertebrate antigens
    • A61K39/0011Cancer antigens
    • A61K39/00119Melanoma antigens
    • A61K39/001192Glycoprotein 100 [Gp100]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/0005Vertebrate antigens
    • A61K39/0011Cancer antigens
    • A61K39/001193Prostate associated antigens e.g. Prostate stem cell antigen [PSCA]; Prostate carcinoma tumor antigen [PCTA]; PAP or PSGR
    • A61K39/001194Prostate specific antigen [PSA]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/0005Vertebrate antigens
    • A61K39/0011Cancer antigens
    • A61K39/001193Prostate associated antigens e.g. Prostate stem cell antigen [PSCA]; Prostate carcinoma tumor antigen [PCTA]; PAP or PSGR
    • A61K39/001195Prostate specific membrane antigen [PSMA]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/10Cellular immunotherapy characterised by the cell type used
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/10Cellular immunotherapy characterised by the cell type used
    • A61K40/19Dendritic cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/20Cellular immunotherapy characterised by the effect or the function of the cells
    • A61K40/24Antigen-presenting cells [APC]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6891Pre-targeting systems involving an antibody for targeting specific cells
    • A61K47/6897Pre-targeting systems with two or three steps using antibody conjugates; Ligand-antiligand therapies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • A61P35/02Antineoplastic agents specific for leukemia
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • A61P37/04Immunostimulants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • BPERFORMING OPERATIONS; TRANSPORTING
    • B82NANOTECHNOLOGY
    • B82YSPECIFIC USES OR APPLICATIONS OF NANOSTRUCTURES; MEASUREMENT OR ANALYSIS OF NANOSTRUCTURES; MANUFACTURE OR TREATMENT OF NANOSTRUCTURES
    • B82Y5/00Nanobiotechnology or nanomedicine, e.g. protein engineering or drug delivery
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2833Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against MHC-molecules, e.g. HLA-molecules
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2887Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against CD20
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • C07K16/3007Carcino-embryonic Antigens
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/46Hybrid immunoglobulins
    • C07K16/468Immunoglobulins having two or more different antigen binding sites, e.g. multifunctional antibodies
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12YENZYMES
    • C12Y207/00Transferases transferring phosphorus-containing groups (2.7)
    • C12Y207/11Protein-serine/threonine kinases (2.7.11)
    • C12Y207/11011Protein-serine/threonine kinases (2.7.11) cAMP-dependent protein kinase (2.7.11.11)
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/60Medicinal preparations containing antigens or antibodies characteristics by the carrier linked to the antigen
    • A61K2039/6031Proteins
    • A61K2039/6056Antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/62Medicinal preparations containing antigens or antibodies characterised by the link between antigen and carrier
    • A61K2039/625Medicinal preparations containing antigens or antibodies characterised by the link between antigen and carrier binding through the biotin-streptavidin system or similar
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/31Indexing codes associated with cellular immunotherapy of group A61K40/00 characterized by the route of administration
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/38Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the dose, timing or administration schedule
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/46Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the cancer treated
    • A61K2239/48Blood cells, e.g. leukemia or lymphoma
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/31Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/51Complete heavy chain or Fd fragment, i.e. VH + CH1
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52Constant or Fc region; Isotype
    • C07K2317/522CH1 domain
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52Constant or Fc region; Isotype
    • C07K2317/526CH3 domain
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/55Fab or Fab'
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/77Internalization into the cell
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/30Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto

