WO2007101948A2 - Nouveaux vaccins destines au traitement ou a la prevention des infections par parasites de la famille des taenidae et en particulier du genre echinococcus - Google Patents

Nouveaux vaccins destines au traitement ou a la prevention des infections par parasites de la famille des taenidae et en particulier du genre echinococcus Download PDF

Info

Publication number
WO2007101948A2
WO2007101948A2 PCT/FR2007/000417 FR2007000417W WO2007101948A2 WO 2007101948 A2 WO2007101948 A2 WO 2007101948A2 FR 2007000417 W FR2007000417 W FR 2007000417W WO 2007101948 A2 WO2007101948 A2 WO 2007101948A2
Authority
WO
WIPO (PCT)
Prior art keywords
vaccine composition
composition according
protein
fragment
ega31
Prior art date
Application number
PCT/FR2007/000417
Other languages
English (en)
Other versions
WO2007101948A3 (fr
Inventor
Anne-Françoise PETAVY
Georges L. Bosquet
Samia Lahmar
Adriana Esteves
Jose Alejandro Chabalgoity
Duncan Maskel
Hammou Ouhelli
Original Assignee
Universite Claude Bernard Lyon 1
Centre National De La Recherche Scientifique
Ecole Nationale De Medecine Veterinaire
Cambridge Enterprise University Of Cambridge
Universidad De Le Republica
Institut Agronomique Et Veterinaire Hassan Ii
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Universite Claude Bernard Lyon 1, Centre National De La Recherche Scientifique, Ecole Nationale De Medecine Veterinaire, Cambridge Enterprise University Of Cambridge, Universidad De Le Republica, Institut Agronomique Et Veterinaire Hassan Ii filed Critical Universite Claude Bernard Lyon 1
Publication of WO2007101948A2 publication Critical patent/WO2007101948A2/fr
Publication of WO2007101948A3 publication Critical patent/WO2007101948A3/fr

Links

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/43504—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from invertebrates
    • C07K14/43536—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from invertebrates from worms
    • C07K14/4355—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from invertebrates from worms from cestodes
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/0003—Invertebrate antigens
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P33/00—Antiparasitic agents
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K2039/51—Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
    • A61K2039/52—Bacterial cells; Fungal cells; Protozoal cells
    • A61K2039/523—Bacterial cells; Fungal cells; Protozoal cells expressing foreign proteins

Definitions

  • the present invention relates to novel vaccines for the treatment or prevention of parasites infections of the family Taenidae, and in particular Echinococcus (E.) granulosus and therefore hydatidosis.
  • E. Echinococcus
  • Parasites of the family Taenidae, and in particular of the genus Echinococcus belong to the order Cestodes. They have a ten-year evolutionary cycle.
  • the definitive host is a domestic or wild carnivore in which the parasite is localized at the intestinal level, most often in the first parts of the small intestine. It is contaminated by ingestion of protoscolex contained in the larvae.
  • the intermediate host is, according to the parasite in question, an ungulate for Echinococcus granulosus responsible for hydatidosis, a rodent for Echinococcus multilocularis responsible for alveolar echinococcosis.
  • the larva containing protoscolex develops mainly, but not exclusively, in the liver or lung. Contamination is carried out by ingestion of the eggs eliminated at the same time as the feces of carnivores, mainly of the dog in the case of Echinococcus granulosus.
  • humans can also act as intermediate hosts with the same larval locations as ungulates.
  • Hydatidosis is a worldwide zoonotic disease caused by E. granulosus cestode.
  • the larval form of the parasite infects cattle, sheep, camelids, deer, etc., and humans. In endemic areas, prevalence may be very important both in cattle (up QS% of sheep are in some districts in Tunisia and Morocco) and dogs (70% of the animals in the region of Fez , in Morocco).
  • the parasite is the source of considerable economic losses (for example, more than half of the noble offal must be destroyed in Morocco, the affected sheep show signs of wasting and loss of wool production).
  • the parasite is also at the origin of an important human health problem: the prevalence in the man reaches 1, 43/1000 in rural area of the province of Rio Negro, in Argentina, 1, 97/1000 in Xinjiang in China, 2.2 / 1000 in the Turkana district of Kenya, and values of 20% were found locally in villages in the Peruvian Andes. For example, half of liver surgery in Morocco is related to this parasite.