Definitions

  • the present invention relates to the design and generation of dendritic cell-based, in vivo antigen targeting vaccines for therapy of cancer, such as multiple myeloma.
  • the vaccines are generated by the dock-and-lock (DNL) method, in which effector moieties are attached to anchoring domain (AD) derived from AKAP proteins and dimerization and docking domain (DDD) moieties derived from protein kinase A (PKA).
  • DNL complexes are generated when DDD moieties spontaneously dimerize and bind to an AD moiety, resulting in a complex with a 2: 1 stoichiometry between DDD and AD-linked effectors.
  • the effector moieties comprise a humanized anti- CD74 antibody and a tumor-associated xenoantigen, such as a CD20 xenoantigen.
  • the anti-CD74 antibody is an hLLl antibody.
  • the DNL constructs are of use for preparation of pharmaceutical compositions, for generation of vaccines against cancers, such as multiple myeloma (MM), and for induction of an immune response against tumor antigen-expressing cells, such as CD20 positive cancer cells in patients with multiple myeloma or other CD20-expressing cancers.
  • MM multiple myeloma
  • MM is a hematological malignancy characterized by clonal proliferation of neoplastic plasma cells in the bone marrow.
  • chemotherapeutic agents Although responsive to many chemotherapeutic agents, MM remains largely incurable and the majority of patients ultimately relapse, due to the existence of a minor population of MM cancer stem cells that survive standard or high-dose chemotherapy and are resistant to chemotherapeutic drugs (Reece et al., Leuk Lymphoma, 2008, 49:1470-85).
  • This small number of MM cancer stem cells constitutes the minimal residual disease and causes relapse, eventually leading to the failure of all treatments.
  • eradication of MM cancer stem cells may offer a long-term control or even cure of MM.
  • CD138 neg CD20 + cells represent the putative multiple myeloma cancer stem cells (Huff and Matsui, J Clin Oncol. 2008, 26:2895-900).
  • MM cancer stem cells are refractory to multiple chemotherapeutic drugs and responsible for tumor re-growth and relapse (Huff and Matsui, J Clin Oncol. 2008, 26:2895-900; Yang and Chang, Cancer Invest. 2008, 26:741-55).
  • Strategies and approaches that could selectively target and eradicate cancer stem cells, such as MM stem cells, are needed. Due to the multiple drug resistance in cancer stem cells, immunotherapy and vaccination may offer a potential modality to eradicate these cells, particularly after standard therapies and/or stem cell transplantation, the time when tumor load is greatly reduced.
  • the present invention discloses methods and compositions for vaccines against cancer stem cells, such as MM stem cells, that are prepared using the Dock-and-Lock (DNL) method (Chang et al., 2007, Clin Cancer Res 13:5586s-91s).
  • the DNL technique has been used to generate a variety of stable and defined complexes suitable for in vivo applications.
  • the DNL complexes comprise an anti-CD74 antibody or antigen binding fragment thereof, such as the hLLl antibody, attached to a dimerization and docking domain (DDD) or anchor domain (AD) moiety.
  • DDD dimerization and docking domain
  • AD anchor domain
  • a complementary AD or DDD moiety is attached to a CD20 xenoantigen, as described in further detail below, resulting in formation of DNL complexes comprising anti-CD74 moieties and CD20 xenoantigen moieties.
  • the antibody component directs the DNL complex to antigen presenting cells (APCs), such as dendritic cells (DCs), while the xenoantigen component is processed to invoke an immune response against cells expressing the target antigen.
  • APCs antigen presenting cells
  • DCs dendritic cells
  • Various types of DNL complexes with different structures and different ratios of target antigen (e.g., CD20) to antibody or antibody fragment may be constructed and used within the scope of the claimed methods and compositions, such as those disclosed in U.S. Patent No. 7,550,143 (incorporated herein by reference from Col. 28, line 30 through Col. 44, line 28); U.S. Patent No. 7,521,056 (incorporated herein by reference from Col. 58, line 1 through Col. Col. 84, line 45); U.S. Patent No. 7,534,866 (incorporated herein by reference from Col. 31, line 1 through Col. 36, line 38); U.S. Patent No. 7,527,787 (incorporated herein by reference from Col. 61, line 51 through Col.
  • target antigen e.g., CD20
  • DNL complexes comprised of trimeric, tetrameric, pentameric, hexameric and other structures have been reported in the above-cited issued patents.
  • the anti-cancer vaccine DNL construct comprises a humanized, or chimeric LLl anti-CD74 antibody or antigen-binding fragment thereof comprising the light chain variable complementarity-determining region (CDR) sequences CDRl (RSSQSLVHRNGNTYLH; SEQ ID NO: 1), CDR2 (TVSNRFS; SEQ ID NO:2), and CDR3 (SQSSHVPPT; SEQ ID NO:3) and the heavy chain variable region CDR sequences CDRl (NYGVN; SEQ ID NO:4), CDR2 (WINPNTGEPTFDDDFKG; SEQ ID NO:5), and CDR3 (SRGKNEAWFAY; SEQ ID NO:6).
  • CDR light chain variable complementarity-determining region
  • a humanized LLl (hLLl) anti-CD74 antibody suitable for use in the claimed DNL complexes is disclosed in U.S. Patent No. 7,312,318, incorporated herein by reference from Col. 35, line 1 through Col. 42, line 27 and FIG. 1 through FIG. 4.
  • other anti-CD74 antibodies or antibodies against other APC- or DC-associated antigens may be utilized.
  • CD20 xenoantigens suitable for use in the anti-cancer vaccine DNL complex are known in the art, such as the murine CD20 sequence (SEQ ID NO:7).
  • Other CD20 amino acid sequences of potential use are readily available to the skilled artisan through such well-known public databases as the NCBI protein database (see, e.g., NCBI Accession Nos. NP 031667; P 19437; AAA37394; BAE47068; ABA29631; BAD77809).
  • the murine CD20 sequence is recited herein, the skilled artisan will realize that CD20 amino acid sequences are known and readily available from a wide variety of species and can be incorporated into the anti-cancer vaccine DNL complex.
  • TAAs tumor-associated antigens
  • TAAs tumor-associated antigens
  • TAAs of potential use include, but are not limited to, carbonic anhydrase IX, alpha- fetoprotein, ⁇ -actinin-4, A3, antigen specific for A33 antibody, ART-4, B7, Ba 733, BAGE, BrE3-antigen, CA125, CAMEL, CAP-I, CASP-8/m, , CCCL19, CCCL21, CDl, CDIa, CD2, CD3, CD4, CD5, CD8, CDl IA, CD14, CD15, CD16, CD18, CD19, CD20, CD21, CD22, CD23, CD25, CD29, CD30, CD32b, CD33, CD37, CD38, CD40, CD40L, CD45, CD46, CD52, CD54, CD55, CD59, CD64, CD66a-e, CD67, CD70, CD74, CD79a, CD80, CD83, CD95, CD126, CD133, CD138, CD147, CD154, CDC27, CDK-4/m
  • Xenoantigen amino acid sequences such as murine protein amino acid sequences, may be readily obtained from public databases, such as the NCBI protein database.
  • NCBI protein database may be readily obtained from public databases, such as the NCBI protein database.
  • the antibody binds to an antigen expressed by APCs, more preferably dendritic cells.
  • antigens associated with dendritic cells are known in the art, including but not limited to CD209 (DC-SIGN), CD34, CD74, CD205, TLR 2 (toll-like receptor 2), TLR 4, TLR 7, TLR 9, BDC A-2, BDC A-3, BDC A-4, and HLA- DR.
  • the target antigen is CD74.
  • anti-cancer vaccine DNL constructs incorporating antibodies that target any such alternative antigen may be utilized in the claimed methods and compositions.
  • the anti-cancer vaccine DNL constructs may comprise an anti-CD74 antibody or antigen-binding fragment thereof and another anti-dendritic cell antibody or fragment.
  • Exemplary antibodies that may be utilized in the anti -cancer vaccine DNL constructs include, but are not limited to, hLLl (anti-CD74, U.S. Patent No. 7,312,318) and hL243 (anti-HLA-DR, U.S. Patent Application No. 11/368,296) the Examples section of each incorporated herein by reference.
  • hLLl anti-CD74, U.S. Patent No. 7,312,3178
  • hL243 anti-HLA-DR, U.S. Patent Application No. 11/368,296
  • the use of chimeric antibodies is preferred because they possess human antibody constant region sequences and therefore do not elicit as strong a human anti-mouse antibody (HAMA) response as murine antibodies.
  • HAMA human anti-mouse antibody
  • the use of humanized antibodies is even more preferred, in order to further reduce the possibility of inducing a HAMA reaction.
  • the anti-cancer vaccine DNL constructs may be administered in combination with at least one therapeutic agent administered before, simultaneously with or after the anti-cancer vaccine construct.
  • the therapeutic agent is administered before the anti-cancer vaccine.
  • the therapeutic agent may be co-administered with or even conjugated to the DNL construct.
  • any therapeutic agent known in the art may be utilized in conjunction with an anti-cancer vaccine DNL construct, including but not limited to radionuclides, immunomodulators, anti-angiogenic agents, cytokines, chemokines, growth factors, hormones, drugs, prodrugs, enzymes, oligonucleotides, siRNAs, pro-apoptotic agents, photoactive therapeutic agents, cytotoxic agents, chemotherapeutic agents, toxins, other antibodies or antigen binding fragments thereof.
  • radionuclides including but not limited to radionuclides, immunomodulators, anti-angiogenic agents, cytokines, chemokines, growth factors, hormones, drugs, prodrugs, enzymes, oligonucleotides, siRNAs, pro-apoptotic agents, photoactive therapeutic agents, cytotoxic agents, chemotherapeutic agents, toxins, other antibodies or antigen binding fragments thereof.
  • the therapeutic agent is a cytotoxic agent, such as a drug or a toxin.
  • the drug is selected from the group consisting of nitrogen mustards, ethylenimine derivatives, alkyl sulfonates, nitrosoureas, gemcitabine, triazenes, folic acid analogs, anthracyclines, taxanes, COX-2 inhibitors, pyrimidine analogs, purine analogs, antibiotics, enzyme inhibitors, epipodophyllotoxins, platinum coordination complexes, vinca alkaloids, substituted ureas, methyl hydrazine derivatives, adrenocortical suppressants, hormone antagonists, endostatin, taxols, camptothecins, SN-38, doxorubicins and their analogs, antimetabolites, alkylating agents, antimitotics, anti-angiogenic agents, tyrosine kinase inhibitors, mTOR inhibitor
  • the therapeutic agent is a toxin selected from the group consisting of ricin, abrin, alpha toxin, saporin, ribonuclease (RNase), DNase I, Staphylococcal enterotoxin-A, pokeweed antiviral protein, gelonin, diphtheria toxin, Pseudomonas exotoxin, and Pseudomonas endotoxin and combinations thereof.
  • an immunomodulator selected from the group consisting of a cytokine, a stem cell growth factor, a lymphotoxin, a hematopoietic factor, a colony stimulating factor (CSF), an interferon (IFN), a stem cell growth factor, erythropoietin, thrombopoietin and a combinations thereof.
  • the therapeutic agent is a radionuclide selected from the group consisting of 111 In, 177 Lu, 212 Bi, 213 Bi, 211 At, 62 Cu, 67 Cu, 90 Y, 125 I, 131 I 5 32 P, 33 P, 47 Sc, 111 Ag, 67 Ga, 142 Pr, 153 Sm, 161 Tb, 166 Dy, 166 Ho, 186 Re, 188 Re, 189 Re, 212 Pb, 223 Ra, 225 Ac, 59 Fe, 75 Se, 77 As, 89 Sr, 99 Mo, 105 Rh, 109 Pd, 143 Pr, 149 Pm, 169 Er, 194 Ir, 198 Au, 199 Au, and 211 Pb, and combinations thereof.
  • a radionuclide selected from the group consisting of 111 In, 177 Lu, 212 Bi, 213 Bi, 211 At, 62 Cu, 67 Cu, 90 Y, 125 I, 131 I 5 32 P, 33 P, 47 Sc, 111 Ag
  • radionuclides that substantially decay with Auger-emitting particles.
  • Decay energies of useful beta-particle-emitting nuclides are preferably ⁇ l,000 keV, more preferably ⁇ 100 keV, and most preferably ⁇ 70 keV.
  • radionuclides that substantially decay with generation of alpha-particles.
  • Such radionuclides include, but are not limited to Dy-152, At-211, Bi-212, Ra-223, Rn-219, Po-215, Bi-211, Ac-225, Fr-221, At-217, Bi-213 and Fm-255. Decay energies of useful alpha-particle-emitting radionuclides are preferably 2,000-10,000 keV, more preferably 3,000-8,000 keV, and most preferably 4,000-7,000 keV.
  • radioisotopes of use include 11 C, 13 N, 15 O, 75 Br, 198 Au, 224 Ac, 126 I, 133 I, 77 Br, 113111 In, 95 Ru, 97 Ru, 103 Ru, 105 Ru, 107 Hg, 203 Hg, 121m Te, 122m Te, 125m Te, 165 Tm, 167 Tm, 168 Tm, 197 Pt, 109 Pd, 105 Rh, 142 Pr, 143 Pr, 161 Tb, 166 Ho, 199 Au, 57 Co, 58 Co, 51 Cr, 59 Fe, 75 Se, 201 Tl, 225 Ac, 76 Br, 169 Yb, and the like.
  • the therapeutic agent is a photoactive therapeutic agent selected from the group consisting of chromogens and dyes.
  • the therapeutic agent is an enzyme selected from the group consisting of malate dehydrogenase, staphylococcal nuclease, delta- V-steroid isomerase, yeast alcohol dehydrogenase, alpha-glycerophosphate dehydrogenase, triose phosphate isomerase, horseradish peroxidase, alkaline phosphatase, asparaginase, glucose oxidase, beta- galactosidase, ribonuclease, urease, catalase, glucose-6-phosphate dehydrogenase, glucoamylase and acetylcholinesterase.
  • malate dehydrogenase staphylococcal nuclease
  • delta- V-steroid isomerase yeast alcohol dehydrogenase
  • alpha-glycerophosphate dehydrogenase alpha-glycerophosphate dehydrogenase
  • triose phosphate isomerase horseradish peroxidas
  • Such enzymes may be used, for example, in combination with prodrugs that are administered in relatively non-toxic form and converted at the target site by the enzyme into a cytotoxic agent.
  • a drug may be converted into less toxic form by endogenous enzymes in the subject but may be reconverted into a cytotoxic form by the therapeutic enzyme.
  • the anti-cancer vaccine DNL complexes are of use for therapy of multiple myeloma
  • a CD20/anti-CD74 construct may potentially be of use for other types of diseases, such as other forms of CD20 + cancer like B-cell lymphoma, B-cell leukemia, acute lymphoblastic leukemia, chronic lymphocytic leukemia, follicular lymphoma, mantle cell lymphoma, small lymphocytic lymphoma, diffuse B-cell lymphoma, marginal zone lymphoma, Burkitt lymphoma, Hodgkin's lymphoma or non-Hodgkin's lymphoma.
  • Still other embodiments relate to DNA sequences encoding fusion proteins, such as antibody-DDD or xenoantigen-DDD fusion proteins or antibody- AD or xenoantigen- AD fusion proteins, vectors and host cells containing the DNA sequences, and methods of making fusion proteins for the production of anti-cancer vaccine DNL constructs.
  • Related embodiments include fusion proteins of use for making anti-cancer vaccine DNL constructs, antibody-DDD or xenoantigen-DDD fusion proteins or antibody- AD or xenoantigen-AD fusion proteins.
  • the subunit components of the DNL complex may be formed by chemical cross-linking of, for example, an antibody or antibody fragment and a DDD peptide, or a CD20 xenoantigen and an AD peptide.
  • the fusion protein or chemically cross-linked conjugate may be attached to a reporter moiety such as a diagnostic agent.
  • diagnostic agents are known in the art, such as radionuclides, contrast agents, fluorescent agents, chemiluminescent agents, bioluminescent agents, paramagnetic ions, enzymes and photoactive diagnostic agents.
  • the diagnostic agent is a radionuclide with an energy between 20 and 4,000 keV or is a radionuclide selected from the group consisting of 110 In, 111 In, 177 Lu, l F, 52 Fe, 62 Cu, 64 Cu, 67 Cu, 67 Ga, 68 Ga, 86 Y, 90 Y, 89 Zr, 94m Tc, 94 Tc, 99m Tc, 120 1, 123 1, 124 1, 125 1, 131 I, 154"158 Gd, 32 P, 11 C, 13 N, 15 0, 186 Re, 188 Re, 51 Mn, 52m Mn, 55 Co, 72 As, 75 Br, 76 Br, 82m Rb, 83 Sr, or other gamma-, beta-, or positron-emitters.
  • a radionuclide selected from the group consisting of 110 In, 111 In, 177 Lu, l F, 52 Fe, 62 Cu, 64 Cu, 67 Cu, 67 Ga, 68 Ga, 86
  • the diagnostic agent is a paramagnetic ion, such as chromium (III), manganese (II), iron (III), iron (II), cobalt (II), nickel (II), copper (II), neodymium (III), samarium (III), ytterbium (III), gadolinium (III), vanadium (II), terbium (III), dysprosium (III), holmium (III) and erbium (III), or a radiopaque material, such as barium, diatrizoate, ethiodized oil, gallium citrate, iocarmic acid, iocetamic acid, iodamide, iodipamide, iodoxamic acid, iogulamide, iohexol, iopamidol, iopanoic acid, ioprocemic acid, iosefamic acid, ioseric
  • the diagnostic agent is a fluorescent labeling compound selected from the group consisting of fluorescein isothiocyanate, rhodamine, phycoerytherin, phycocyanin, allophycocyanin, o-phthaldehyde and fluorescamine, a chemiluminescent labeling compound selected from the group consisting of luminol, isoluminol, an aromatic acridinium ester, an imidazole, an acridinium salt and an oxalate ester, or a bioluminescent compound selected from the group consisting of luciferin, luciferase and aequorin.
  • a fluorescent labeling compound selected from the group consisting of fluorescein isothiocyanate, rhodamine, phycoerytherin, phycocyanin, allophycocyanin, o-phthaldehyde and fluorescamine
  • a chemiluminescent labeling compound selected from the group consisting of lumin
  • an antibody refers to a full-length (i.e., naturally occurring or formed by normal immunoglobulin gene fragment recombinatorial processes) immunoglobulin molecule (e.g., an IgG antibody) or an immunologically active, antigen-binding portion of an immunoglobulin molecule, like an antibody fragment.
  • an antibody fragment is a portion of an antibody such as F(ab') 2 , F(ab) 2 , Fab', Fab, Fv, scFv and the like. Regardless of structure, an antibody fragment binds with the same antigen that is recognized by the intact antibody. Therefore the term is used synonymously with "antigen-binding antibody fragment.”
  • antibody fragment also includes isolated fragments consisting of the variable regions, such as the "Fv” fragments consisting of the variable regions of the heavy and light chains and recombinant single chain polypeptide molecules in which light and heavy variable regions are connected by a peptide linker ("scFv proteins").
  • antibody fragment does not include portions of antibodies without antigen binding activity, such as Fc fragments or single amino acid residues.
  • Other antibody fragments for example single domain antibody fragments, are known in the art and may be used in the claimed constructs. (See, e.g., Muyldermans et al., TIBS 26:230-235, 2001; Yau et al., J Immunol Methods 281 :161-75, 2003; Maass et al., J Immunol Methods 324:13-25, 2007).
  • antibody fusion protein may refer to a recombinantly produced antigen- binding molecule in which one or more of the same or different single-chain antibody or antibody fragment segments with the same or different specificities are linked. Valency of the fusion protein indicates how many binding arms or sites the fusion protein has to a single antigen or epitope; i.e., monovalent, bivalent, trivalent or multivalent. The multi valency of the antibody fusion protein means that it can take advantage of multiple interactions in binding to an antigen, thus increasing the avidity of binding to the antigen. Specificity indicates how many antigens or epitopes an antibody fusion protein is able to bind; i.e., monospecific, bispecific, trispecific, multispecific.
  • a natural antibody e.g., an IgG
  • the fusion protein may comprise a single antibody component, a multivalent or multispecific combination of different antibody components or multiple copies of the same antibody component.
  • the fusion protein may additionally comprise an antibody or an antibody fragment and a therapeutic agent. Examples of therapeutic agents suitable for such fusion proteins include immunomodulators and toxins.
  • One preferred toxin comprises a ribonuclease (RNase), preferably a recombinant RNase.
  • RNase ribonuclease
  • a fusion protein may comprise an AD or DDD sequence for producing a DNL construct as discussed below.
  • a chimeric antibody is a recombinant protein that contains the variable domains including the complementarity determining regions (CDRs) of an antibody derived from one species, preferably a rodent antibody, while the constant domains of the antibody molecule are derived from those of a human antibody.
  • the constant domains of the chimeric antibody may be derived from that of other species, such as a cat or dog.
  • a humanized antibody is a recombinant protein in which the CDRs from an antibody from one species; e.g., a rodent antibody, are transferred from the heavy and light variable chains of the rodent antibody into human heavy and light variable domains (e.g., framework region sequences).
  • the constant domains of the antibody molecule are derived from those of a human antibody.
  • a limited number of framework region amino acid residues from the parent (rodent) antibody may be substituted into the human antibody framework region sequences.
  • a human antibody is, e.g., an antibody obtained from transgenic mice that have been "engineered” to produce specific human antibodies in response to antigenic challenge.
  • elements of the human heavy and light chain loci are introduced into strains of mice derived from embryonic stem cell lines that contain targeted disruptions of the endogenous murine heavy chain and light chain loci.
  • the transgenic mice can synthesize human antibodies specific for particular antigens, and the mice can be used to produce human antibody-secreting hybridomas. Methods for obtaining human antibodies from transgenic mice are described by Green et al, Nature Genet. 7:13 (1994), Lonberg et al., Nature 368:856 (1994), and Taylor et al., Int. Immun. 6:579 (1994).
  • a fully human antibody also can be constructed by genetic or chromosomal transfection methods, as well as phage display technology, all of which are known in the art. See for example, McCafferty et al., Nature 348:552-553 (1990) for the production of human antibodies and fragments thereof //? vitro, from immunoglobulin variable domain gene repertoires from unimmunized donors.