  • a vaccine for sheep has been developed from recombinant proteins expressed by the embryo (Lightowlers MW, 1996, Int.J. Parasitol., 26, pp836-842), but its application is cumbersome because if the efficacy is satisfactory, the duration of protection is short and the number of animals to be treated, so to handle, important (the entire livestock for a breeder).
  • This cDNA encodes a leucine-rich protein of helical putative structure, comprising a proline-rich domain of SH3 type (Sarc Homology 3 type 1) close to the C-terminal region of the protein; these domains are involved especially in protein - protein interactions.
  • SH3 type Sarc Homology 3 type 1
  • 28 phosphorylation sites and 4 putative myristylation sites can be identified using PROSITE software.
  • the sequence of EgA31 has been filed (GenBank) under the number AF 067 807.
  • RD show an immunogenic activity of E granulosus and lead, especially in the dog, a change in the response of the duodenum to the subsequent infection with E granulosus and can therefore be subject to vaccines against infections due to this type of parasites.
  • Tropomyosin is a helical protein present inter alia in the larvae of E granulosus (Esteves A., Parasitai Res., 2003, Apr 89 (6), 501-2).
  • the nucleotide sequence of tropomyosin was deposited in GenBAnk under the number AAB65799. It is a component of intervening muscle cells, in association with actin and myosin in muscle contraction. It is known to induce protective immunity against parasitic nematodes during experimental infestations.
  • tropomyosin can induce effective protection of parasite infections of the family Taenidae.
  • the subject of the present invention is a vaccine composition, characterized in that it comprises at least one microorganism allowing:
  • a first recombinant PR1 protein of from 48 to 435, preferably from 65 to 219 amino acids, which corresponds to an EgA31 fragment or to an analog of an EgA31 fragment, said fragment of EgA31 comprising the sequence SEQ ID No. 3:
  • sequence SEQ ID No. 3 corresponds to amino acids No. 168 to 237 of the sequence deposited under No. AF067807 in GenBank.
  • analogs of one of the abovementioned proteins is meant a protein whose sequence corresponds to the protein of which it is the analogue and whose sequence differs by insertion, substitution or deletion of one or more amino acids and which makes it possible to obtain a protective activity vis-à-vis Taenidae and in particular, parasites of the genus Echinococcus at least equivalent.
  • the analogs of a protein therefore contain at least one epitope of said protein, which is responsible for the immunogenic activity with respect to the parasites of the genus Echinococcus of the fragment of EgA31 or the fragment of tropomyosin, respectively, and therefore remain functionally equivalent. to these.
  • the analogs of a reference protein will preferably have, after alignment, a percentage of homology of at least 80%, preferably at least 95%, preferably from at least 98%, and advantageously 100% with the protein of which they are the analog.
  • the degree of homology can, within the meaning of the invention, be determined locally by the protein sequence comparison techniques, and for example the BLAST P technique as described by ALTSCHUL SF et al. in Nucleic Acid Research 1997, 25, 3389-3402.
  • the optimal alignment that corresponds to the alignment that gives the largest number of identical amino acids after alignment between the two compared amino acid sequences can be obtained, possibly by sliding the sequences relative to each other. other and / or the insertion in one of the compared sequences, of a gap between 2 consecutive amino acids.
  • the PR1 protein has from 48 to 435 and preferably from 65 to 219 amino acids. Also, when this PR1 protein is a fragment of EgA31, comprising SEQ ID No. 3 which comprises 70 amino acids, the PR1 protein is obviously composed of 70 to 435 or, preferably, 70 to 219 amino acids.
  • the PR2 proteins corresponding to an analogue of such a fragment can, for their part, be composed of 48 to 435, preferably 65 to 219 amino acids.
  • the first recombinant protein PR1 is a fragment contained in the portion of EgA31 of sequence SEQ ID No. 5:
  • the first recombinant protein PR1 is a fragment which comprises from 60 to 75 amino acids and which is contained in the sequence SEQ ID No. 6:
  • the first recombinant protein PR1 corresponds to the protein of sequence SEQ ID No. 3:
  • the second protein PR2 has the sequence SEQ ID No. 4:
  • microorganisms used for the expression of the recombinant proteins are advantageously attenuated microorganisms, such as attenuated viruses or attenuated bacteria.
  • the microorganism used allows a release of the expressed proteins at the level of the mucosa of the host to be treated.
  • the attenuated bacterium may be selected from different genera including the genera Salmonella, Bordetella, Vibrio, Haemophilus and Yersinia.
  • the bacterium attenuated can also be an attenuated strain of enterotoxigenic Escherichia coli.
  • S. enterica serovar Typhimurium the agent of salmonellosis in several animal species, one of the food poisoning agents in humans
  • S. cholerae suis an agent of salmonellosis in pigs
  • Bordetella bronchiseptica Haemophilus influenzae and Yersinia - a food poisoning agent.
  • a vaccine targeting the dog it is preferable to have a vaccine targeting the dog and allowing a significant reduction in the number of parasite eggs disseminated in the environment, and thus reduce contamination of livestock and livestock. 'man.
  • the number of dogs to be treated is much lower than that of the cattle and the handling is simpler, since a peros administration by baits is possible.
  • Salmonella specific for dogs preferably Salmonella typhi or Salmonella enterica
  • Salmonella enterica a strain of Salmonella specific for dogs, preferably Salmonella typhi or Salmonella enterica.
  • LVR01 described in Vaccine, 2001, 19, 460-469.
  • Mitigating viruses used as quarantine agents include the vaccine used in rabies vaccines, the Pox virus family, Herpes simplex, and vesicular stomatitis virus.
  • the attenuation of the microorganism is obtained in particular by deletion of the genes from the pathogenicity.
  • the attenuation can be attributed to an irreversible mutation in a gene of the biosynthetic pathway of the aromatic amino acids of the bacterium.
  • genes involved in the synthesis of chorismate a compound located at the crossroads of the aromatic amino acid biosynthetic pathway.
  • aroA (5-enolpyruvateshikimate-3-phosphate synthase)
  • aroC chorismate synthase
  • aroD 3-dihydroquinate dehydratase
  • aroE shikimate
  • an attenuated bacterium contains an irreversible mutation in each of two genes distinct from its biosynthetic pathway aromatic amino acids. Such bacteria are described in EP-A-0 322237. Suitable double aro mutants are aroA aroC, aroA aroD and aroA aroE. Other bacteria with mutations in other combinations of the aroA, aroC, aroD and aroE genes, however, are useful.
  • the double Salmonella aro mutants are particularly preferred, for example the double mutants aro of S. typhi or S. typhimurium or advantageously of S. enterica, in particular the mutants aroA aroC, aroA aroD and aroA aroE.
  • the attenuated bacterium may also contain an irreversible mutation in a gene involved in the regulation of one or more other genes (EP-AO 400 958). Preferably, the mutation occurs in the ompR gene or another gene involved in regulation.
  • This type of attenuated bacterium may contain a second mutation in a second gene.
  • the second gene is a gene coding for an enzyme involved in an essential biosynthetic pathway, in particular genes involved in the pre-chorismate synthesis pathway involved in the biosynthesis of aromatic compounds.
  • the second mutation is therefore preferably in the aroA, aroC or aroD gene.
  • Attenuated bacterium is a bacterium in which the attenuation is due to the presence of an irreversible mutation in one of the genes involved in the response to environmental stress.
  • the irreversible mutation can be a deletion, an insertion, an inversion or a substitution.
  • a deletion mutation can be generated using a transposon.
  • the gene coding for proteins inducing immune responses can be inserted into a plasmid or directly incorporated into the chromosome of the microorganism.
  • An attenuated microorganism, usable in a vaccine according to the present invention can be prepared by transforming the attenuated microorganism with a DNA construct, allowing expression of the desired immunogenic protein. Any suitable transformation technique can be used, such as electroporation. In this way, an attenuated bacterium capable of expressing a protein or heterologous proteins for the bacterium can be obtained. A culture of attenuated bacteria can be grown in aerobic conditions. A sufficient amount of bacteria is thus prepared for formulation as a vaccine with minimal expression of the heterologous protein.