  • antibody variable domain genes are cloned in-frame into either a major or minor coat protein gene of a filamentous bacteriophage, and displayed as functional antibody fragments on the surface of the phage particle.
  • the filamentous particle contains a single-stranded DNA copy of the phage genome, selections based on the functional properties of the antibody also result in selection of the gene encoding the antibody exhibiting those properties. In this way, the phage mimics some of the properties of the B cell.
  • Phage display can be performed in a variety of formats, for review, see e.g. Johnson and Chiswell, Current Opiniion in Structural Biology 3:5564-571 (1993).
  • Human antibodies may also be generated by in vitro activated B cells. See U.S. Pat. Nos. 5,567,610 and 5,229,275, the Examples section of which are incorporated herein by reference.
  • FIG. 1 Specific binding of hLLl on human blood DC subsets, B cells, and monocytes.
  • A The gating strategy for the different APC subsets.
  • B CD74 expression in APCs.
  • C The binding efficiency of hLLl on the cells. The numbers represent mean fluorescence intensity.
  • FIG. 2 CD74 expression in and binding efficiency of hLLl with human monocyte- derived immature vs mature DCs.
  • the human monocyte-derived DCs (day 5 after culture in the presence of hGM-CSF and hIL-4) were stained with FITC-labeled anti-CD74 antibody or AlexaFluor488-labeled hLLl, in combination with the staining with fluorescence-labeled mAbs against HLA-DR and CD83.
  • the HLA-DR-positive cells are gated and analyzed.
  • A CD74 expression in immature and LPS-matured DCs.
  • B hLLl binding with immature vs LPS-matured DCs.
  • C Comparison of expression of CD83, HLA-DR, CD74 and hLLl binding in immature and mature DCs.
  • FIG. 3 Side-by-side comparison of the cytotoxic effect of hLLl on B cell malignant Daudi cells and normal DCs.
  • A Comparison of the effect of hLLl on Daudi and DCs.
  • B Effect of hLLl on cell viability of DCs in an extended doses.
  • C The cytotoxic effect of hLLl on Daudi cells.
  • D The microscopic image shows no effect of hLLl on DC viability.
  • FIG. 4. Moderate enhancement of DC constitutive maturation by hLLl. The HLA- DR positive cell populations were gated from day 5 DCs derived from human monocytes in the presence of hGM-CSF and hIL-4.
  • A The expression of antigen-presenting molecule HLA-DR, costimulatory molecule CD54 and CD86 was measured by flow cytometry.
  • B Expression levels of antigen-presenting molecule HLA-DR, costimulatory molecule CD54 and CD86.
  • FIG. 5 No significant influence of hLLl on DC-mediated T cell proliferation.
  • the hLLl -treated DCs were co-cultured with CFSE-labeled allogeneic PBMCs for 8 (A) or 11 days (B).
  • the expanded T cells were stained with Percp-conjugated mAb against CD4.
  • the cell proliferation of total T cells, CD4+ and CD4- T cells were analyzed.
  • FIG. 6. Polarization of naive CD4+ T cells by hLLl -treated DCs favoring the differentiation toward ThI effector cells.
  • Na ⁇ ve CD4+ T cells isolated from human PBMCs using the depletion column with magnetic beads (MACS) were co-cultured with hLLl- treated allogeneic DCs. After different time points (day 11, 13, 18), the cells were harvested, stimulated with PMA and ionomycin, and analyzed with intracellular cytokine staining with fluorescence-labeled hlFN-gamma and hIL-4 antibodies. Thl/Th2/ThO cells populations were gated and analyzed. The flow cytokine production in T cells stimulated by hLLl- treatred DCs or by GAH-cross-linked hLLl -treated DCs was determined.
  • C The data of ThI responses in two donors, in the absence or presence of cross-linking by GAH, at different days after DC/T coculture, are shown.
  • D The dose-effect curve for increasing ThI populations by hLLl.
  • CD20 is normally expressed in cells of B cell lineage. It was recently reported that CD20 is expressed in a small population of MM cells isolated from MM cell lines or clinical specimens, which do not express the characteristic plasma cell surface antigen CD138 but have a highly clonogenic potential and are resistant to multiple clinical anti-myeloma drugs (Matsui et al., Blood 2004, 103:2332-6; Matsui et al., Cancer Res. 2008, 68:190-7).
  • CD20+CD138- cells are capable of clonogenic growth in vitro and in a 3-D culture model (Kirshner et al., Blood 2008, 112:2935-45), and of differentiation into MM cells in vitro and in the engrafted NOD/SCID mouse model during both primary and secondary transplantation. It has thus been suggested that these CD138 neg CD20 + cells represent the putative multiple myeloma cancer stem cells.
  • TAAs tumor-associated Ags
  • T cells that recognize these TAAs/self-Ags with high avidity are either clonally deleted in the thymus or anergized in the periphery.
  • immunization with xenoantigen has been shown to be capable of overcoming the immune tolerance against the homologous self- Ag.
  • DCs dendritic cells
  • DC targeting vaccination is more efficient in eliciting anti-tumor immune response, and more effective in controlling tumor growth in animal models (Kretz-Rommel et al, J Immunother 2007, 30:715-726).
  • B cells are another type of potent antigen-presenting cells capable of priming Thl/Th2 cells (Morris et al, J Immunol.
  • CD74 as a potential receptor for targeting vaccination.
  • Some receptors expressed on DCs have been used as the targets for in vivo antigen targeting, such as the mannose receptor (He et al., J. Immunol 2007, 178, 6259-6267; Ramakrishna et al., J. Immunol. 2004, 172, 2845-2852) CD205 (Bonifaz et al., J Exp Med. 2004, 199:815-24), DC-SIGN (Tacken et al., Blood 2005, 106:1278-85), and LOXl (excellentste et al., Immunity 2002, 17, 353-362), etc.
  • CD74 is a type II integral membrane protein essential for proper MHC II folding and targeting of MHC II-CD74 complex to the endosomes (Stein et al., Clin Cancer Res. 2007, 13:5556s-5563s; Matza et al., Trends Immunol. 2003, 24(5):264-8). CD74 expression is not restricted to DCs, but is found in almost all antigen-presenting cells (Freudenthal et al., Proc Natl Acad Sci U S A. 1990, 87:7698-702; Clark et al., J Immunol. 1992, 148(11):3327-35).
  • CD74 in APCs may offer some advantages over sole expression in myeloid DCs, as targeting of antigens to other APCs like B cells has been reported to break immune tolerance (Ding et al., Blood 2008, 112:2817-25), and targeting to plasmacytoid DCs cross-presents antigens to na ⁇ ve CD8 T cells. More importantly, CD74 is also expressed in follicular DCs (Clark et al., J Immunol. 1992, 148(11):3327-35), a DC subset critical for antigen presentation to B cells (Tew et al., Immunol Rev. 1997, 156:39-52). This expression profile makes CD74 an excellent candidate for in vivo targeting vaccination.
  • hLLl is a humanized monoclonal antibody against human CD74 (Leung et al., MoI Immunol. 1995, 32:1416-1427; Losman et al., Cancer 1997, 80:2660-2666; Stein et al., Blood 2004, 104:3705-11).
  • This MAb in the presence of cross-linking by a second antibody, exhibits cytotoxicity against B cell malignancies.
  • the naked hLLl is also capable of controlling tumor growth in a MM mouse model.
  • our recent data demonstrate that hLLl, in the presence or absence of cross-linking, has no cytotoxicity against human monocyte-derived DCs.
  • our preliminary data shows hLLl could efficiently bind different subsets of blood DCs and B cells. It also could moderately induce DC maturation and polarize na ⁇ ve T cell differentiation toward ThI effector cells, suggesting it has some adjuvant activity and may be a good candidate for use as a targeting tool.
  • Cancer stem cells are capable of self-renewal, possess the ability for unlimited proliferation, and are resistant to multiple therapeutic approaches. A pressing and interesting question is raised if cancer stem cells are sensitive to immunotherapy. In the case of leukemia, it was reported that CD8(+) minor histocompatibility antigen-specific cytotoxic T lymphocyte clones could eliminate human acute myeloid leukemia stem cells (Bonnet et al., Proc Natl Acad Sci U.S.A. 1999, 96:8639-8644). More recently, Rosinski et al.
  • the DNL method exploits specific protein/protein interactions that occur between the regulatory (R) subunits of cAMP-dependent protein kinase (PKA) and the anchoring domain (AD) of A-kinase anchoring proteins (AKAPs) (Baillie et al, FEBS Letters. 2005; 579:3264. Wong and Scott, Nat. Rev. MoI. Cell Biol. 2004; 5:959).
  • PKA which plays a central role in one of the best studied signal transduction pathways triggered by the binding of the second messenger cAMP to the R subunits, was first isolated from rabbit skeletal muscle in 1968 (Walsh et al, J. Biol. Chem. 1968;243:3763).
  • the structure of the holoenzyme consists of two catalytic subunits held in an inactive form by the R subunits (Taylor, J. Biol. Chem. 1989;264:8443). Isozymes of PKA are found with two types of R subunits (RI and RII), and each type has ⁇ and ⁇ isoforms (Scott, Pharmacol. Ther. 1991;50:123). The R subunits have been isolated only as stable dimers and the dimerization domain has been shown to consist of the first 44 amino-terminal residues (Newlon et al, Nat. Struct. Biol. 1999;6:222).
  • Binding of cAMP to the R subunits leads to the release of active catalytic subunits for a broad spectrum of serine/threonine kinase activities, which are oriented toward selected substrates through the compartmentalization of PKA via its docking with AKAPs (Scott et al, J. Biol. Chem. 1990;265;21561)
  • AKAP microtubule-associated protein-2
  • the amino acid sequences of the AD are quite varied among individual AKAPs, with the binding affinities reported for RII dimers ranging from 2 to 90 nM (Alto et al., Proc. Natl. Acad. Sci. USA. 2003;100:4445). Interestingly, AKAPs will only bind to dimeric R subunits.
  • the AD binds to a hydrophobic surface formed by the 23 amino-terminal residues (Colledge and Scott, Trends Cell Biol. 1999; 6:216).
  • the dimerization domain and AKAP binding domain of human RIIa are both located within the same N-terminal 44 amino acid sequence (Newlon et al., Nat. Struct. Biol. 1999;6:222; Newlon et al, EMBO J. 2001 ;20: 1651), which is termed the DDD herein.
  • Entity B is constructed by linking an AD sequence to a precursor of B, resulting in a second component hereafter referred to as b.
  • the dimeric motif of DDD contained in a 2 will create a docking site for binding to the AD sequence contained in b, thus facilitating a ready association of a 2 and b to form a binary, trimeric complex composed of a 2 b.
  • This binding event is made irreversible with a subsequent reaction to covalently secure the two entities via disulfide bridges, which occurs very efficiently based on the principle of effective local concentration because the initial binding interactions should bring the reactive thiol groups placed onto both the DDD and AD into proximity (Chmura et ah, Proc. Natl. Acad. Sci. USA. 2001;98:8480) to ligate site-specifically.
  • the anti-cancer vaccine DNL constructs are based on a variation of the a 2 b structure, in which each heavy chain of an anti-CD74 antibody or F(ab') 2 or F(ab) 2 antibody fragment, such as an hLLl antibody or fragment, is attached at its C- terminal end to one copy of an AD moiety. Since there are two heavy chains per antibody or fragment, there are two AD moieties per antibody or fragment. A CD20 xenoantigen is attached to a complementary DDD moiety.
  • each DDD dimer binds to one of the AD moieties attached to the IgG antibody or F(ab') 2 or F(ab) 2 fragment, resulting in a stoichiometry of four CD20 xenoantigens per IgG or F(ab') 2 or F(ab) 2 unit.
  • CD20 xenoantigens per IgG or F(ab') 2 or F(ab) 2 unit.
  • alternative complexes may be utilized, such as attachment of the CD20 to the AD sequence and attachment of the anti-CD74 MAb or fragment to the DDD moiety, resulting in a different stoichiometry of effector moieties.
  • a DNL complex may be constructed that comprises one CD20 molecule and one anti-CD74 antibody or fragment.
  • the effector moiety is a protein or peptide, which can be linked to a DDD or AD unit to form a fusion protein or peptide.
  • a variety of methods are known for making fusion proteins, including nucleic acid synthesis, hybridization and/or amplification to produce a synthetic double-stranded nucleic acid encoding a fusion protein of interest.
  • Such double-stranded nucleic acids may be inserted into expression vectors for fusion protein production by standard molecular biology techniques (see, e.g. Sambrook et al., Molecular Cloning, A laboratory manual, 2 nd Ed, Cold Spring Harbor Press, Cold Spring Harbor, NY, 1989).
  • the AD and/or DDD moiety may be attached to either the N-terminal or C-terminal end of an effector protein or peptide.
  • site of attachment of an AD or DDD moiety to an effector moiety may vary, depending on the chemical nature of the effector moiety and the part(s) of the effector moiety involved in its physiological activity.
  • an AD or DDD moiety may be attached to either the N- or C-terminal end of an antibody or antibody fragment while retaining antigen-binding activity
  • attachment to the C- terminal end positions the AD or DDD moiety farther from the antigen-binding site and appears to result in a stronger binding interaction (e.g., Chang et al., Clin Cancer Res 2007, 13:5586s- 91s).
  • Site-specific attachment of a variety of effector moieties may be also performed using techniques known in the art, such as the use of bivalent cross-linking reagents and/or other chemical conjugation techniques.
  • antibodies or antigen-binding fragments of antibodies may be incorporated into the anti-cancer vaccine DNL complex.
  • Antigen-binding antibody fragments are well known in the art, such as F(ab') 2 , F(ab) 2 , Fab', Fab, Fv, scFv and the like, and any such known fragment may be used.
  • an antigen-binding antibody fragment refers to any fragment of an antibody that binds with the same antigen that is recognized by the intact or parent antibody. Techniques for preparing AD and/or DDD conjugates of virtually any antibody or fragment of interest are known (e.g., U.S. Patent No. 7,527,787).
  • antibodies or fragment thereof may be used which is not conjugated to a therapeutic agent - referred to as a "naked" antibody or fragment thereof.
  • antibodies or fragments may be conjugated to one or more therapeutic and/or diagnostic agents.
  • therapeutic and diagnostic agents are known in the art, as discussed in more detail below, and any such known therapeutic or diagnostic agent may be used.
  • monoclonal antibodies can be obtained by injecting mice with a composition comprising an antigen, removing the spleen to obtain B-lymphocytes, fusing the B-lymphocytes with myeloma cells to produce hybridomas, cloning the hybridomas, selecting positive clones which produce antibodies to the antigen, culturing the clones that produce antibodies to the antigen, and isolating the antibodies from the hybridoma cultures.
  • MAbs can be isolated and purified from hybridoma cultures by a variety of well-established techniques. Such isolation techniques include affinity chromatography with Protein-A Sepharose, size-exclusion chromatography, and ion-exchange chromatography. See, for example, Coligan at pages 2.7.1-2.7.12 and pages 2.9.1-2.9.3. Also, see Baines et al, "Purification of Immunoglobulin G (IgG)," in METHODS IN MOLECULAR BIOLOGY, VOL. 10, pages 79-104 (The Humana Press, Inc. 1992).
  • the antibodies can be sequenced and subsequently prepared by recombinant techniques. Humanization and chimerization of murine antibodies and antibody fragments are well known to those skilled in the art. The use of antibody components derived from humanized, chimeric or human antibodies obviates potential problems associated with the immunogenicity of murine constant regions.
  • a chimeric antibody is a recombinant protein in which the variable regions of a human antibody have been replaced by the variable regions of, for example, a mouse antibody, including the complementarity-determining regions (CDRs) of the mouse antibody.
  • Chimeric antibodies exhibit decreased immunogenicity and increased stability when administered to a subject.
  • CDRs complementarity-determining regions
  • a chimeric or murine monoclonal antibody may be humanized by transferring the mouse CDRs from the heavy and light variable chains of the mouse immunoglobulin into the corresponding variable domains of a human antibody.
  • the mouse framework regions (FR) in the chimeric monoclonal antibody are also replaced with human FR sequences.
  • additional modification might be required in order to restore the original affinity of the murine antibody. This can be accomplished by the replacement of one or more human residues in the FR regions with their murine counterparts to obtain an antibody that possesses good binding affinity to its epitope.
  • a humanized LLl (hLLl) anti-CD74 antibody is disclosed in U.S. Patent No. 7,312,318, incorporated herein by reference from Col. 35, line 1 through Col. 42, line 27 and FIG. 1 through FIG. 4.
  • the phage display technique may be used to generate human antibodies (e.g., Dantas-Barbosa et al., 2005, Genet. MoI Res. 4:126-40).
  • Human antibodies may be generated from normal humans or from humans that exhibit a particular disease state, such as cancer (Dantas-Barbosa et al., 2005).
  • the advantage to constructing human antibodies from a diseased individual is that the circulating antibody repertoire may be biased towards antibodies against disease-associated antigens.
  • RNAs were converted to cDNAs and used to make Fab cDNA libraries using specific primers against the heavy and light chain immunoglobulin sequences (Marks et al., 1991, J MoI. Biol. 222:581-97).
  • Phage display can be performed in a variety of formats, for their review, see e.g. Johnson and Chiswell, Current Opinion in Structural Biology 3:5564-571 (1993).
  • Human antibodies may also be generated by in vitro activated B-cells. See U.S. Patent Nos. 5,567,610 and 5,229,275, incorporated herein by reference in their entirety. The skilled artisan will realize that these techniques are exemplary and any known method for making and screening human antibodies or antibody fragments may be utilized.
  • transgenic animals that have been genetically engineered to produce human antibodies may be used to generate antibodies against essentially any immunogenic target, using standard immunization protocols.
  • the XenoMouse® was transformed with germline-configured YACs (yeast artificial chromosomes) that contained portions of the human IgH and Igkappa loci, including the majority of the variable region sequences, along accessory genes and regulatory sequences.
  • the human variable region repertoire may be used to generate antibody producing B-cells, which may be processed into hybridomas by known techniques.
  • a XenoMouse® immunized with a target antigen will produce human antibodies by the normal immune response, which may be harvested and/or produced by standard techniques discussed above.
  • a variety of strains of XenoMouse® are available, each of which is capable of producing a different class of antibody.
  • Transgenically produced human antibodies have been shown to have therapeutic potential, while retaining the pharmacokinetic properties of normal human antibodies (Green et al., 1999).
  • the skilled artisan will realize that the claimed compositions and methods are not limited to use of the XenoMouse® system but may utilize any transgenic animal that has been genetically engineered to produce human antibodies.
  • Antibody fragments which recognize specific epitopes can be generated by known techniques.
  • Antibody fragments are antigen binding portions of an antibody, such as F(ab') 2j Fab', F(ab) 2 , Fab, Fv, sFv and the like.
  • F(ab') 2 fragments can be produced by pepsin digestion of the antibody molecule and Fab' fragments can be generated by reducing disulfide bridges of the F(ab') 2 fragments.
  • Fab' expression libraries can be constructed (Huse et al., 1989, Science, 246:1274-1281) to allow rapid and easy identification of monoclonal Fab' fragments with the desired specificity.
  • F(ab) 2 fragments may be generated by papain digestion of an antibody and Fab fragments obtained by disulfide reduction.
  • a single chain Fv molecule (scFv) comprises a VL domain and a VH domain. The VL and VH domains associate to form a target binding site. These two domains are further covalently linked by a peptide linker (L).
  • L peptide linker
  • Single domain antibodies may be obtained, for example, from camels, alpacas or llamas by standard immunization techniques.
  • the VHH may have potent antigen-binding capacity and can interact with novel epitopes that are inacessible to conventional VH-VL pairs.
  • Alpaca serum IgG contains about 50% camelid heavy chain only IgG antibodies (HCAbs) (Maass et al., 2007).
  • Alpacas may be immunized with known antigens, such as TNF- ⁇ , and VHHs can be isolated that bind to and neutralize the target antigen (Maass et al., 2007).
  • PCR primers that amplify virtually all alpaca VHH coding sequences have been identified and may be used to construct alpaca VHH phage display libraries, which can be used for antibody fragment isolation by standard biopanning techniques well known in the art (Maass et al., 2007).
  • An antibody fragment can be prepared by proteolytic hydrolysis of the full length antibody or by expression in E. coli or another host of the DNA coding for the fragment.
  • An antibody fragment can be obtained by pepsin or papain digestion of full length antibodies by conventional methods. These methods are described, for example, by Goldenberg, U.S. Patent Nos. 4,036,945 and 4,331 ,647 and references contained therein. Also, see Nisonoff et al, Arch Biochem. Biophys. 89:230 (1960); Porter, Biochem. J. 73:119 (1959), Edelman et al, in METHODS IN ENZYMOLOGY VOL. 1, page 422 (Academic Press 1967), and Coligan at pages 2.8.1-2.8.10 and 2.10.-2.10.4.