  • a promoter capable of promoting the expression of a DNA sequence and whose activity is inducible in vivo, under anaerobic conditions, and in particular the promoter of the nitrite reductase of E. B. coli, as described by NS Chatfield et al. Biotechnology, vol 10, 888-892, 1992.
  • the NirB promoter has, for example, been described in patent application WO 92/15689.
  • a DNA construct comprising a promoter as defined above, operably linked to a DNA sequence coding for two protein sequences linked by a hinge link, is used: one of the protein sequences will be the first PR1 protein and the other sequence will preferably be an antigenic sequence comprising the fragment C tetanus toxin or epitopes thereof, as described in EP 0652962 to which reference may be made.
  • the DNA construct may therefore be a replicating expression vector comprising the nirB promoter operably linked to a DNA sequence encoding the tetanus toxin fragment C or epitopes thereof and the second heterologous protein, linked by a hinge region.
  • the nirB promoter can be inserted into an expression vector, in which is already incorporated a gene coding for one of the heterologous proteins (for example the tetanus toxin fragment C), in the place of the existing promoter, controlling the expression of the protein.
  • the hinge region and the gene encoding the second heterologous protein e.g., an antigenic sequence
  • the expression vector must, of course, be compatible with the attenuated bacterium into which the vector is to be inserted and will advantageously be a plasmid.
  • references to the nirB promoter refer to the promoter itself or a part or derivatives thereof that are capable of promoting the expression of a coding sequence under anaerobic conditions.
  • the preferred sequence which contains the nirB promoter is:
  • the hinge region is a region constructed to induce independent folding of both the first and second proteins by providing both spatial and temporal separation between the domains.
  • the hinge region is typically a coding sequence for a high proportion of proline and / or glycine amino acids.
  • the hinge region may be composed entirely of proline and / or glycine amino acids.
  • the hinge region may comprise one or more glycine-proline dipeptide units.
  • the hinge region may, for example, contain up to about fifteen amino acids, for example at least four, and preferably six to fourteen amino acids, the number of amino acids being such that it confers the flexibility between the first and second amino acids, the second protein.
  • the vaccine composition of the present invention may include one or more suitable adjuvants.
  • the vaccines according to the invention are preferably suitable for oral administration and are for example in the form of tablets, a solution or oral suspension, sachet or granules dispersible in water.
  • the dose of vaccine to be administered depends on the type, weight, size of man or animal to which the vaccine is to be administered and the degree of immunogenicity of the vaccine agent.
  • the vaccine of the present invention can be used in the prophylactic treatment of a host, such as an animal and, in particular, a dog.
  • a infection caused by parasites of the Echinococcus family, in particular a vaccine according to the invention.
  • the bacterium then expresses the PR1 and PR2 recombinant proteins capable of inducing the production of antibodies directed against parasites of the Echinococcus family.
  • the present invention also relates to the use of at least one microorganism for:
  • a first recombinant PR1 protein comprising from 48 to 435, preferably from 65 to 219 amino acids, which corresponds to an EgA31 fragment or to an analogue of an EgA31 fragment, said fragment of EgA31 comprising the sequence SEQ ID No. 3:
  • the invention also relates to a method of treatment for treating or preventing an infection, caused by parasites of the Echinococcus family, which implements:
  • a first recombinant PR1 protein comprising from 48 to 435, preferably from 65 to 219 amino acids, which corresponds to an EgA31 fragment or to an analog of an EgA31 fragment, said EgA31 fragment comprising the SEQ sequence ID N ° 3:
  • proteins are advantageously recombinant proteins and are preferably administered in the form of a microorganism, as defined above, ensuring their expression.
  • the cDNa sequence of tropomyosin is available in GenBank with No. AF011923. Reference can be made to the publication of Esteves, A., Senorale, M., and Ehrlich R. A "Tropomyosin gene is differentially expressed in the larval stage of Echinococcus granulosus" Parasitol. Res. 2003 Apr, 89 (6): 501-2.
  • the cloned region corresponding to the number AF011923 in GenBank coding for EgTrp was amplified by PCR using specific primers and then cloned into the pTECH 2 vector at Bam HI-Hind III sites.