  • Known Antibodies are described, for example, by Goldenberg, U.S. Patent Nos. 4,036,945 and 4,331 ,647 and references contained therein. Also, see Nisonoff et al, Arch Biochem. Biophys. 89:230 (1960); Porter, Biochem. J. 73:119 (1959), Edelman et al, in METHODS IN ENZYMO
  • antibodies against other antigenic targets besides CD74 may be incorporated into the anti-cancer vaccine DNL complex.
  • a wide variety of antibodies against tumor-associated antigens are known and may be obtained from commercial sources.
  • a number of antibody secreting hybridoma lines are available from the American Type Culture Collection (ATCC, Manassas, VA). See, e.g., U.S. Patent Nos.
  • antibody sequences or antibody- secreting hybridomas against almost any tumor-associated antigen may be obtained by a simple search of the ATCC, NCBI and/or USPTO databases for antibodies against a selected disease-associated target of interest.
  • the antigen binding domains of the cloned antibodies may be amplified, excised, ligated into an expression vector, transfected into an adapted host cell and used for protein production, using standard techniques well known in the art.
  • the disclosed methods and compositions may involve production and use of proteins or peptides with one or more substituted amino acid residues.
  • sequences of the AD and/or DDD moieties may be varied to improve DNL complex formation and/or in vivo stability of the DNL complexes.
  • structural, physical and/or therapeutic characteristics of native, chimeric, humanized or human antibodies may be optimized by replacing one or more amino acid residues.
  • functional characteristics of humanized antibodies may be improved by substituting a limited number of human framework region (FR) amino acids with the corresponding FR amino acids of the parent murine antibody.
  • the therapeutic properties of an antibody such as binding affinity for the target antigen, the dissociation- or off-rate of the antibody from its target antigen, or even the effectiveness of induction of CDC (complement-dependent cytotoxicity) or ADCC (antibody dependent cellular cytotoxicity) by the antibody, may be optimized by a limited number of amino acid substitutions.
  • amino acid substitutions typically involve the replacement of an amino acid with another amino acid of relatively similar properties (i.e., conservative amino acid substitutions).
  • conservative amino acid substitutions The properties of the various amino acids and effect of amino acid substitution on protein structure and function have been the subject of extensive study and knowledge in the art.
  • the hydropathic index of amino acids may be considered (Kyte & Doolittle, 1982, J. MoI. Biol, 157:105-132).
  • the relative hydropathic character of the amino acid contributes to the secondary structure of the resultant protein, which in turn defines the interaction of the protein with other molecules.
  • Each amino acid has been assigned a hydropathic index on the basis of its hydrophobicity and charge characteristics (Kyte & Doolittle, 1982), these are: isoleucine (+4.5); valine (+4.2); leucine (+3.8); phenylalanine (+2.8); cysteine/cystine (+2.5); methionine (+1.9); alanine (+1.8); glycine (-0.4); threonine (- 0.7); serine (-0.8); tryptophan (-0.9); tyrosine (-1.3); proline (-1.6); histidine (-3.2); glutamate (-3.5); glutamine (-3.5); aspartate (-3.5); asparagine (-3.5); lysine (-3.9); and arginine (-4.5).
  • the use of amino acids whose hydropathic indices are within ⁇ 2 is preferred, within ⁇ 1 are more preferred, and within ⁇ 0.5 are even more preferred.
  • Amino acid substitution may also take into account the hydrophilicity of the amino acid residue (e.g., U.S. Pat. No. 4,554,101). Hydrophilicity values have been assigned to amino acid residues: arginine (+3.0); lysine (+3.0); aspartate (+3.0); glutamate (+3.0); serine (+0.3); asparagine (+0.2); glutamine (+0.2); glycine (0); threonine (-0.4); proline (-0.5 .+-.1); alanine (-0.5); histidine (-0.5); cysteine (-1.0); methionine (-1.3); valine (-1.5); leucine (-1.8); isoleucine (-1.8); tyrosine (-2.3); phenylalanine (-2.5); tryptophan (-3.4). Replacement of amino acids with others of similar hydrophilicity is preferred.
  • amino acid side chain For example, it would generally not be preferred to replace an amino acid with a compact side chain, such as glycine or serine, with an amino acid with a bulky side chain, e.g., tryptophan or tyrosine.
  • a compact side chain such as glycine or serine
  • an amino acid with a bulky side chain e.g., tryptophan or tyrosine.
  • the effect of various amino acid residues on protein secondary structure is also a consideration. Through empirical study, the effect of different amino acid residues on the tendency of protein domains to adopt an alpha-helical, beta-sheet or reverse turn secondary structure has been determined and is known in the art (see, e.g., Chou & Fasman, 1974, Biochemistry, 13:222-245; 1978, Ann. Rev. Biochem., 47:251-276; 1979, Biophys. J., 26:367-384).
  • amino acid substitutions include whether or not the residue is located in the interior of a protein or is solvent exposed.
  • conservative substitutions would include Asp and Asn; Ser and Thr; Ser and Ala; Thr and Ala; Ala and GIy; He and Val; Val and Leu; Leu and Ile; Leu and Met; Phe and Tyr; Tyr and Trp.
  • therapeutic agents such as cytotoxic agents, anti-angiogenic agents, pro-apoptotic agents, antibiotics, hormones, hormone antagonists, chemokines, drugs, prodrugs, toxins, enzymes or other agents may be used as adjunct therapies to the anti-cancer vaccine DNL complexes described herein.
  • Drugs of use may possess a pharmaceutical property selected from the group consisting of antimitotic, antikinase, alkylating, antimetabolite, antibiotic, alkaloid, anti-angiogenic, pro-apoptotic agents and combinations thereof.
  • Exemplary drugs of use may include 5-fluorouracil, aplidin, azaribine, anastrozole, anthracyclines, bendamustine, bleomycin, bortezomib, bryostatin-1, busulfan, calicheamycin, camptothecin, carboplatin, 10-hydroxycamptothecin, carmustine, celebrex, chlorambucil, cisplatin (CDDP), Cox-2 inhibitors, irinotecan (CPT-11), SN-38, carboplatin, cladribine, camptothecans, cyclophosphamide, cytarabine, dacarbazine, docetaxel, dactinomycin, daunorubicin, doxorubicin, 2-pyrrolinodoxorubicine (2P-DOX), cyano-morpholino doxorubicin, doxorubicin glucuronide, epirubicin glucuronide,
  • Toxins of use may include ricin, abrin, alpha toxin, saporin, ribonuclease (RNase), e.g., onconase, DNase I, Staphylococcal enterotoxin-A, pokeweed antiviral protein, gelonin, diphtheria toxin, Pseudomonas exotoxin, and Pseudomonas endotoxin.
  • RNase ribonuclease
  • a therapeutic agent may be an immunomodulator.
  • An immunomodulator is an agent that when present, alters, suppresses or stimulates the body's immune system.
  • Immunomodulators of use may include a cytokine, a stem cell growth factor, a lymphotoxin, a hematopoietic factor, a colony stimulating factor (CSF), an interferon (IFN), erythropoietin, thrombopoietin and a combination thereof.
  • lymphotoxins such as tumor necrosis factor (TNF), hematopoietic factors, such as interleukin (IL), colony stimulating factor, such as granulocyte-colony stimulating factor (G-CSF) or granulocyte macrophage-colony stimulating factor (GM-CSF), interferon, such as interferons- ⁇ , - ⁇ or - ⁇ , and stem cell growth factor, such as that designated "Sl factor”.
  • TNF tumor necrosis factor
  • IL interleukin
  • colony stimulating factor such as granulocyte-colony stimulating factor (G-CSF) or granulocyte macrophage-colony stimulating factor (GM-CSF)
  • interferon such as interferons- ⁇ , - ⁇ or - ⁇
  • stem cell growth factor such as that designated "Sl factor”.
  • the therapeutic agent may include one or more cytokines, such as lymphokines, monokines, growth factors and traditional polypeptide hormones. Included among the cytokines are growth hormones such as human growth hormone, N- methionyl human growth hormone, and bovine growth hormone; parathyroid hormone; thyroxine; insulin; proinsulin; relaxin; prorelaxin; glycoprotein hormones such as follicle stimulating hormone (FSH), thyroid stimulating hormone (TSH), and luteinizing hormone (LH); placenta growth factor (PlGF), hepatic growth factor; prostaglandin, fibroblast growth factor; prolactin; placental lactogen, OB protein; tumor necrosis factor- ⁇ and - ⁇ ; mullerian- inhibiting substance; mouse gonadotropin-associated peptide; inhibin; activin; vascular endothelial growth factor; integrin; thrombopoietin (TPO); nerve growth factors such as NGF
  • Anti-angiogenic agents include angiostatin, baculostatin, canstatin, maspin, anti-VEGF antibodies, anti-PIGF peptides and antibodies, anti-vascular growth factor antibodies, anti- FIk-I antibodies, anti-Fit- 1 antibodies and peptides, anti-Kras antibodies, anti-cMET antibodies, anti-MIF (macrophage migration-inhibitory factor) antibodies, laminin peptides, fibronectin peptides, plasminogen activator inhibitors, tissue metalloproteinase inhibitors, interferons, interleukin- 12, IP-IO, Gro- ⁇ , thrombospondin, 2-methoxyoestradiol, proliferin- related protein, carboxiamidotriazole, CMlOl, Marimastat, pentosan polysulphate, angiopoietin-2, interferon-alpha, herbimycin A, PNU145156E, 16K prolactin fragment
  • Other useful therapeutic agents may comprise oligonucleotides, especially antisense oligonucleotides that preferably are directed against oncogenes and oncogene products, such as bcl-2 or p53.
  • a preferred form of therapeutic oligonucleotide is siRNA.
  • Diagnostic agents may be selected from the group consisting of a radionuclide, a radiological contrast agent, a paramagnetic ion, a metal, a fluorescent label, a chemiluminescent label, an ultrasound contrast agent and a photoactive agent. Such diagnostic agents are well known and any such known diagnostic agent may be used.
  • Non- limiting examples of diagnostic agents may include a radionuclide such as 110 In, 111 In, 177 Lu, 18 F, 52 Fe, 62 Cu, 64 Cu, 67 Cu, 67 Ga, 68 Ga, 86 Y, 90 Y, 89 Zr, 94m Tc, 94 Tc, " m Tc, 120 1, 123 1, 124 1, 125 I, 131 I, 154"158 Gd, 32 P, 11 C, 13 N, 15 0, 186 Re, 188 Re, 51 Mn, 52m Mn, 55 Co, 72 As, 75 Br, 76 Br, 82m Rb, 83 Sr, or other gamma-, beta-, or positron-emitters.
  • a radionuclide such as 110 In, 111 In, 177 Lu, 18 F, 52 Fe, 62 Cu, 64 Cu, 67 Cu, 67 Ga, 68 Ga, 86 Y, 90 Y, 89 Zr, 94m Tc, 94 Tc, "
  • Paramagnetic ions of use may include chromium (III), manganese (II), iron (III), iron (II), cobalt (II), nickel (II), copper (II), neodymium (III), samarium (III), ytterbium (III), gadolinium (III), vanadium (II), terbium (III), dysprosium (III), holmium (III) or erbium (III).
  • Metal contrast agents may include lanthanum (III), gold (III), lead (II) or bismuth (III).
  • Ultrasound contrast agents may comprise liposomes, such as gas filled liposomes.
  • Radiopaque diagnostic agents may be selected from compounds, barium compounds, gallium compounds, and thallium compounds.
  • fluorescent labels are known in the art, including but not limited to fluorescein isothiocyanate, rhodamine, phycoerytherin, phycocyanin, allophycocyanin, o- phthaldehyde and fluorescamine.
  • Chemiluminescent labels of use may include luminol, isoluminol, an aromatic acridinium ester, an imidazole, an acridinium salt or an oxalate ester.
  • the anti-cancer vaccine DNL construct may be conjugated to one or more therapeutic or diagnostic agents.
  • the therapeutic agents do not need to be the same but can be different, e.g. a drug and a radioisotope.
  • 131 I can be incorporated into a tyrosine of an antibody or fusion protein and a drug attached to an epsilon amino group of a lysine residue.
  • Therapeutic and diagnostic agents also can be attached, for example to reduced SH groups and/or to carbohydrate side chains. Many methods for making covalent or non-covalent conjugates of therapeutic or diagnostic agents with antibodies or fusion proteins are known in the art and any such known method may be utilized.
  • a therapeutic or diagnostic agent can be attached at the hinge region of a reduced antibody component via disulfide bond formation.
  • such agents can be attached using a heterobifunctional cross-linker, such as vV-succinyl 3-(2-pyridyldithio)propionate (SPDP). Yu et al, Int. J. Cancer 56:244 (1994). General techniques for such conjugation are well-known in the art.
  • the therapeutic or diagnostic agent can be conjugated via a carbohydrate moiety in the Fc region of the antibody.
  • the carbohydrate group can be used to increase the loading of the same agent that is bound to a thiol group, or the carbohydrate moiety can be used to bind a different therapeutic or diagnostic agent.
  • the Fc region may be absent if the antibody used as the antibody component of the immunoconjugate is an antibody fragment.
  • a carbohydrate moiety into the light chain variable region of a full length antibody or antibody fragment. See, for example, Leung et al, J. Immunol 154:5919 (1995); Hansen et al, U.S. Patent No. 5,443,953 (1995), Leung et al, U.S. patent No. 6,254,868, incorporated herein by reference in their entirety.
  • the engineered carbohydrate moiety is used to attach the therapeutic or diagnostic agent.
  • a chelating agent may be attached to an antibody, antibody fragment or fusion protein and used to chelate a therapeutic or diagnostic agent, such as a radionuclide.
  • exemplary chelators include but are not limited to DTPA (such as Mx-DTPA), DOTA, TETA, NETA or NOTA.
  • Methods of conjugation and use of chelating agents to attach metals or other ligands to proteins are well known in the art (see, e.g., U.S. Patent Application Serial No. 12/112,289, incorporated herein by reference in its entirety).
  • radioactive metals or paramagnetic ions may be attached to proteins or peptides by reaction with a reagent having a long tail, to which may be attached a multiplicity of chelating groups for binding ions.
  • a tail can be a polymer such as a polylysine, polysaccharide, or other derivatized or derivatizable chains having pendant groups to which can be bound chelating groups such as, e.g., ethylenediaminetetraacetic acid (EDTA), diethylenetriaminepentaacetic acid (DTPA), porphyrins, polyamines, crown ethers, bis-thiosemicarbazones, polyoximes, and like groups known to be useful for this purpose.
  • EDTA ethylenediaminetetraacetic acid
  • DTPA diethylenetriaminepentaacetic acid
  • porphyrins polyamines, crown ethers, bis-thiosemicarbazones, polyoximes, and like groups known to be useful for
  • Chelates may be directly linked to antibodies or peptides, for example as disclosed in U.S. Patent 4,824,659, incorporated herein in its entirety by reference.
  • Particularly useful metal-chelate combinations include 2-benzyl-DTPA and its monomethyl and cyclohexyl analogs, used with diagnostic isotopes in the general energy range of 60 to 4,000 keV, such a sweepines 125 T 1, 131 ⁇ 1, 123 T 1, 124 T 1, 62 n Cu, 64 n Cu, 18 ⁇ b ?
  • n r radioimaging H l ⁇ In, 67 n Oa, 99m x n Ic ⁇ ,, 94m X Ic r ,, H C, 13 X N T , I 5r ⁇ >, 76r B»_r , f to n r radioimaging.
  • non-radioactive metals such as manganese, iron and gadolinium
  • Macrocyclic chelates such as NOTA, DOTA, and TETA are of use with a variety of metals and radiometals, most particularly with radionuclides of gallium, yttrium and copper, respectively.
  • Such metal-chelate complexes can be made very stable by tailoring the ring size to the metal of interest.
  • Other ring-type chelates such as macrocyclic polyethers, which are of interest for stably binding nuclides, such as 223 Ra for RAIT are encompassed.
  • Various embodiments concern methods of treating a cancer, such as multiple myeloma, in a subject, such as a mammal, including humans, domestic or companion pets, such as dogs and cats.
  • the methods may comprise administering to a subject a therapeutically effective amount of an anti-cancer vaccine DNL construct.
  • the anti-cancer vaccine DNL construct comprises an anti-CD74 antibody or fragment thereof and a CD20 xenoantigen, as described in further detail in the Examples below.
  • anti-cancer vaccine DNL construct can be supplemented by administering concurrently or sequentially a therapeutically effective amount of another antibody that binds to or is reactive with another antigen on the surface of the target cell.
  • Preferred additional MAbs comprise at least one humanized, chimeric or human MAb selected from the group consisting of a MAb reactive with CD209 (DC-SIGN), CD34, CD74, CD205, TLR 2 (toll-like receptor 2), TLR 4, TLR 7, TLR 9, BDC A-2, BDC A-3, BDC A-4 and HLA- DR.
  • Various antibodies of use are known to those of skill in the art, as discussed above. See, for example, Ghetie et al, Cancer Res.
  • an antibody or fragment thereof against another dendritic cell antigen such as CD209 (DC-SIGN), CD34, CD205, TLR 2 (toll-like receptor 2), TLR 4, TLR 7, TLR 9, BDC A-2, BDC A-3, BDCA-4 or HLA-DR, may be substituted for the anti- CD74 antibody in the DNL complex.
  • CD209 DC-SIGN
  • CD34 CD34
  • CD205 TLR 2 (toll-like receptor 2)
  • TLR 4 TLR 7, TLR 9, BDC A-2, BDC A-3, BDCA-4 or HLA-DR
  • CD209(DC-SIGN) may be obtained from public sources like the American Type Culture Collection or from commercial antibody vendors.
  • CD209(DC-SIGN), CD34, BDCA-2, TLR2, TLR 4, TLR 7 and TLR 9 may be purchased from Santa Cruz Biotechnology, Inc. (Santa Cruz, CA).
  • Antibodies against CD205 and BDCA-3 may be purchased from Miltenyi Biotec Inc. (Auburn, CA). Numerous other commercial sources of antibodies are known to the skilled artisan. [0097] The anti-cancer vaccine DNL construct therapy can be further supplemented with the administration, either concurrently or sequentially, of at least one therapeutic agent.
  • Therapeutic agents used for the treatment of multiple myeloma include dexamethasone, thalidomide/dexamethasone, cyclophosphamide, VAD (vincristine, doxorubicin and dexamethasone), DVd (DOXIL® (PEGylated doxorubicin), vincristine and reduced schedule dexamethasone), BCNU, melphalan, carmustine, bortezomib (VELCADE®), prednisone and corticosteroids.
  • the individual therapeutic agents may be used alone or in various combinations known in the art, such as CP (cyclophosphamide, prednisone), CT (cyclophosphamide, thalidomide), VBMCP (vincristine, BCNU, melphalan, cyclophosphamide, melphalan), VMCP (vincristine, melphalan, cyclophosphamide, prednisone), DT-PACE (dexamethasone, thalidomide, cisplatin, doxorubicin, cyclophosphamide, etoposide), MPT (melphalan, prednisone, thalidomide), CVAD (cyclophosphamide and VAD), EDAP (etoposide, dexamethasone, ara-C, cisplatin) MTD (melphalan, thalidomide, dexamethasone), VT (VELCADE®, thalidomide), V
  • Chemotherapeutic treatment of multiple myeloma prior to stem cell transplantation is referred to as induction therapy.
  • Certain of the chemotherapeutic agents listed herein are more suitable for induction therapy than others.
  • Examples of chemotherapeutic treatments of use for induction therapy for MM include dexamethasone, thalidomide/dexamethasone, cyclophosphamide, VAD and DVd.
  • MM is often resistant to chemotherapeutic treatment, administration of therapeutic agents may occur at higher doses than are used in conventional chemotherapy.
  • Such high-dose chemotherapy usually results in bone marrow toxicity and is often used in conjunction with stem cell transplantation.
  • Dosages and schedules for chemotherapeutic treatment of MM are well known in the art and any such known dosage and/or schedule may be utilized in conjunction with administration of the anticancer vaccine DNL construct.
  • DNL vaccine is used for other types of cancers besides MM
  • other chemotherapeutic regimens are known.
  • “CVB” 1.5 g/m 2 cyclophosphamide, 200-400 mg/m 2 etoposide, and 150-200 mg/m 2 carmustine
  • CVB is a regimen used to treat non- Hodgkin's lymphoma. Patti et al., Eur. J. Haematol. 57:18 (1993).
  • Other suitable combination chemotherapeutic regimens are well-known to those of skill in the art.
  • first generation chemotherapeutic regimens for treatment of intermediate- grade non-Hodgkin's lymphoma include C-MOPP (cyclophosphamide, vincristine, procarbazine and prednisone) and CHOP (cyclophosphamide, doxorubicin, vincristine, and prednisone).
  • a useful second generation chemotherapeutic regimen is m-BACOD (methotrexate, bleomycin, doxorubicin, cyclophosphamide, vincristine, dexamethasone and leucovorin), while a suitable third generation regimen is MACOP-B (methotrexate, doxorubicin, cyclophosphamide, vincristine, prednisone, bleomycin and leucovorin).
  • m-BACOD metalhotrexate, bleomycin, doxorubicin, cyclophosphamide, vincristine, dexamethasone and leucovorin
  • MACOP-B metalhotrexate, doxorubicin, cyclophosphamide, vincristine, prednisone, bleomycin and leucovorin
  • Chemotherapeutic agents of use against other types of cancers include, but are not limited to, 5-fluorouracil, aplidin, azaribine, anastrozole, anthracyclines, bendamustine, bleomycin, bortezomib, bryostatin-1, busulfan, calicheamycin, camptothecin, carboplatin, 10- hydroxycamptothecin, carmustine, celebrex, chlorambucil, cisplatin (CDDP), Cox-2 inhibitors, irinotecan (CPT-11), SN-38, carboplatin, cladribine, camptothecans, cyclophosphamide, cytarabine, dacarbazine, docetaxel, dactinomycin, daunorubicin, doxorubicin, 2-pyrrolinodoxorubicine (2P-DOX), cyano-morpholino doxorubicin, doxorubicin glucur
  • the anti-cancer vaccine DNL construct can be formulated according to known methods to prepare pharmaceutically useful compositions, whereby the anti-cancer vaccine DNL construct is combined in a mixture with a pharmaceutically suitable excipient.
  • Sterile phosphate-buffered saline is one example of a pharmaceutically suitable excipient.