  • the principle is based on the use of Salmonelies, strain Aro, in which a plasmid allows the expression of the tetanus toxin C fragment (Tet C) under the control of the promoter nirB (promoter of nitrite reductase) of E. coli. coli. This promoter is induced by anaerobiosis.
  • the TetC fragment is nontoxic but highly immunogenic and can function as an adjuvant for an associated antigen.
  • Salmonella typhi strain P228067 was deleted from 600 base pairs in the open reading phase of the AroC gene as described in US Pat.
  • the plasmids pTECH EgA31: II is prepared from the already existing plasmid pTETmir 15
  • SEQ ID NO: 3 were inserted near a domain coding for a pattern
  • Gly-Pro-Gly-Pro This type of domain creates a hinge that allows the individualization of the protein domain that follows it.
  • pTECH Df5 The protocol is the same as the previous one.
  • the restriction sites allow insertion of the DNA fragment encoding the tropomyosin fragment (SEQ ID NO: 4)
  • pFES EgA31 The DNA fragment encoding the sequence SEQ ID No. 3 is first fused to the SseA gene (Proteins of the Salmonella SPI2 group associated with the type III secretion system). A better export of the antigen is expected from this association.
  • Three Salmonella cultures LVR01 are each transformed by one of these three plasmids according to the methods described in Sambrook J. Fritsch EF, Maniatis T.
  • the bacteria are cultured on LB medium with stirring at 37 ° C. When the culture reaches the exponential phase of growth, it is centrifuged, and the bacteria are washed once in 10 ml of distilled water, glycerol 10% (volume-volume) at 40 ° C., then resuspended at the concentration of 10 10 cells. / ml.
  • Salmonella LVR01 were cultured on LB medium as described by
  • the vaccine, empty salmonellae and PBS were administered twice 20 days apart, per os, in 4 ml of PBS.
  • Salmonellae containing the plasmids were administered at the dose of
  • the animals were euthanized 26 days later with a barbiturate solution. Worms present in the anterior part of the intestine were counted after washing and scraping the mucosa and sedimentation.
  • 15765 is an average of 564, 1498, 2627 or a 78% decrease in the number of worms.
  • the number of worms was evaluated by 100 ml of resuspension in the washing liquid.
  • Vaccinated animals average 65 to / 100ml Animals with Salmonella alone: 135 to / 100ml
  • Infestation control animals 246 to / 100ml, a 73% reduction in the number of worms

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Medicinal Chemistry (AREA)
  • Tropical Medicine & Parasitology (AREA)
  • Veterinary Medicine (AREA)
  • General Health & Medical Sciences (AREA)
  • Public Health (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Toxicology (AREA)
  • Molecular Biology (AREA)
  • Mycology (AREA)
  • Microbiology (AREA)
  • Zoology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Epidemiology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Immunology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Peptides Or Proteins (AREA)

Abstract

La présente invention a pour objet une composition vaccinale, caractérisée en ce qu'elle comprend au moins un microorganisme permettant l'expression d'une première protéine recombinante PR1 comprenant de 48 à 435, de préférence de 65 à 219 acides aminés, qui correspond à un fragment d'EgA31 ou à un analogue d'un fragment d'EgA31, ledit fragment d'EgA31 comprenant la séquence SEQ ID N°3 : ISAAEKQAMDDSTASSDGIYFAIEEERKKSAELRRALGGQESRNLELQNDLERLQRETRDELDE QKAEIE; et l'expression d'une deuxième protéine recombinante PR2 de séquence SEQ ID N°4 : ETSTKLDDASKAAEESERNRKTLETRSISDDERMAQLEEQVKEAKYIAEDAERKYDEAARRLAV TEVDLERAESRLETSESKIVELEEELRIVGNNMKSLEVSEQESLQREESYEE?RDLTERLKTAE QRAAEAERQVSKLQNEVDRLEDELLSKERYRAISGELDTTFAELTSF, ou d'un de ses analogues.