  • Other suitable excipients are well-known to those in the art. See, for example, Ansel et al. , PHARMACEUTICAL DOSAGE FORMS AND DRUG DELIVERY SYSTEMS, 5th Edition (Lea & Febiger 1990), and Gennaro (ed.), REMINGTON'S PHARMACEUTICAL SCIENCES, 18th Edition (Mack Publishing Company 1990), and revised editions thereof.
  • the anti-cancer vaccine can be formulated for intravenous administration via, for example, bolus injection or continuous infusion.
  • Formulations for injection can be presented in unit dosage form, e.g., in ampoules or in multi-dose containers, with an added preservative.
  • the compositions can take such forms as suspensions, solutions or emulsions in oily or aqueous vehicles, and can contain formulatory agents such as suspending, stabilizing and/or dispersing agents.
  • the active ingredient can be in powder form for constitution with a suitable vehicle, e.g., sterile pyrogen-free water, before use.
  • Control release preparations can be prepared through the use of polymers to complex or adsorb the anti-cancer vaccine DNL construct.
  • biocompatible polymers include matrices of poly(ethylene-co-vinyl acetate) and matrices of a polyanhydride copolymer of a stearic acid dimer and sebacic acid. Sherwood et al. , Bio/Technology 10:1446 (1992). The rate of release from such a matrix depends upon the molecular weight of the anti-cancer vaccine DNL construct, the amount of anti-cancer vaccine within the matrix, and the size of dispersed particles.
  • the anti-cancer vaccine DNL construct may also be administered to a mammal subcutaneously or even by other parenteral routes. Moreover, the administration may be by continuous infusion or by single or multiple boluses.
  • the anti-cancer vaccine is administered as a single or multiple boluses via subcutaneous injection.
  • the dosage of an administered anti-cancer vaccine DNL construct for humans will vary depending upon such factors as the patient's age, weight, height, sex, general medical condition and previous medical history. It may be desirable to provide the recipient with a dosage of anti-cancer vaccine DNL construct that is in the range of from about 1 mg/kg to 25 mg/kg as a single administration, although a lower or higher dosage also may be administered as circumstances dictate.
  • a dosage of 1-20 mg/kg for a 70 kg patient, for example, is 70-1,400 mg, or 41-824 mg/m for a 1.7-m patient. The dosage may be repeated as needed for induction of an immune response.
  • the vaccine DNL constructs are of use for therapy of cancer.
  • cancers include, but are not limited to, carcinoma, lymphoma, glioblastoma, melanoma, sarcoma, and leukemia, myeloma, or lymphoid malignancies.
  • squamous cell cancer e.g., epithelial squamous cell cancer
  • Ewing sarcoma e.g., Ewing sarcoma
  • Wilms tumor astrocytomas
  • lung cancer including small-cell lung cancer, non-small cell lung cancer, adenocarcinoma of the lung and squamous carcinoma of the lung, cancer of the peritoneum, hepatocellular cancer, gastric or stomach cancer including gastrointestinal cancer, pancreatic cancer, glioblastoma multiforme, cervical cancer, ovarian cancer, liver cancer, bladder cancer, hepatoma, hepatocellular carcinoma, neuroendocrine tumors, medullary thyroid cancer, differentiated thyroid carcinoma, breast cancer, ovarian cancer, colon cancer, rectal cancer, endometrial cancer or uterine carcinoma, salivary gland carcinoma, kidney or renal cancer, prostate cancer, vulvar cancer, anal carcinoma, penile carcinoma, as well as head-and-neck cancer.
  • cancer includes primary malignant cells or tumors (e.g., those whose cells have not migrated to sites in the subject's body other than the site of the original malignancy or tumor) and secondary malignant cells or tumors (e.g., those arising from metastasis, the migration of malignant cells or tumor cells to secondary sites that are different from the site of the original tumor).
  • primary malignant cells or tumors e.g., those whose cells have not migrated to sites in the subject's body other than the site of the original malignancy or tumor
  • secondary malignant cells or tumors e.g., those arising from metastasis, the migration of malignant cells or tumor cells to secondary sites that are different from the site of the original tumor.
  • cancers or malignancies include, but are not limited to: Acute Childhood Lymphoblastic Leukemia, Acute Lymphoblastic Leukemia, Acute Lymphocytic Leukemia, Acute Myeloid Leukemia, Adrenocortical Carcinoma, Adult (Primary) Hepatocellular Cancer, Adult (Primary) Liver Cancer, Adult Acute Lymphocytic Leukemia, Adult Acute Myeloid Leukemia, Adult Hodgkin's Lymphoma, Adult Lymphocytic Leukemia, Adult Non-Hodgkin's Lymphoma, Adult Primary Liver Cancer, Adult Soft Tissue Sarcoma, AIDS-Related Lymphoma, AIDS-Related Malignancies, Anal Cancer, Astrocytoma, Bile Duct Cancer, Bladder Cancer, Bone Cancer, Brain Stem Glioma, Brain Tumors, Breast Cancer, Cancer of the Renal Pelvis and Ureter, Central Nervous System (Primary) Ly
  • the methods and compositions described and claimed herein may be used to treat malignant or premalignant conditions and to prevent progression to a neoplastic or malignant state, including but not limited to those disorders described above. Such uses are indicated in conditions known or suspected of preceding progression to neoplasia or cancer, in particular, where non-neoplastic cell growth consisting of hyperplasia, metaplasia, or most particularly, dysplasia has occurred (for review of such abnormal growth conditions, see Robbins and Angell, Basic Pathology, 2d Ed., W. B. Saunders Co., Philadelphia, pp. 68-79 (1976)).
  • Dysplasia is frequently a forerunner of cancer, and is found mainly in the epithelia.
  • Dysplasia characteristically occurs where there exists chronic irritation or inflammation.
  • Dysplastic disorders which can be treated include, but are not limited to, anhidrotic ectodermal dysplasia, anterofacial dysplasia, asphyxiating thoracic dysplasia, atriodigital dysplasia, bronchopulmonary dysplasia, cerebral dysplasia, cervical dysplasia, chondroectodermal dysplasia, cleidocranial dysplasia, congenital ectodermal dysplasia, craniodiaphysial dysplasia, craniocarpotarsal dysplasia, craniometaphysial dysplasia, dentin dysplasia, diaphysial dysplasia, ectodermal dysplasia, enamel dysplasia, encephalo-o
  • Additional pre-neoplastic disorders which can be treated include, but are not limited to, benign dysproliferative disorders (e.g., benign tumors, fibrocystic conditions, tissue hypertrophy, intestinal polyps or adenomas, and esophageal dysplasia), leukoplakia, keratoses, Bowen's disease, Farmer's Skin, solar cheilitis, and solar keratosis.
  • the method of the invention is used to inhibit growth, progression, and/or metastasis of cancers, in particular those listed above.
  • Additional hyperproliferative diseases, disorders, and/or conditions include, but are not limited to, progression, and/or metastases of malignancies and related disorders such as leukemia (including acute leukemias (e.g., acute lymphocytic leukemia, acute myelocytic leukemia (including myeloblasts, promyelocyte, myelomonocytic, monocytic, and erythroleukemia)) and chronic leukemias (e.g., chronic myelocytic (granulocytic) leukemia and chronic lymphocytic leukemia)), polycythemia vera, lymphomas (e.g., Hodgkin's disease and non-Hodgkin's disease), multiple myeloma, Waldenstrom's macroglobulinemia, heavy chain disease, and solid tumors including, but not limited to, sarcomas and carcinomas such as fibrosarcoma, myxosarcoma, liposar
  • kits containing components suitable for treating or diagnosing diseased tissue in a patient.
  • Exemplary kits may contain at least one or more anti-cancer vaccine constructs as described herein.
  • a device capable of delivering the kit components through some other route may be included.
  • One type of device, for applications such as parenteral delivery, is a syringe that is used to inject the composition into the body of a subject. Inhalation devices may also be used.
  • a therapeutic agent may be provided in the form of a prefilled syringe or autoinjection pen containing a sterile, liquid formulation or lyophilized preparation.
  • the kit components may be packaged together or separated into two or more containers.
  • the containers may be vials that contain sterile, lyophilized formulations of a composition that are suitable for reconstitution.
  • a kit may also contain one or more buffers suitable for reconstitution and/or dilution of other reagents.
  • Other containers that may be used include, but are not limited to, a pouch, tray, box, tube, or the like.
  • Kit components may be packaged and maintained sterilely within the containers. Another component that can be included is instructions to a person using a kit for its use.
  • Still other embodiments may concern DNA sequences comprising a nucleic acid encoding a anti-cancer vaccine construct, or its constituent fusion proteins.
  • Fusion proteins may comprise an anti-CD74 antibody or CD20 xenoantigen attached to a different peptide or protein, such as the AD and DDD peptides utilized for DNL construct formation as discussed in more detail in the Examples below.
  • the encoded fusion proteins may comprise a DDD or AD moiety attached to a different antibody or xenoantigen.
  • Various embodiments relate to expression vectors comprising the coding DNA sequences.
  • the vectors may contain sequences encoding the light and heavy chain constant regions and the hinge region of a human immunoglobulin to which may be attached chimeric, humanized or human variable region sequences.
  • the vectors may additionally contain promoters that express the encoded protein(s) in a selected host cell, enhancers and signal or leader sequences. Vectors that are particularly useful are pdHL2 or GS.
  • the light and heavy chain constant regions and hinge region may be from a human EU myeloma immunoglobulin, where optionally at least one of the amino acid in the allotype positions is changed to that found in a different IgGl allotype, and wherein optionally amino acid 253 of the heavy chain of EU based on the EU number system may be replaced with alanine.
  • an IgGl sequence may be converted to an IgG4 sequence.
  • the DNL technique can be used to make dimers, trimers, tetramers, hexamers, etc. comprising virtually any antibodies or fragments thereof or other effector moieties.
  • IgG antibodies, F(ab') 2 antibody fragments and xenoantigens, such as CD20 xenoantigens may be produced as fusion proteins containing either a dimerization and docking domain (DDD) or anchoring domain (AD) sequence.
  • DDD and AD moieties are produced as fusion proteins, the skilled artisan will realize that other methods of conjugation, such as chemical cross-linking, may be utilized within the scope of the claimed methods and compositions.
  • DNL constructs may be formed by combining, for example, an Fab-DDD fusion protein of an anti-CD74 antibody with a CD20- AD fusion protein.
  • constructs may be made that combine IgG-AD fusion proteins with CD20-DDD fusion proteins.
  • the technique is not limiting and any protein or peptide of use may be produced as an AD or DDD fusion protein for incorporation into a DNL construct.
  • the AD and DDD conjugates are not limited to proteins or peptides and may comprise any molecule that may be cross-linked to an AD or DDD sequence using any cross- linking technique known in the art.
  • independent transgenic cell lines may be developed for each DDD or AD fusion protein. Once produced, the modules can be purified if desired or maintained in the cell culture supernatant fluid. Following production, any DDD-fusion protein module can be combined with any AD-fusion protein module to generate a DNL construct. For different types of constructs, different AD or DDD sequences may be utilized. Exemplary DDD and AD sequences are provided below.
  • DDDl SHIQIPPGLTELLQGYTVEVLRQQPPDLVEFAVEYFTRLREARA (SEQ ID NO: 10)
  • DDD2 CGHIQIPPGLTELLQGYTVEVLRQQPPDLVEFAVEYFTRLREARA (SEQ ID NO:11)
  • ADl QIEYLAKQIVDNAIQQA (SEQ ID NO: 12)
  • AD2 CGQIEYLAKQIVDNAIQQAGC (SEQ ID NO:13)
  • the plasmid vector pdHL2 has been used to produce a number of antibodies and antibody-based constructs. See Gillies et al, J Immunol Methods (1989), 125:191-202; Losman et al., Cancer (Phila) (1997), 80:2660-6.
  • the di-cistronic mammalian expression vector directs the synthesis of the heavy and light chains of IgG.
  • the vector sequences are mostly identical for many different IgG-pdHL2 constructs, with the only differences existing in the variable domain (VH and VL) sequences. Using molecular biology tools known to those skilled in the art, these IgG expression vectors can be converted into Fab-DDD or Fab- AD expression vectors.
  • Fab-DDD expression vectors To generate Fab-DDD expression vectors, the coding sequences for the hinge, CH2 and CH3 domains of the heavy chain are replaced with a sequence encoding the first 4 residues of the hinge, a 14 residue Gly-Ser linker and the first 44 residues of human RIIa (referred to as DDDl).
  • ADl AKAP-ZS
  • Two shuttle vectors were designed to facilitate the conversion of IgG-pdHL2 vectors to either Fab-DDD 1 or Fab- ADl expression vectors, as described below.
  • the CHl domain was amplified by PCR using the pdHL2 plasmid vector as a template.
  • the left PCR primer consisted of the upstream (5') end of the CHl domain and a SacII restriction endonuc lease site, which is 5' of the CHl coding sequence.
  • the right primer consisted of the sequence coding for the first 4 residues of the hinge (PKSC (SEQ ID NO:29) followed by four glycines and a serine, with the final two codons (GS) comprising a Bam HI restriction site.
  • the 410 bp PCR amplimer was cloned into the PGEMT® PCR cloning vector (PROMEGA®, Inc.) and clones were screened for inserts in the T7 (5') orientation.
  • a duplex oligonucleotide designated (G 4 S) 2 DDDl ((G 4 S) 2 disclosed as SEQ ID NO: 14), was synthesized by Sigma GENOSYS® (Haverhill, UK) to code for the amino acid sequence of DDDl preceded by 11 residues of the linker peptide, with the first two codons comprising a BamHI restriction site. A stop codon and an Eagl restriction site are appended to the 3 'end. The encoded polypeptide sequence is shown below.
  • oligonucleotides designated RIIA 1-44 top and RIIA 1-44 bottom, that overlap by 30 base pairs on their 3' ends, were synthesized (Sigma GENOS YS®) and combined to comprise the central 154 base pairs of the 174 bp DDDl sequence.
  • the oligonucleotides were annealed and subjected to a primer extension reaction with Taq polymerase. Following primer extension, the duplex was amplified by PCR. The amplimer was cloned into PGEMT® and screened for inserts in the T7 (5') orientation.
  • a duplex oligonucleotide designated (G 4 S) 2 -ADl ((G 4 S) 2 disclosed as SEQ ID NO: 14), was synthesized (Sigma GENOSYS®) to code for the amino acid sequence of ADl preceded by 11 residues of the linker peptide with the first two codons comprising a BamHI restriction site. A stop codon and an Eagl restriction site are appended to the 3 'end. The encoded polypeptide sequence is shown below.
  • AKAP-IS Top and AKAP-IS Bottom Two complimentary overlapping oligonucleotides encoding the above peptide sequence, designated AKAP-IS Top and AKAP-IS Bottom, were synthesized and annealed. The duplex was amplified by PCR. The amplimer was cloned into the PGEMT® vector and screened for inserts in the T7 (5') orientation.
  • a 190 bp fragment encoding the DDDl sequence was excised from PGEMT® with BamHI and Notl restriction enzymes and then ligated into the same sites in CHl -PGEMT® to generate the shuttle vector CHl -DDDl -PGEMT®.
  • a 110 bp fragment containing the ADl sequence was excised from PGEMT® with BamHI and Notl and then ligated into the same sites in CHl -PGEMT® to generate the shuttle vector CHl -ADl -PGEMT®. Cloning CHl-DDDl or CHl-ADl into pdHL2-based vectors
  • CHl-DDDl or CHl-ADl can be incorporated into any IgG construct in the pdHL2 vector.
  • the entire heavy chain constant domain is replaced with one of the above constructs by removing the SacII/Eagl restriction fragment (CHl -CH3) from pdHL2 and replacing it with the SacII/Eagl fragment of CHl-DDDl or CHl-ADl, which is excised from the respective pGemT shuttle vector.
  • h679-Fd-ADl-pdHL2 is an expression vector for production of h679 Fab with ADl coupled to the carboxyl terminal end of the CHl domain of the Fd via a flexible Gly/Ser peptide spacer composed of 14 amino acid residues.
  • a pdHL2 -based vector containing the variable domains of h679 was converted to h679-Fd-ADl-pdHL2 by replacement of the SacII/Eagl fragment with the CHl-ADl fragment, which was excised from the CHl-ADl- SV3 shuttle vector with SacII and Eagl.
  • C-DDD l-Fd-hMN-14-pdHL2 is an expression vector for production of a stable dimer that comprises two copies of a fusion protein C-DDD 1-Fab-hMN- 14, in which DDDl is linked to hMN-14 Fab at the carboxyl terminus of CHl via a flexible peptide spacer.
  • the plasmid vector hMN-14(I)-pdHL2 which has been used to produce hMN-14 IgG, was converted to C-DDD l-Fd-hMN-14-pdHL2 by digestion with SacII and Eagl restriction endonucleases to remove the CH1-CH3 domains and insertion of the CHl-DDDl fragment, which was excised from the CH1-DDD1-SV3 shuttle vector with SacII and Eagl.
  • C-DDD2-Fd-hMN-14-pdHL2 is an expression vector for production of C-DDD2-Fab- hMN-14, which possesses a dimerization and docking domain sequence of DDD2 appended to the carboxyl terminus of the Fd of hMN-14 via a 14 amino acid residue Gly/Ser peptide linker.
  • the fusion protein secreted is composed of two identical copies of hMN-14 Fab held together by non-covalent interaction of the DDD2 domains.
  • the expression vector was engineered as follows. Two overlapping, complimentary oligonucleotides, which comprise the coding sequence for part of the linker peptide (GGGGSGGGCG, SEQ ID NO: 17) and residues 1-13 of DDD2, were made synthetically. The oligonucleotides were annealed and phosphorylated with T4 PNK, resulting in overhangs on the 5' and 3' ends that are compatible for ligation with DNA digested with the restriction endonucleases BamHI and Pstl, respectively.
  • the duplex DNA was ligated with the shuttle vector CH1-DDD1-PGEMT®, which was prepared by digestion with BamHI and Pstl, to generate the shuttle vector CH1-DDD2- PGEMT®.
  • a 507 bp fragment was excised from CH1-DDD2-PGEMT® with SacII and Eagl and ligated with the IgG expression vector hMN-14(I)-pdHL2, which was prepared by digestion with SacII and Eagl.
  • the final expression construct was designated C-DDD2-Fd- hMN-14-pdHL2. Similar techniques have been utilized to generated DDD2-fusion proteins of the Fab fragments of a number of different humanized antibodies.
  • h679-Fd-AD2-pdHL2 is an expression vector for the production of h679-Fab-AD2, which possesses an anchoring domain sequence of AD2 appended to the carboxyl terminal end of the CHl domain via a 14 amino acid residue Gly/Ser peptide linker.
  • AD2 has one cysteine residue preceding and another one following the anchor domain sequence of ADl.
  • the expression vector was engineered as follows. Two overlapping, complimentary oligonucleotides which comprise the coding sequence for AD2 and part of the linker sequence, were made synthetically. The oligonucleotides were annealed and phosphorylated with T4 PNK, resulting in overhangs on the 5' and 3' ends that are compatible for ligation with DNA digested with the restriction endonucleases BamHI and Spel, respectively. [0139] The duplex DNA was ligated into the shuttle vector CH1-AD1-PGEMT®, which was prepared by digestion with BamHI and Spel, to generate the shuttle vector CH1-AD2- PGEMT®.
  • a 429 base pair fragment containing CHl and AD2 coding sequences was excised from the shuttle vector with SacII and Eagl restriction enzymes and ligated into h679-pdHL2 vector that prepared by digestion with those same enzymes.
  • the final expression vector is h679-Fd-AD2-pdHL2.
  • a trimeric DNL construct designated TF2 was obtained by reacting C-DDD2-Fab- hMN-14 with h679-Fab-AD2.
  • a pilot batch of TF2 was generated with >90% yield as follows.
  • Protein L-purified C-DDD2-Fab-hMN-14 200 mg was mixed with h679-Fab-AD2 (60 mg) at a 1.4: 1 molar ratio.
  • the total protein concentration was 1.5 mg/ml in PBS containing 1 mM EDTA.
  • Subsequent steps involved TCEP reduction, HIC chromatography, DMSO oxidation, and IMP 291 affinity chromatography. Before the addition of TCEP, SE- HPLC did not show any evidence of a 2 b formation.
  • TF2 was purified to near homogeneity by IMP 291 affinity chromatography (not shown).
  • IMP 291 is a synthetic peptide containing the HSG hapten to which the 679 Fab binds (Rossi et al, 2005, Clin Cancer Res 1 l:7122s-29s).
  • SE-HPLC analysis of the IMP 291 unbound fraction demonstrated the removal of a ⁇ , a 2 and free kappa chains from the product (not shown).
  • Non-reducing SDS-PAGE analysis demonstrated that the majority of TF2 exists as a large, covalent structure with a relative mobility near that of IgG (not shown). Reducing SDS-PAGE shows that any additional bands apparent in the non-reducing gel are product- related (not shown), as only bands representing the constituent polypeptides of TF2 were evident (not shown). However, the relative mobilities of each of the four polypeptides were too close to be resolved.
  • MALDI-TOF mass spectrometry revealed a single peak of 156,434 Da, which is within 99.5% of the calculated mass (157,319 Da) of TF2.
  • TF2 C-DDDl- hMN-14+h679-ADl (used as a control sample of noncovalent a 2 b complex), or C-DDD2- hMN-14+h679-AD2 (used as a control sample of unreduced a 2 and b components) were diluted to 1 ⁇ g/ml (total protein) and passed over a sensorchip immobilized with HSG.