Description

NOUVEAUX VACCINS DESTINES AU TRAITEMENT OU A LA PREVENTION DES INFECTIONS PAR PARASITES DE LA FAMILLE DES TAENIDAE ET EN PARTICULIER DU GENRE ECHINOCOCCUS
En particulier, la présente invention a pour objet des nouveaux vaccins destinés au traitement ou à la prévention des infections par parasites de la famille des Taenidae, et en particulier Echinococcus (E.) granulosus et donc de l'hydatidose.
Les parasites de la famille des Taenidae, et en particulier du genre Echinococcus appartiennent à l'ordre des Cestodes .Ils ont un cycle évolutif dixène. Dans le cas des échinocoques, l'hôte définitif est un Carnivore domestique ou sauvage chez lequel le parasite est localisé au niveau intestinal, le plus souvent dans les premières parties de l'intestin grêle. Il se contamine par ingestion des protoscolex contenus dans les larves.
L'hôte intermédiaire est, suivant le parasite en cause, un ongulé pour Echinococcus granulosus responsable de l'hydatidose, un rongeur pour Echinococcus multilocularis responsable de l'échinococcose alvéolaire. La larve renfermant les protoscolex se développe principalement, mais non exclusivement, au niveau du foie ou du poumon. La contamination s'effectue par ingestion des œufs éliminés en même temps que les fèces des carnivores, principalement du chien dans le cas d' Echinococcus granulosus.
Dans les deux cas, l'homme peut également jouer le rôle d'hôte intermédiaire avec les mêmes localisations larvaires que les ongulés.
L'hydatidose est une zoonose à distribution mondiale provoquée par le cestode E. granulosus. La forme larvaire du parasite infecte les bovins, les ovins, les camélidés, cervidés, etc., et l'homme. En zone d'endémie, la prévalence peut être très importante à la fois chez le bétail (jusqu'à QS% des moutons dans certains districts en Tunisie et au Maroc) et chez le chien (70% des animaux dans la région de Fès, au Maroc). Le parasite est la source de pertes économiques considérables (par exemple, plus de la moitié des abats nobles doivent être détruits au Maroc ; les brebis atteintes présentent des phénomènes d'émaciation et de perte en production de laine). Le parasite est également à l'origine d'un problème de santé humaine important : la prévalence chez l'homme atteint 1 ,43/1000 en zone rurale de la province du Rio Negro, en Argentine, 1 ,97/1000 dans le Xinjiang en Chine, 2,2/1000 dans le district du Turkana au Kenya, et des valeurs de 20 % ont été relevées localement dans des villages des Andes péruviennes. A titre d'exemple, la moitié des interventions chirurgicales hépatiques au Maroc sont liées à ce parasite.
Les moyens de lutte actuels se situent essentiellement à 2 niveaux :
- la modification des pratiques d'élevage, incluant la surveillance stricte des chiens, vecteurs de dissémination, qui se nourrissent des abats d'animaux d'élevage contaminés et rejetés; ces changements de pratique rencontrent souvent des difficultés d'application notamment dans les pays en voie de développement ;
- l'utilisation de vermifuges type Praziquantel ou Arécoline, qui ne sont cependant pas ovicides.
Un vaccin pour ovins a été mis au point à partir de protéines recombinantes exprimées par l'embryon (Lightowlers M.W., 1996, Int. J. Parasitol., 26, pp836-842), mais son application se révèle lourde car si l'efficacité est satisfaisante, la durée de protection est courte et le nombre d'animaux à traiter, donc à manipuler, important (l'ensemble du cheptel pour un éleveur).
On comprend aisément qu'il est urgent de trouver de nouveaux vaccins contre cette maladie. Pour cela, les inventeurs ont réalisé leurs essais chez le chien. En effet, la disparition ou la forte réduction du nombre de chiens disséminant les œufs serait un moyen d'interrompre le cycle de vie du parasite, et donc de réduire ou de supprimer la contamination du bétail et de l'homme. Le choix du chien comme cible du traitement conduit à avoir un nombre d'animaux à traiter considérablement plus réduit que si la cible est le bétail lui même.