  • the response for TF2 was approximately two-fold that of the two control samples, indicating that only the h679-Fab-AD component in the control samples would bind to and remain on the sensorchip.
  • a plasmid shuttle vector was produced to facilitate the conversion of any IgG-pdHL2 vector into a CH 3 -AD2-IgG-pdHL2 vector.
  • the gene for the Fc (C R2 and C H3 domains) was amplified by PCR using the pdHL2 vector as a template and the following oligonucleotide primers:
  • the amplimer was cloned in the pGemT PCR cloning vector (Promega).
  • the Fc insert fragment was excised from pGemT with Xba I and Bam HI and ligated with AD2-pdHL2 vector that was prepared by digesting h679-Fab-AD2-pdHL2 (Rossi et al, Proc Natl Acad Sci USA 2006, 103:6841-6) with Xba I and Bam HI, to generate the shuttle vector Fc-AD2- pdHL2.
  • C H3 -AD2- IgG-pdHL2 vectors (30 ⁇ g) were linearized by digestion with Sal I restriction endonuclease and transfected into Sp2/0-Agl4 (2.8 x 10 6 cells) by electroporation (450 volts, 25 ⁇ F).
  • the pdHL2 vector contains the gene for dihydrofolate reductase allowing clonal selection as well as gene amplification with methotrexate (MTX).
  • transgenic clones were selected in media containing 0.2 ⁇ M MTX.
  • Clones were screened for C H3 -AD2-IgG productivity by a sandwich ELISA using 96-well microtitre plates coated with specific antiidiotype MAbs.
  • Conditioned media from the putative clones were transferred to the micro- plate wells and detection of the fusion protein was accomplished with horseradish peroxidase-conjugated goat anti-human IgG F(ab') 2 (Jackson ImmunoResearch Laboratories, West Grove, PA). Wells giving the highest signal were expanded and ultimately used for production.
  • roller bottle cultures were seeded at 2 x 10 5 cells/ml and incubated in a roller bottle incubator at 37°C under 5% CO 2 until the cell viability dropped below 25% (-10 days).
  • Culture broth was clarified by centrifugation, filtered, and concentrated up to 50-fold by ultrafiltration.
  • concentrated supernatant fluid was loaded onto a Protein-A (MAB Select) affinity column. The column was washed to baseline with PBS and the fusion proteins were eluted with 0.1 M Glycine, pH 2.5.
  • DDD2-mCD20(136-178) and Construction of DDD2- mCD20(136-l 78)-pdHL2 are the expression vector for DDD2-mCD20(136-
  • mCD20 which comprises DDD2-linker-mCD20(136-178)-HHHHHH (HHHHHH disclosed as SEQ ID NO:30).
  • the extracellular domain of mouse CD20 (mCD20) is referred to as mCD20(136-178), comprising amino acid residues 136 to 178 of the sequence shown below:
  • the PCR amplimer (141 bp) is cloned into the PGEMT® vector (PROMEGA®).
  • a DDD2-pdHL2 mammalian expression vector for example, N-DDD2-hG-CSF-His-pdHL2 , is prepared for ligation with the amplimer by digestion with Xbal and Bam HI restriction endonucleases.
  • the mCD20-amplimer is excised from PGEMT® with Xbal and Bam HI and ligated into the DDD2-pdHL2 vector to generate the expression vector DDD2-mCD20(l 36- 178)-pdHL2.
  • the vector DDD2-mCD20(l 36-178) is linearized by digestion with Sail enzyme and stably transfected into SpESF myeloma cells by electroporation (see, e.g., U.S. Patent 7,537,930, the Examples section of which is incorporated herein by reference).
  • a number of clones are found to have detectable levels of DDD2-mCD20(136-178) by ELISA, from which the best producing clone is selected and subsequently amplified with increasing methotrexate (MTX) concentrations from 0.1 to 0.8 ⁇ M over five weeks. At this stage, it is sub-cloned by limiting dilution and the highest producing sub-clone is expanded.
  • MTX methotrexate
  • the clone is expanded to 34 roller bottles containing a total of 20 L of serum-free Hybridoma SFM with 0.8 ⁇ M MTX and allowed to reach terminal culture.
  • the supernatant fluid is clarified by centrifugation and filtered (0.2 ⁇ M).
  • the filtrate is diafiltered into IX Binding buffer (10 mM imidazole, 0.5 M NaCl, 50 mM NaH 2 PO 4 , pH 7.5) and concentrated to 310 mL in preparation for purification by immobilized metal affinity chromatography (IMAC).
  • the concentrate is loaded onto a 30-mL Ni-NTA column, which is washed with 500 mL of 0.02% Tween 20 in IX binding buffer and then 290 mL of 30 mM imidazole, 0.02% Tween 20, 0.5 M NaCl, 50 mM NaH 2 PO 4 , pH 7.5.
  • the product is eluted with 110 mL of 250 mM imidazole, 0.02% Tween 20, 150 mM NaCl, 50 mM NaH 2 PO 4 , pH 7.5.
  • the purity of DDD2-mCD20(136-178) is assessed by SDS-PAGE under reducing conditions.
  • Example 5 Generation of 74-mCD20 DNL vaccine comprising hLLl IgG linked to four copies of mCD20(136-178)
  • C H3 -AD2-Ig(j-hLLl (anti-CD74) is produced as described in Examples 2 and 3.
  • the construct comprises an AD2 moiety attached to the C-terminal end of each heavy chain of the hLLl IgG.
  • DDD2-mCD20(136-178) is produced as described in Example 4.
  • a DNL reaction is performed by mixing hLLl IgG-AD2 and DDD2-mCD20(136-178) in PBS containing 1 mM reduced glutathione. On the next day oxidized glutathione is added to a final concentration of 2 mM and the reaction mixture is purified on a Protein A column 24 h later.
  • two copies of the DDD2-mCD20 are attached to each AD2 moiety, resulting in a DNL complex comprising one hLLl IgG moiety and four mCD20 xenoantigen moieties.
  • the Fab of hLLl is linked to DDD2 and the mCD20(136-178) to AD2.
  • Formation of a DNL construct as described above results in the formation of an MM vaccine, designated hLLl-F(ab) 2 -mCD20(136-178), which comprises a single mCD20(136-178) attached to two Fab moieties of hLLl.
  • the generation of AD2- mCD20(136-178) is described in Example 6..
  • AD2-mCD20(lS6-178)-pdHL2 is the expression vector for recombinant AD2- mCD20(136-178), which comprises AD2-linker-mCD20(136-178)-HHHHHH (HHHHHH disclosed as SEQ ID NO:30).
  • the DNA segment comprising the nucleotide sequence of mCD20(136-178) flanked by BgYl and Eag ⁇ restriction sites is obtained by PCR using a full length murine CD20 cDNA clone as template and the two primers shown below: Upstream primer: Bgl2 _mCD20 primer (30-mer) 5'- AGATCTACACTTTCTCATTTTTTAAAAATG (SEQ ID NO:33) Downstream primer: Eagl _ mCD20 primer (48-mer)
  • the PCR amplimer (162 bp) is cloned into the PGEMT® vector (PROMEGA®).
  • An AD2-pdHL2 mammalian expression vector for example, N-AD2-hTransferrin-His-pdHL2, is prepared for ligation with the amplimer by digestion with BgH and Eag ⁇ restriction endonucleases.
  • the mCD20-amplimer is excised from PGEMT® with BgYl and Eagl and ligated into the AD2-pdHL2 vector to generate the expression vector AD2-mCD20(136-l 78)- pdHL2.
  • Clones expressing AD2-mCD20(136-178) are obtained as described in Example 4 and AD2-mCD20(136-178) is purified from culture supernatants using Ni-select.
  • the AD and DDD sequences incorporated into the DNL complexes comprise the amino acid sequences of AD2 (SEQ ID NO: 13) and DDD2 (SEQ ID NO:11), as described above.
  • sequence variants of the AD and/or DDD moieties may be utilized in construction of the cytokine-MAb DNL complexes. The structure-function relationships of the AD and DDD domains have been the subject of investigation.
  • Alto et al. (2003) performed a bioinformatic analysis of the AD sequence of various AKAP proteins to design an RII selective AD sequence called AKAP-IS (SEQ ID NO: 12), with a binding constant for DDD of 0.4 nM.
  • the AKAP-IS sequence was designed as a peptide antagonist of AKAP binding to PKA. Residues in the AKAP-IS sequence where substitutions tended to decrease binding to DDD are underlined in SEQ ID NO: 12 below.
  • AKAP-IS sequence QIEYLAKQWDNAIQQA (SEQ ID NO: 12)
  • the SuperAKAP-IS sequence may be substituted for the AKAP-IS AD moiety sequence to prepare cytokine-MAb DNL constructs.
  • Other alternative sequences that might be substituted for the AKAP-IS AD sequence are shown in SEQ ID NO: 20-22. Substitutions relative to the AKAP-IS sequence are underlined. It is anticipated that, as with the AKAP-IS sequence shown in SEQ ID NO: 19, the AD moiety may also include the additional N- terminal residues cysteine and glycine and C-terminal residues glycine and cysteine.
  • Ht31 SEQ ID NO:23
  • RIAD SEQ ID NO:24
  • PV-38 SEQ ID NO:25
  • Carr et al. examined the degree of sequence homology between different AKAP-binding DDD sequences from human and non-human proteins and identified residues in the DDD sequences that appeared to be the most highly conserved among different DDD moieties. These are indicated below by underlining with reference to the human PKA RIIa DDD sequence of SEQ ID NO: 10. Residues that were particularly conserved are further indicated by italics. The residues overlap with, but are not identical to those suggested by Kinderman et al. (2006) to be important for binding to AKAP proteins.
  • Example 8 Effects of hLLl on DCs - Efficient binding of hLLl with different subsets of APCs
  • CD74 is expressed in most antigen-presenting cells including blood DCs, B cells, monocytes.
  • APCs APCs
  • MDCl myeloid DCl
  • MDC2 DC2
  • PDC plasmacytoid DC
  • hLLl bound efficiently with blood DC subsets, B cells, monocytes, and monocyte-derived immature DCs (FIG. 1C, FIG. 2B), but not LPS-matured DCs (FIG. 2B, FIG. 2C).
  • the binding efficiency of hLLl in these APC subsets correlates well with their CD74 expression levels.
  • Human IgG can interact with DCs through FcR ligation and has opposing effects on DC maturation depending on which subtype(s) of FcR is involved.
  • hLLl as a humanized IgG, may interact with human DCs not only through CD74 but also through FcR expressed on DCs. For this reason, we speculated that hLLl may influence DC functions through interaction with CD74 or FcR, or both. To investigate this, we tested the effect of hLLl on DC constitutive maturation during in vitro culture of monocytes in the presence of hGM-CSF and hIL-4.
  • hLLl As mature DCs differ from immature DCs mainly in the upregulation of antigen-presenting and costimulatory molecule expression, altered cytokine production, and enhanced T-cell stimulatory ability, we then investigated if hLLl has any effect on the expression level of antigen-presenting molecule HLA-DR and costimulatory molecules CD54 and CD86 in DCs (FIG. 4). The results show that hLLl could upregulate HLA-DR, CD54, and CD86 in a dose-dependent manner within the range of hLLl concentrations at 0.05-5ug/ml (FIG. 4A).
  • naive CD4+ T cells toward ThI effector cells by hLLl -treated DCs
  • DCs have another important function: the polarization of na ⁇ ve CD4 T cells to differentiate into different effector cells, ThI, Th2, ThI 7, as well as newly defined ThI 7-1 cells.
  • ThI cells are critical for cellular immunity against intracellular pathogens and cancers, whereas induction of Th2 cells is responsible for humoral immunity.
  • the IL-17-producing Th 17 and Th 17-1 cells are other polarized cell populations which have multiple functions in immunity to certain pathogens and autoimmune inflammation.
  • the polarization of these effector cells is largely mediated through DC-secreted cytokines, the so-called "signal 3", that DCs provide to T cells in the DC/T cell synapse.
  • the CD4+ na ⁇ ve T cells can differentiate into ThI, Th2 and ThO cells which mediate different effector functions, among which the ThI effector cells play an essential role in maintaining CTL response against cancer and infectious diseases.
  • ThI, Th2 and ThO cells which mediate different effector functions, among which the ThI effector cells play an essential role in maintaining CTL response against cancer and infectious diseases.
  • hLLl at 0.05 to 50 ⁇ g/ml could enhance DC constitutive maturation in a weak but dose-dependent manner, but DCs treated with these concentrations of hLLl didn't influence the DC-mediated T cell expansion (FIG. 5).
  • hLLl -treated DCs could influence the polarization of CD4+ na ⁇ ve T cells.
  • hLLl -treated DCs polarized the CD4+ na ⁇ ve T cells to differentiate toward more ThI effector cells and fewer Th2 and Tnp cells.
  • Example 9 In vitro properties of 74-mCD20 - Induction of hCD20-specific immunity by 74-mCD20 in human PBMCs
  • CD20 is a self antigen normally expressed on B cells, which is theoretically difficult to target by vaccine strategies due to immune tolerance.
  • specific T-cell immune response to CD20 has been achieved in tumor bearing mice by vaccination with a minigene encoding the extracellular domain of human CD20 (Palomba et al., Clin Cancer Res 2005; 11 :370-9), or a conjugate comprising the extracellular domain of human CD20 and a carrier protein with QS21 adjuvant (Roberts et al., Blood 2002; 99:3748-55).
  • Human DCs are generated from PBMCs by culturing for 5 days in the presence of hGM-CSF and hIL-4.
  • the immature DCs are loaded with 74-mCD20, and matured by LPS plus IFN-gamma.
  • the mature DCs are used to stimulate autologous PBMCs for 10 days. Restimulation with the same loaded DCs is performed twice weekly.
  • the T cells are tested for their antigen specificity by measuring cytokine response (IFN-gamma) upon stimulation by sorted CD20-positive MM cancer stem cells.
  • the CD20-negative MM cells are used as a control.
  • the T cells show a positive reaction to CD20-positive MM cancer stem cells but not to control CD20-negative MM cells.
  • 74-mCD20 or Ml-mCD20 are labeled with a ZENONTM ALEXA FLUOR® 488 human IgG labeling kit (INVITROGEN®) following the manufacturer's instructions.
  • the labeled preparations are used to stain the human PBMCs as described below..
  • Human PBMCs isolated from buffy coat using FICOLL-P AQUETM are treated with human FcR blocking Reagent (Miltenyi Biotec, 1 :20 dilution) at 4°C for 10 min. The washed cells are stained with specifically labeled mAbs and analyzed by flow cytometry (FACSCALIBUR®).
  • the labeled mAbs used for the study include FITC-labeled anti-CD74 mAb ALEXA FLUOR® 488-labeled 74-mCD20; ALEXA FLUOR® 488-labeled Ml- mCD20; PE-conjugated anti-CD19 mAb (for B cells); PE-conjugated anti- CD14 mAb (for monocytes); and APC-conjugated mAb to BDCA-I (for MDCl), BDCA-2 (for PDC), or BDCA-3 (for MDC2).
  • a gating strategy is used for identification of B cells, monocytes, MDCl , MDC2, and PDC.
  • 74-mCD20 is internalized to endosomes for further processing to MHC class II presentation and MHC class I cross-presentation, the following experiment is performed. 74-mCD20 or Ml-mCD20 is mixed with human PBMCs, and incubated at 4°C for lhr, followed by extensive washing. The cells are then transferred to 37°C, fixed at different time points (0, 15, 30, or 45 min) and stained with ALEXA FLUOR®-labeled anti-human IgG secondary antibody with or without prior permeabilization.
  • the mean fluorescence is determined by flow cytometry, and the amount of internalized antibody is calculated by subtracting the mean fluorescence in fixed cells (surface bound) from that recorded with fixed and permeabilized cells (internalized and surface bound) at various time points. [0182] The results show that the 74-mCD20 DNL complex has the same efficiency and specificity in binding with APCs as hLLl alone.
  • the specific cytotoxicity against MM cancer stem cells is assessed by a calcein AM release assay with MM cancer stem cells as the target cells.
  • the CD20+ MM cancer stem cells are isolated from the MM cell line RPMIl 8226 using magnetic beads.
  • the stem cell property is verified by staining with aldehyde dehydrogenase. The results indicate that 74-mCD20 is capable of inducing an anti-hcd20 specific immune response in vivo.
  • Example 11 Therapeutic Potential of 74-mCD20 against MM Cancer stem cells: In Vivo Evaluation by hPBMC/NOD/SCID Mouse Model or Adoptive Transfer.
  • the best way for in vivo evaluation of the therapeutic effect of 74-mCD20 is to immunize an animal model that can support both the growth of MM and the development of a human adaptive immune system. Since human CD34+ cell-reconstituted Rag2-/- ⁇ c-/- mice are immune-competent, which may not support MM growth, the hPBMC/NOD/SCID mouse model is used to test the therapeutic effect of 74-mCD20against MM stem cells. The NOD/SCID mice have been used for engraftment of clonogenic multiple myeloma stem cells by Matsui et al. (Blood 2004, 103:2332-6; Cancer Res 2008, 68:190-7).
  • NOD/SCID mice are also used for evaluating the therapeutic effect by co- engraftment of tumor cells and hPBMC. By carefully adjusting the cell numbers infused, this model can support both tumor growth and hPBMC engraftment, and has been used for testing the effect of an in vivo vaccine targeting DC-SIGN.
  • mice Four to six-week-old female NOD/SCID mice (Jackson Laboratories, Barr Harbor, Maine) are irradiated with 300 cGy (84 cGy/min using a 137Cs gamma irradiator). 12-16 h later, sorted CD20+ MM cancer stem cells (2 million) are injected via dorsal tail vein. Meanwhile, a mixture of human PBMCs (3 million), immature DC (30,000) and the DNL vaccine is injected into the mice subcutaneously. At certain time points (days), mice are euthanatized and bone marrow is harvested from the long bones and the engraftment and therapeutic efficacy are determined by staining for human CD138 + MM cells.
  • mice are immunized with 74- mCD20 as described above.
  • the splenocytes are harvested and injected via the tail vein into NOD/SCID mice engrafted with CD20+ MM cancer stem cells.
  • mice are euthanatized and bone marrow is harvested from the long bones and the engraftment and therapeutic efficacy are determined by staining for human CD 138+ MM cells.
  • the results confirm that 74-mCD20 is capable of inducing an immune response against CD20 + MM stem cells in vivo.
  • a DDD2 conjugated PAP xenoantigen is generated from murine prostatic acid phosphatase according to the method of Example 4.
  • the efficacy of dendritic cell based vaccination with a PAP xenoantigen has been previously disclosed (Fong et al. J Immunol 2001, 167:7150-56).
  • a DDD2-mPAP-pdHL2 expression vector is constructed as described in Example 4 and the DDD2-mPAP xenoantigen fusion protein is expressed in cell culture according to Example 4.
  • the murine prostatic acid phosphatase sequence is disclosed, for example, in the NCBI database at Accession No. AAF23171.
  • a DDD2-mPAP-6His fusion protein is expressed and purified by immobilized metal affinity chromatography (IMAC) as described in Example 4.
  • IMAC immobilized metal affinity chromatography
  • a DNL construct comprising one copy of C H3 -AD2-IgG-hLLl (anti-CD74) and four copies of DDD2-mPAP is prepared according to the methods of Example 5.
  • the hLLl IgG moiety comprises an AD2 sequence attached to the C-terminal end of each heavy chain of the hLLl IgG.
  • a DNL reaction is performed by mixing hLLl IgG- AD2 and DDD2-mPAP in PBS containing 1 niM reduced glutathione. On the next day oxidized glutathione is added to a final concentration of 2 mM and the reaction mixture is purified on a Protein A column 24 h later.
  • Two copies of the DDD2-mPAP are attached to each AD2 moiety, resulting in a DNL complex comprising one hLLl IgG moiety and four mPAP xenoantigen moieties.
  • a DDD2 conjugated EGFR xenoantigen is generated from murine EGFR according to the method of Example 4.
  • the efficacy of EGFR xenoantigen at inducing a humoral immune response has been previously disclosed (Fang et al. Int J MoI Med 2009, 23:181-88).
  • a DDD2-mEGFR-pdHL2 expression vector comprising the extracellular domain of murine EGFR is constructed as described in Example 4 and the DDD2-mEGFR xenoantigen fusion protein is expressed in cell culture according to Example 4.
  • the murine EGFR sequence is disclosed, for example, in the NCBI database at Accession No. AAG43241.
  • a DDD2- mEGFR-6His fusion protein is expressed and purified by immobilized metal affinity chromatography (IMAC) as described in Example 4.
  • a DNL construct comprising one copy of C ⁇ 3 -AD2-IgG-hLLl (anti-CD74) and four copies of DDD2-mEGFR is prepared according to the methods of Example 5.
  • the hLLl IgG moiety comprises an AD2 sequence attached to the C-terminal end of each heavy chain of the hLLl IgG.
  • a DNL reaction is performed by mixing hLLl IgG- AD2 and DDD2-mEGFR in PBS containing 1 mM reduced glutathione. On the next day oxidized glutathione is added to a final concentration of 2 mM and the reaction mixture is purified on a Protein A column 24 h later.
  • Two copies of the DDD2-mEGFR are attached to each AD2 moiety, resulting in a DNL complex comprising one hLLl IgG moiety and four mEGFR xenoantigen moieties.
  • the immune response is effective to reduce or eliminate EGFR positive cancer cells in the subjects.
  • DNL-based vaccines incorporating xenoantigen moieties corresponding to a wide variety of tumor-associated antigens may be constructed and utilized according to the techniques described herein.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Immunology (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Veterinary Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Epidemiology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Oncology (AREA)
  • Mycology (AREA)
  • Microbiology (AREA)
  • Cell Biology (AREA)
  • Organic Chemistry (AREA)
  • Molecular Biology (AREA)
  • Genetics & Genomics (AREA)
  • Engineering & Computer Science (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Developmental Biology & Embryology (AREA)
  • Nanotechnology (AREA)
  • General Engineering & Computer Science (AREA)
  • General Chemical & Material Sciences (AREA)
  • Reproductive Health (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Vascular Medicine (AREA)
  • Gynecology & Obstetrics (AREA)
  • Pregnancy & Childbirth (AREA)
  • Wood Science & Technology (AREA)
  • Zoology (AREA)
  • Crystallography & Structural Chemistry (AREA)
  • Medical Informatics (AREA)
  • Biotechnology (AREA)
  • Dermatology (AREA)
  • Hematology (AREA)
PCT/US2009/054441 2008-08-20 2009-08-20 Dock-and-lock (dnl) vaccines for cancer therapy Ceased WO2010022225A1 (en)