Dans un travail antérieur (Fu et al., Mol. Biochem. Parasitol., 102, p.43- 52, 1999), une protéine du parasite détectée en raison de son immunogénicité très importante lors des infections naturelles ou expérimentales chez le chien a été identifiée et préparée. Une banque ADNc d'Echinococcus granulosυs dans le vecteur d'expression lambda gt22 avait été criblée à l'aide de sérum de chiens infectés par le parasite (3 mois en élevage protégé). L'ensemble des clones ADNc exprimant les protéines reconnues par les anticorps avaient été analysés une seconde fois avec les sérums individuels de chiens infectés et les intensités des réactions comparées : le clone fournissant la réaction la plus forte avec les sérums de tous les chiens avait été retenu et dénommé EgA31. Cette publication permet donc de mettre en évidence l'existence d'anticorps circulants dirigés contre la protéine EgA31 chez des chiens infectés par le parasite E. granulosus.
Cet ADNc code pour une protéine riche en leucine, de structure putative hélicoïdale, comportant un domaine riche en proline de type SH3 (Sarc Homology 3 type 1) proche de la région C terminale de la protéine; ces domaines sont impliqués notamment dans des interactions protéine - protéine. Par ailleurs, 28 sites de phosphorylation et 4 sites de myristylation putatifs peuvent être repérés grâce au logiciel PROSITE. La séquence de EgA31 a été déposée (GenBank) sous le numéro AF 067 807.
Les inventeurs ont également mis en évidence, dans Parasite Immunology, 25(10), 2003, 489-501 et WO 2005/058350 que la protéine nommée EgA31 , ainsi que certains de ses fragments ou variants, et en particulier les fragments nommés Pst-Hind de séquence SEQ ID N°1 :
AEKQAMDDSTASSDGIYFAIEEERKKSAELRRALΓΓQESRNLELQNDLERLQRETRDE LDEQKAEIEKLHKELVGADNSKTTVQSIRNEMRGIQVQIQLLRGGYLDLFHDKIGHYK EKLQESETKLLELQGTHDQTKRIHDVEKDKLAQELKYMEKQINLCSNENNKLKDALA SMENQΓΓGLLNGNELLKKKIEMLETRAETKEINTKLEN et Pst-Dra SEQ ID N°2 :
AEKQAMDDSTASSDGIYFAIEEERKKSAELRRALΓΓQESRNLELQNDLERLQRETRDE
LDEQKAEIEKLHKELVGADNSKTTVQSIRNEMRGIQVQIQLLRGGYLDLFHDKIGHYK
EKLQESETKLLELQGTHDQTKRIHDVEKDKLAQELKYMEKQINLCSNENNKLKDALA
SMENQITGLLNGNELLKKKIEMLETRAETKEINTKLENLLKTETQELLΠIKDLDSKLT
ESGEEVKELKKQLEKAEKQIRDAEVLTDEKN KIIEEM KKTINKLSETKKEVEDKNSELR
KASIQKQSLIEEKEILGRQLELKDΉISAMKKEKDALRHELHEMRDΉNTLTEKIAΉKI PEPLPMKPIEIPKPLQKEGVNKAMENEIQTYKDTIKTLKDEIFDKSRVINENQVΠKQLE
RD présentent une activité immunogène d' E granulosus et entraînent, notamment chez le chien, une modification de la réponse du duodénum à l'infection ultérieure par E granulosus et peut donc de ce fait faire l'objet de vaccins contre les infections dues à ce type de parasites.
La tropomyosine est une protéine hélicoïdale présente entre autre dans les larves d' E granulosus (Esteves A., Parasitai. Res., 2003, Apr 89(6), 501- 2). La séquence nucléotidique de la tropomyosine a été déposée dans GenBAnk sous le numéro AAB65799. C'est un composant des cellules musculaires intervenant, en association avec l'actine et la myosine dans la contraction musculaire. Elle est connue pour induire une immunité protectrice contre des Nématodes parasites lors d'infestations expérimentales.
Néanmoins, à ce jour, il n'a pas été mentionné, ni même suggéré que que la tropomyosine pouvait induire une protection efficace des infections par parasites de la famille des Taenidae.