Priority Applications (5)

Application Number Priority Date Filing Date Title
CN200980141590.7A CN102186499B (zh) 2008-08-20 2009-08-20 用于癌症治疗的对接和锁定(dnl)疫苗
EP09808814A EP2326346A4 (en) 2008-08-20 2009-08-20 DOCK-AND-LOCK (DNL) VACCINES FOR CANCER THERAPY
CA2734265A CA2734265C (en) 2008-08-20 2009-08-20 Dock-and-lock (dnl) vaccines for cancer therapy
AU2009282830A AU2009282830B2 (en) 2008-08-20 2009-08-20 Dock-and-lock (DNL) vaccines for cancer therapy
JP2011523987A JP5870404B2 (ja) 2008-08-20 2009-08-20 癌治療のためのドック・ロック(dnl)ワクチン

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US9048708P 2008-08-20 2008-08-20
US61/090,487 2008-08-20

Publications (2)

Publication Number Publication Date
WO2010022225A1 true WO2010022225A1 (en) 2010-02-25
WO2010022225A9 WO2010022225A9 (en) 2011-04-28

Family

ID=41707458

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2009/054441 Ceased WO2010022225A1 (en) 2008-08-20 2009-08-20 Dock-and-lock (dnl) vaccines for cancer therapy

Country Status (7)

Country Link
US (3) US7901680B2 (https=)
EP (1) EP2326346A4 (https=)
JP (1) JP5870404B2 (https=)
CN (1) CN102186499B (https=)
AU (1) AU2009282830B2 (https=)
CA (1) CA2734265C (https=)
WO (1) WO2010022225A1 (https=)

Cited By (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP2416807A4 (en) * 2009-04-10 2012-06-13 Immunomedics Inc NEW STRATEGIES FOR IMPROVED CANCER VACCINES
WO2013163689A1 (en) * 2012-05-01 2013-11-07 The University Of Sydney Vaccine and uses thereof
WO2013104804A3 (en) * 2012-01-13 2013-11-21 Julius-Maximilians-Universität Würzburg Dual antigen-induced bipartite functional complementation
WO2013181087A3 (en) * 2012-06-01 2014-02-06 Ibc Pharmaceuticals, Inc. Multimeric complexes with improved in vivo stability, pharmacokinetics and efficacy
WO2014037519A3 (en) * 2012-09-07 2014-05-30 Duetsches Rheuma-Forschungszentrum Berlin (Drfz) Compositions and methods
EP4590721A4 (en) * 2022-09-23 2026-03-25 Frontaim Biomedicines Inc MOLECULAR GRAFTED IMMUNOGLOBULIN HAVING MULTIPLE FUNCTIONS OR BOND SPECIFICITIES

Families Citing this family (62)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US8383081B2 (en) 1999-05-10 2013-02-26 Immunomedics, Inc. Anti-CD74 immunoconjugates and methods of use
US7534866B2 (en) 2005-10-19 2009-05-19 Ibc Pharmaceuticals, Inc. Methods and compositions for generating bioactive assemblies of increased complexity and uses
US7527787B2 (en) * 2005-10-19 2009-05-05 Ibc Pharmaceuticals, Inc. Multivalent immunoglobulin-based bioactive assemblies
US7550143B2 (en) 2005-04-06 2009-06-23 Ibc Pharmaceuticals, Inc. Methods for generating stably linked complexes composed of homodimers, homotetramers or dimers of dimers and uses
US7312318B2 (en) * 2002-03-01 2007-12-25 Immunomedics, Inc. Internalizing anti-CD74 antibodies and methods of use
US7666400B2 (en) 2005-04-06 2010-02-23 Ibc Pharmaceuticals, Inc. PEGylation by the dock and lock (DNL) technique
US20160279239A1 (en) 2011-05-02 2016-09-29 Immunomedics, Inc. Subcutaneous administration of anti-cd74 antibody for systemic lupus erythematosus and autoimmune disease
US8658773B2 (en) 2011-05-02 2014-02-25 Immunomedics, Inc. Ultrafiltration concentration of allotype selected antibodies for small-volume administration
US7906118B2 (en) 2005-04-06 2011-03-15 Ibc Pharmaceuticals, Inc. Modular method to prepare tetrameric cytokines with improved pharmacokinetics by the dock-and-lock (DNL) technology
US20110020273A1 (en) * 2005-04-06 2011-01-27 Ibc Pharmaceuticals, Inc. Bispecific Immunocytokine Dock-and-Lock (DNL) Complexes and Therapeutic Use Thereof
US8435539B2 (en) * 2004-02-13 2013-05-07 Immunomedics, Inc. Delivery system for cytotoxic drugs by bispecific antibody pretargeting
US8034352B2 (en) * 2005-04-06 2011-10-11 Ibc Pharmaceuticals, Inc. Tetrameric cytokines with improved biological activity
US8003111B2 (en) * 2005-04-06 2011-08-23 Ibc Pharmaceuticals, Inc. Dimeric alpha interferon pegylated site-specifically shows enhanced and prolonged efficacy in vivo
US8491914B2 (en) 2004-02-13 2013-07-23 Ibc Pharmaceuticals, Inc. Dock-and-lock (DNL) complexes for delivery of interference RNA
US9550838B2 (en) 2004-02-13 2017-01-24 Ibc Pharmaceuticals, Inc. Dock-and-lock (DNL) complexes for therapeutic and diagnostic use
US8883160B2 (en) * 2004-02-13 2014-11-11 Ibc Pharmaceuticals, Inc. Dock-and-lock (DNL) complexes for therapeutic and diagnostic use
US8652484B2 (en) 2004-02-13 2014-02-18 Immunomedics, Inc. Delivery system for cytotoxic drugs by bispecific antibody pretargeting
US20160355591A1 (en) 2011-05-02 2016-12-08 Immunomedics, Inc. Subcutaneous anti-hla-dr monoclonal antibody for treatment of hematologic malignancies
US8067006B2 (en) 2005-04-06 2011-11-29 Immunomedics, Inc. Polymeric carriers of therapeutic agents and recognition moieties for antibody-based targeting of disease sites
US8158129B2 (en) * 2005-04-06 2012-04-17 Ibc Pharmaceuticals, Inc. Dimeric alpha interferon PEGylated site-specifically shows enhanced and prolonged efficacy in vivo
US8475794B2 (en) 2005-04-06 2013-07-02 Ibc Pharmaceuticals, Inc. Combination therapy with anti-CD74 antibodies provides enhanced toxicity to malignancies, Autoimmune disease and other diseases
US8349332B2 (en) 2005-04-06 2013-01-08 Ibc Pharmaceuticals, Inc. Multiple signaling pathways induced by hexavalent, monospecific and bispecific antibodies for enhanced toxicity to B-cell lymphomas and other diseases
US9931413B2 (en) 2005-04-06 2018-04-03 Ibc Pharmaceuticals, Inc. Tetrameric cytokines with improved biological activity
CA2604032C (en) 2005-04-06 2017-08-22 Ibc Pharmaceuticals, Inc. Methods for generating stably linked complexes composed of homodimers, homotetramers or dimers of dimers and uses
US9623115B2 (en) 2005-04-06 2017-04-18 Ibc Pharmaceuticals, Inc. Dock-and-Lock (DNL) Complexes for Disease Therapy
US8481041B2 (en) 2005-04-06 2013-07-09 Ibc Pharmaceuticals, Inc. Dock-and-lock (DNL) constructs for human immunodeficiency virus (HIV) therapy
US20100226884A1 (en) 2009-01-20 2010-09-09 Immunomedics, Inc. Novel Class of Monospecific and Bispecific Humanized Antibodies that Target the Insulin-like Growth Factor Type I Receptor (IGF-1R)
US9862770B2 (en) 2005-10-19 2018-01-09 Ibc Pharmaceuticals, Inc. Multivalent antibody complexes targeting IGF-1R show potent toxicity against solid tumors
WO2012024223A2 (en) * 2010-08-17 2012-02-23 Immunomedics, Inc. Combination therapy with anti-cd74 antibodies provides enhanced toxicity to malignancies, autoimmune disease and other diseases
US9272029B2 (en) 2009-03-26 2016-03-01 Ibc Pharmaceuticals, Inc. Interferon lambada-antibody complexes
CN102186499B (zh) * 2008-08-20 2015-05-20 Ibc医药公司 用于癌症治疗的对接和锁定(dnl)疫苗
US10865233B2 (en) 2008-12-18 2020-12-15 Dana-Farber Cancer Institute, Inc. NKG2D-fc for immunotherapy
WO2011066454A1 (en) * 2009-11-24 2011-06-03 Inviragen, Inc. Compositions, methods and uses for expression of enterobacterium-associated peptides
CA2794499A1 (en) * 2010-04-01 2011-10-06 Immumomedics, Inc. Antibody-based depletion of antigen-presenting cells and dendritic cells
CA2812442A1 (en) * 2010-11-03 2012-05-10 Ibc Pharmaceuticals, Inc. Dock-and-lock (dnl) constructs for human immunodeficiency virus (hiv) therapy
US9884909B2 (en) 2010-12-01 2018-02-06 Alderbio Holdings Llc Anti-NGF compositions and use thereof
US9539324B2 (en) 2010-12-01 2017-01-10 Alderbio Holdings, Llc Methods of preventing inflammation and treating pain using anti-NGF compositions
US11214610B2 (en) 2010-12-01 2022-01-04 H. Lundbeck A/S High-purity production of multi-subunit proteins such as antibodies in transformed microbes such as Pichia pastoris
US9078878B2 (en) 2010-12-01 2015-07-14 Alderbio Holdings Llc Anti-NGF antibodies that selectively inhibit the association of NGF with TrkA, without affecting the association of NGF with p75
EP2646468B1 (en) 2010-12-01 2018-07-25 AlderBio Holdings LLC Anti-ngf compositions and use thereof
US9067988B2 (en) 2010-12-01 2015-06-30 Alderbio Holdings Llc Methods of preventing or treating pain using anti-NGF antibodies
WO2013112801A1 (en) * 2012-01-26 2013-08-01 Ibc Pharmaceuticals, Inc. Targeting interferon-lambda with antibodies potently enhances anti-tumor and anti-viral activities
US9682143B2 (en) 2012-08-14 2017-06-20 Ibc Pharmaceuticals, Inc. Combination therapy for inducing immune response to disease
CN104379169A (zh) 2012-08-14 2015-02-25 Ibc药品公司 用于治疗疾病的t-细胞重定向双特异性抗体
US20150231241A1 (en) 2012-08-14 2015-08-20 Ibc Pharmaceuticals, Inc. Combination therapy for inducing immune response to disease
US10131712B2 (en) 2012-08-14 2018-11-20 Ibc Pharmaceuticals, Inc. Combination therapy with T-cell redirecting bispecific antibodies and checkpoint inhibitors
US9382329B2 (en) 2012-08-14 2016-07-05 Ibc Pharmaceuticals, Inc. Disease therapy by inducing immune response to Trop-2 expressing cells
CN107753954A (zh) 2012-12-13 2018-03-06 免疫医疗公司 功效改进且毒性降低的抗体与sn‑38的免疫缀合物的剂量
CN103131710B (zh) * 2013-03-05 2014-12-17 西藏自治区人民医院 一种抑制肿瘤细胞侵袭的shRNA
US9416197B2 (en) 2013-11-01 2016-08-16 Ibc Pharmaceuticals, Inc. Bispecific antibodies that neutralize both TNF-α and IL-6: novel therapeutic agent for autoimmune disease
CN103739714B (zh) * 2013-12-30 2016-06-01 江苏众红生物工程创药研究院有限公司 TNFα与DC-SIGN的融合蛋白及其应用
JP6447933B2 (ja) 2014-02-21 2019-01-09 アイビーシー ファーマスーティカルズ,インコーポレイテッド Trop−2発現細胞に対する免疫応答を誘発することによる疾患治療
US20160060707A1 (en) * 2014-08-29 2016-03-03 Immunomedics, Inc. Identification of Cancer Genes by In-Vivo Fusion of Human Cancer Cells and Animal Cells
EP3262070A4 (en) 2015-02-24 2018-07-25 Rpeptide, LLC Anti-amyloid-beta antibodies
US9687547B2 (en) 2015-05-28 2017-06-27 Immunomedics, Inc. T20 constructs for anti-HIV (human immunodeficiency virus) therapy and/or vaccines
JP6980980B2 (ja) 2015-06-25 2021-12-15 イミューノメディクス、インコーポレイテッドImmunomedics, Inc. 抗hla‐drまたは抗trop‐2抗体と微小管阻害剤、parp阻害剤、ブルトンキナーゼ阻害剤またはホスホイノシチド3‐キナーゼ阻害剤との併用は癌の治療効果を有意に改善する
EP3373970A4 (en) 2015-11-13 2019-07-10 Dana Farber Cancer Institute, Inc. NKG2D IG FUSION PROTEIN FOR CANCER IMMUNOTHERAPY
US10669338B2 (en) 2016-06-17 2020-06-02 Immunomedics, Inc. Anti-PD-1 checkpoint inhibitor antibodies that block binding of PD-L1 to PD-1
US10799597B2 (en) 2017-04-03 2020-10-13 Immunomedics, Inc. Subcutaneous administration of antibody-drug conjugates for cancer therapy
CN108379567A (zh) * 2018-02-28 2018-08-10 宁夏医科大学 抗黑色素瘤纳米颗粒疫苗及其制备与应用
WO2020172233A1 (en) * 2019-02-22 2020-08-27 The Trustees Of Columbia University In The City Of New York Treatment of prostate cancer by androgen ablation and il-8 blockade
WO2023056240A2 (en) 2021-09-28 2023-04-06 Frontaim Biomedicines, Inc. Multiple formats of molecular complexes

Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20030228300A1 (en) * 2002-02-22 2003-12-11 Haspel Martin V. Sterile immunogenic non-tumorigenic tumor cell compositions and methods
US20060228300A1 (en) * 2005-04-06 2006-10-12 Ibc Pharmaceuticals, Inc. Stably tethered structures of defined compositions with multiple functions or binding specificities
US20080187515A1 (en) * 1994-07-06 2008-08-07 Immunomedics, Inc. Use of Immunoconjugates to Enhance the Efficacy of Multi-Stage Cascade Boosting Vaccines

Family Cites Families (71)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
GB1541435A (en) * 1975-02-04 1979-02-28 Searle & Co Immunological materials
US4818709A (en) * 1983-01-21 1989-04-04 Primus Frederick J CEA-family antigens, Anti-CEA antibodies and CEA immunoassay
US5614610A (en) * 1984-12-21 1997-03-25 Oncogen Tumor immunotherapy using anti-idiotypic antibodies
US5851526A (en) 1985-04-19 1998-12-22 Ludwig Institute For Cancer Research Methods of treating colon cancer utilizing tumor-specific antibodies
NL8501219A (nl) * 1985-04-29 1986-11-17 Stichting Vrienden Van De Stic Immunologisch complex, de bereiding en toepassing daarvan.
US4699784A (en) * 1986-02-25 1987-10-13 Center For Molecular Medicine & Immunology Tumoricidal methotrexate-antibody conjugate
US5194254A (en) * 1986-05-06 1993-03-16 Connaught Laboratories Limited Enhancement of antigen immunogenicity
DK8189A (da) 1988-01-12 1989-07-13 Bunge Australia Antigen-antistof-konjugater, deres fremstilling og anvendelse
IL86278A (en) 1988-05-04 2003-06-24 Yeda Res & Dev Endowing cells with antibody specificity using chimeric t cell receptor
US5770198A (en) * 1988-05-18 1998-06-23 The Research Foundation Of The State Of New York Platelet-specific chimeric 7E3 immunoglobulin
US5530101A (en) * 1988-12-28 1996-06-25 Protein Design Labs, Inc. Humanized immunoglobulins
AU648261B2 (en) * 1989-08-18 1994-04-21 Novartis Vaccines And Diagnostics, Inc. Recombinant retroviruses delivering vector constructs to target cells
EP0438803B1 (en) 1990-01-26 1997-03-12 Immunomedics, Inc. Vaccines against cancer and infectious diseases
IE920716A1 (en) 1991-03-07 1992-09-09 Gen Hospital Corp Redirection of cellular immunity by receptor chimeras
US5932448A (en) 1991-11-29 1999-08-03 Protein Design Labs., Inc. Bispecific antibody heterodimers
CA2139743A1 (en) 1992-08-31 1994-03-17 Lynn E. Spitler Stimulation of an antitumor t-cell response using anti-idiotypic antibodies
US5478556A (en) * 1994-02-28 1995-12-26 Elliott; Robert L. Vaccination of cancer patients using tumor-associated antigens mixed with interleukin-2 and granulocyte-macrophage colony stimulating factor
US5571515A (en) * 1994-04-18 1996-11-05 The Wistar Institute Of Anatomy & Biology Compositions and methods for use of IL-12 as an adjuvant
US5798100A (en) * 1994-07-06 1998-08-25 Immunomedics, Inc. Multi-stage cascade boosting vaccine
US5686578A (en) 1994-08-05 1997-11-11 Immunomedics, Inc. Polyspecific immunoconjugates and antibody composites for targeting the multidrug resistant phenotype
US5874540A (en) * 1994-10-05 1999-02-23 Immunomedics, Inc. CDR-grafted type III anti-CEA humanized mouse monoclonal antibodies
US20040018587A1 (en) * 1994-10-13 2004-01-29 Lee Makowski Nanostructures containing antibody assembly units
US20030198956A1 (en) * 2002-02-21 2003-10-23 Lee Makowski Staged assembly of nanostructures
US5871945A (en) 1994-11-23 1999-02-16 Icos Corporation Modulators of anchoring protein function
WO1996040941A1 (en) 1995-06-07 1996-12-19 Connaught Laboratories Limited Chimeric antibodies for delivery of antigens to selected cells of the immune system
US6261537B1 (en) * 1996-10-28 2001-07-17 Nycomed Imaging As Diagnostic/therapeutic agents having microbubbles coupled to one or more vectors
US8021666B2 (en) * 1997-02-18 2011-09-20 Sloan-Kettering Institute For Cancer Research Method and compositions for stimulation of an immune response to CD20 using a xenogeneic CD20 antigen
US6306393B1 (en) * 1997-03-24 2001-10-23 Immunomedics, Inc. Immunotherapy of B-cell malignancies using anti-CD22 antibodies
CA2286477A1 (en) * 1997-04-11 1998-10-22 Dendreon Corporation Composition and method for inducing an immune response against tumour-related antigens
US7527787B2 (en) 2005-10-19 2009-05-05 Ibc Pharmaceuticals, Inc. Multivalent immunoglobulin-based bioactive assemblies
US6756039B1 (en) 1999-05-10 2004-06-29 The Regents Of The University Of California Self assembling proteins
US7534866B2 (en) 2005-10-19 2009-05-19 Ibc Pharmaceuticals, Inc. Methods and compositions for generating bioactive assemblies of increased complexity and uses
US7312318B2 (en) * 2002-03-01 2007-12-25 Immunomedics, Inc. Internalizing anti-CD74 antibodies and methods of use
US7666400B2 (en) 2005-04-06 2010-02-23 Ibc Pharmaceuticals, Inc. PEGylation by the dock and lock (DNL) technique
US7550143B2 (en) 2005-04-06 2009-06-23 Ibc Pharmaceuticals, Inc. Methods for generating stably linked complexes composed of homodimers, homotetramers or dimers of dimers and uses
MXPA02001417A (es) * 1999-08-09 2002-08-12 Lexigen Pharm Corp Complejos multiples de citosina-anticuerpo.
US7030228B1 (en) * 1999-11-15 2006-04-18 Miltenyi Biotec Gmbh Antigen-binding fragments specific for dendritic cells, compositions and methods of use thereof antigens recognized thereby and cells obtained thereby
US7060506B2 (en) * 2000-01-31 2006-06-13 Cyclacel, Ltd. Compositions and methods for monitoring the modification of modification dependent binding partner polypeptides
KR100881471B1 (ko) * 2000-05-08 2009-02-05 셀덱스 쎄라퓨틱스, 인크. 수상세포에 대한 인간 모노클로날 항체
US7560534B2 (en) 2000-05-08 2009-07-14 Celldex Research Corporation Molecular conjugates comprising human monoclonal antibodies to dendritic cells
US6524854B1 (en) * 2001-09-11 2003-02-25 Isis Pharmaceuticals, Inc. Antisense inhibition of PKA regulatory subunit RII alpha expression
WO2003068821A2 (en) * 2002-02-14 2003-08-21 Immunomedics, Inc. Anti-cd20 antibodies and fusion proteins thereof and methods of use
US7591994B2 (en) * 2002-12-13 2009-09-22 Immunomedics, Inc. Camptothecin-binding moiety conjugates
WO2003093296A2 (en) * 2002-05-03 2003-11-13 Sequenom, Inc. Kinase anchor protein muteins, peptides thereof, and related methods
WO2003103706A2 (en) * 2002-06-11 2003-12-18 Glaxosmithkline Biologicals S.A. Immunogenic compositions
US7906118B2 (en) 2005-04-06 2011-03-15 Ibc Pharmaceuticals, Inc. Modular method to prepare tetrameric cytokines with improved pharmacokinetics by the dock-and-lock (DNL) technology
US7541440B2 (en) * 2002-09-30 2009-06-02 Immunomedics, Inc. Chimeric, human and humanized anti-granulocyte antibodies and methods of use
WO2004094613A2 (en) * 2003-04-22 2004-11-04 Ibc Pharmaceuticals Polyvalent protein complex
US8562988B2 (en) * 2005-10-19 2013-10-22 Ibc Pharmaceuticals, Inc. Strategies for improved cancer vaccines
US8491914B2 (en) 2004-02-13 2013-07-23 Ibc Pharmaceuticals, Inc. Dock-and-lock (DNL) complexes for delivery of interference RNA
US8034352B2 (en) * 2005-04-06 2011-10-11 Ibc Pharmaceuticals, Inc. Tetrameric cytokines with improved biological activity
US8003111B2 (en) 2005-04-06 2011-08-23 Ibc Pharmaceuticals, Inc. Dimeric alpha interferon pegylated site-specifically shows enhanced and prolonged efficacy in vivo
US8883160B2 (en) 2004-02-13 2014-11-11 Ibc Pharmaceuticals, Inc. Dock-and-lock (DNL) complexes for therapeutic and diagnostic use
US20110064754A1 (en) 2005-03-03 2011-03-17 Center For Molecular Medicine And Immunology Immunoconjugates Comprising Poxvirus-Derived Peptides and Antibodies Against Antigen-Presenting Cells for Subunit-Based Poxvirus Vaccines
US20110020273A1 (en) 2005-04-06 2011-01-27 Ibc Pharmaceuticals, Inc. Bispecific Immunocytokine Dock-and-Lock (DNL) Complexes and Therapeutic Use Thereof
US8551480B2 (en) 2004-02-13 2013-10-08 Immunomedics, Inc. Compositions and methods of use of immunotoxins comprising ranpirnase (Rap) show potent cytotoxic activity
US7608425B2 (en) * 2004-07-23 2009-10-27 Immunomedics, Inc. Methods for protein expression in mammalian cells in serum-free medium
ES2665422T3 (es) * 2005-03-03 2018-04-25 Immunomedics Inc. Anticuerpos L243 humanizados
AU2006232310B9 (en) * 2005-04-06 2011-07-21 Ibc Pharmaceuticals, Inc. Improved stably tethered structures of defined compositions with multiple functions or binding specificities
US8475794B2 (en) 2005-04-06 2013-07-02 Ibc Pharmaceuticals, Inc. Combination therapy with anti-CD74 antibodies provides enhanced toxicity to malignancies, Autoimmune disease and other diseases
US8349332B2 (en) 2005-04-06 2013-01-08 Ibc Pharmaceuticals, Inc. Multiple signaling pathways induced by hexavalent, monospecific and bispecific antibodies for enhanced toxicity to B-cell lymphomas and other diseases
US20120276100A1 (en) 2005-04-06 2012-11-01 Ibc Pharmaceuticals, Inc. Compositions and Methods of Use of Immunotoxins Comprising Ranpirnase (Rap) Show Potent Cytotoxic Activity
US8158129B2 (en) 2005-04-06 2012-04-17 Ibc Pharmaceuticals, Inc. Dimeric alpha interferon PEGylated site-specifically shows enhanced and prolonged efficacy in vivo
US9623115B2 (en) 2005-04-06 2017-04-18 Ibc Pharmaceuticals, Inc. Dock-and-Lock (DNL) Complexes for Disease Therapy
US8481041B2 (en) 2005-04-06 2013-07-09 Ibc Pharmaceuticals, Inc. Dock-and-lock (DNL) constructs for human immunodeficiency virus (HIV) therapy
CA2607056C (en) * 2005-10-19 2015-11-24 Ibc Pharmaceuticals, Inc. Methods and compositions for generating bioactive assemblies of increased complexity and uses
SG153825A1 (en) 2005-12-16 2009-07-29 Ibc Pharmaceuticals Inc Multivalent immunoglobulin-based bioactive assemblies
WO2008033413A2 (en) 2006-09-14 2008-03-20 Human Genome Sciences, Inc. Albumin fusion proteins
WO2008039432A1 (en) * 2006-09-26 2008-04-03 Alexion Pharmaceuticals, Inc. Compositions and methods for enhancing an adjuvant
KR20090114430A (ko) * 2007-02-02 2009-11-03 베일러 리서치 인스티튜트 항원-제시 세포 상에서 발현된 dcir에 대한 항원 표적화에 기초한 백신
CN102186499B (zh) 2008-08-20 2015-05-20 Ibc医药公司 用于癌症治疗的对接和锁定(dnl)疫苗

Patent Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20080187515A1 (en) * 1994-07-06 2008-08-07 Immunomedics, Inc. Use of Immunoconjugates to Enhance the Efficacy of Multi-Stage Cascade Boosting Vaccines
US20030228300A1 (en) * 2002-02-22 2003-12-11 Haspel Martin V. Sterile immunogenic non-tumorigenic tumor cell compositions and methods
US20060228300A1 (en) * 2005-04-06 2006-10-12 Ibc Pharmaceuticals, Inc. Stably tethered structures of defined compositions with multiple functions or binding specificities

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
See also references of EP2326346A4 *

Cited By (13)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP2416807A4 (en) * 2009-04-10 2012-06-13 Immunomedics Inc NEW STRATEGIES FOR IMPROVED CANCER VACCINES
EP3333190A1 (en) * 2012-01-13 2018-06-13 Julius-Maximilians-Universität Würzburg Dual antigen-induced bipartite functional complementation
WO2013104804A3 (en) * 2012-01-13 2013-11-21 Julius-Maximilians-Universität Würzburg Dual antigen-induced bipartite functional complementation
US11427644B2 (en) 2012-01-13 2022-08-30 Julius-Maxmillians-Universitat Wurzburg Dual antigen-induced bipartite functional complementation
EP3907241A1 (en) * 2012-01-13 2021-11-10 Julius-Maximilians-Universität Würzburg Dual antigen-induced bipartite functional complementation
EA033947B1 (ru) * 2012-01-13 2019-12-12 Юлиус-Максимилианс-Универзитет Вюрцбург Набор полипептидов для идентификации и/или элиминации клеток, его применение, молекула нуклеиновой кислоты, которая кодирует один из полипептидов набора, набор нуклеиновых кислот, который кодирует набор полипептидов, фармацевтическая композиция, содержащая эти наборы
WO2013163689A1 (en) * 2012-05-01 2013-11-07 The University Of Sydney Vaccine and uses thereof
US20150132302A1 (en) * 2012-05-01 2015-05-14 The University Of Sydney Vaccine and uses thereof
WO2013181087A3 (en) * 2012-06-01 2014-02-06 Ibc Pharmaceuticals, Inc. Multimeric complexes with improved in vivo stability, pharmacokinetics and efficacy
US9446123B2 (en) 2012-06-01 2016-09-20 Ibc Pharmaceuticals, Inc. Multimeric complexes with improved in vivo stability, pharmacokinetics and efficacy
US9862772B2 (en) 2012-09-07 2018-01-09 Beutsches Rheuma-Forschungszentrum Berlin (Drfz) Compositions and methods
WO2014037519A3 (en) * 2012-09-07 2014-05-30 Duetsches Rheuma-Forschungszentrum Berlin (Drfz) Compositions and methods
EP4590721A4 (en) * 2022-09-23 2026-03-25 Frontaim Biomedicines Inc MOLECULAR GRAFTED IMMUNOGLOBULIN HAVING MULTIPLE FUNCTIONS OR BOND SPECIFICITIES

Also Published As

Publication number Publication date
AU2009282830A1 (en) 2010-02-25
CA2734265A1 (en) 2010-02-25
CA2734265C (en) 2017-12-19
AU2009282830B2 (en) 2013-11-28
US9457072B2 (en) 2016-10-04
US20100068137A1 (en) 2010-03-18
CN102186499A (zh) 2011-09-14
US20160361405A1 (en) 2016-12-15
JP2012500286A (ja) 2012-01-05
EP2326346A1 (en) 2011-06-01
CN102186499B (zh) 2015-05-20
US7901680B2 (en) 2011-03-08
EP2326346A4 (en) 2012-06-13
WO2010022225A9 (en) 2011-04-28
US20110189083A1 (en) 2011-08-04
JP5870404B2 (ja) 2016-03-01

Similar Documents

Publication Publication Date Title
US7901680B2 (en) Dock-and-lock (DNL) vaccines for cancer therapy
US8562988B2 (en) Strategies for improved cancer vaccines
US10377829B2 (en) Isolated nucleic acid encoding an anti-IGF-1R antibody
US9446123B2 (en) Multimeric complexes with improved in vivo stability, pharmacokinetics and efficacy
AU2010286642B2 (en) Bispecific immunocytokine dock-and-lock (DNL) complexes and therapeutic use thereof
AU2010343304B2 (en) Novel class of monospecific and bispecific humanized antibodies that target the insulin-like growth factor type I receptor (IGF-1R)
US20110020273A1 (en) Bispecific Immunocytokine Dock-and-Lock (DNL) Complexes and Therapeutic Use Thereof
US20120237442A1 (en) Design and Construction of Novel Multivalent Antibodies
WO2012162583A1 (en) Design and construction of novel multivalent antibodies
WO2011026026A1 (en) Compositions and methods of use of immunotoxins comprising ranpirnase (rap) show potent cytotoxic activity
WO2013082254A1 (en) Multivalent antibody complexes targeting igf-1r show potent toxicity against solid tumors
AU2010286496B2 (en) Compositions and methods of use of immunotoxins comprising ranpirnase (Rap) show potent cytotoxic activity
WO2010117984A1 (en) Novel strategies for improved cancer vaccines

Legal Events

Date Code Title Description
WWE Wipo information: entry into national phase

Ref document number: 200980141590.7

Country of ref document: CN

121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 09808814

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 2009282830

Country of ref document: AU

WWE Wipo information: entry into national phase

Ref document number: 2734265

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2011523987

Country of ref document: JP

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 1219/DELNP/2011

Country of ref document: IN

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2009282830

Country of ref document: AU

Date of ref document: 20090820

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 2009808814

Country of ref document: EP