Dans ce contexte dans lequel le besoin pour de nouveaux vaccins plus efficaces est toujours exprimé, la présente invention a pour objet une composition vaccinale, caractérisée en ce qu'elle comprend au moins un microorganisme permettant :
- l'expression d'une première protéine recombinante PR1 de 48 à 435, de préférence de 65 à 219 acides aminés, qui correspond à un fragment d'EgA31 ou à un analogue d'un fragment d'EgA31 , ledit fragment d'EgA31 comprenant la séquence SEQ ID N°3 :
ISAAEKQAMDDSTASSDGIYFAIEEERKKSAELRRAUTQESRN LELQNDLERLQRET RDELDEQKAEIE
- et l'expression d'une deuxième protéine recombinante PR2 de séquence SEQ ID N°4 :
ETSTKLDDASKAAEESERNRKTLETRSISDDERMAQLEEQVKEAKYIAEDAERKYDEA ARRLAVTEVDLERAESRLETSESKIVELEEELRIVGNNMKSLEVSEQESLQREESYEET IRDLTERLKTAEQRAAEAERQVSKLQNEVDRLEDELLSKERYRAISGELDTTFAELTSF ou d'un de ses analogues.
La séquence SEQ ID N°3 correspond aux acides aminés n°168 à 237 de la séquence déposée sous le n°AF067807 dans GenBank.
Au sens de l'invention, par analogues de l'une des protéines susmentionnées, on entend une protéine dont la séquence correspond à la protéine dont elle est l'analogue et dont la séquence diffère par l'insertion, la substitution ou la délétion d'un ou plusieurs acides aminés et qui permet d'obtenir une activité protectrice vis-à-vis des Taenidae et en particulier, des parasites du genre Echinococcus au moins équivalente. Les analogues d'une protéine contiennent donc au moins un épitope de ladite protéine, responsable de l'activité immunogène vis-à-vis des parasites du genre Echinococcus du fragment de EgA31 ou du fragment de la tropomyosine, respectivement, et restent donc fonctionnellement équivalents à ces derniers. Ils pourront contenir, par rapport au fragment de EgA31 ou au fragment de la tropomyosine respectivement, sur un ou plusieurs sites spécifiques, des amino acides à la place d'autres amino acides équivalents qui correspondent à des substitutions conservatives qui conduisent à une forme de la protéine et à une fonction équivalente. Les groupes d'amino acides ci-après sont généralement reconnus comme équivalents :
- AIa, Ser, Thr, Pro, GIy
- Asn, Asp, Glu, GIn,
- His, Arg, Lys,
- Met, Leu, Ile, Val,
- Phe, Tyr, Trp.
Les analogues d'une protéine de référence (fragment de EgA31 ou fragment de la tropomyosine) présenteront, de préférence, après alignement un pourcentage d'homologie d'au moins 80%, de préférence d'au moins 95%, préférentiellement d'au moins 98%, et avantageusement de 100% avec la protéine dont ils sont l'analogue. Le degré d'homologie peut, au sens de l'invention, être déterminé localement par les techniques de comparaison de séquences protéiques, et par exemple la technique BLAST P telle que décrite par ALTSCHUL S.F. et al. dans Nucleic Acid Research 1997, 25, 3389-3402. Dans ce cas, est, par exemple, considérée comme une séquence protéique, analogue d'une autre séquence protéique de référence, une protéine qui présente, sur un nombre d'acides aminés au moins égal à 80% du nombre d'acides aminés de la séquence protéique de référence, un pourcentage d'homologie donné par la technique BLAST P correspondant aux valeurs indiquées précédemment, à savoir un pourcentage d'homologie d'au moins 80%, de préférence d'au moins 95%, préférentiellement d'au moins 98%, et avantageusement de 100%. L'alignement optimal qui correspond à l'alignement qui donne le nombre le plus important d'acides aminés identiques après alignement entre les deux séquences d'acides aminés comparées, peut être obtenu, éventuellement par glissement des séquences les unes par rapport à l'autre et/ou l'insertion dans l'une des séquences comparées, d'un gap entre 2 acides aminés consécutifs.
La protéine PRl présente de 48 à 435 et, de préférence, de 65 à 219 acides aminés. Aussi, lorsque cette protéine PRl est un fragment d'EgA31, comprenant la SEQ ID N°3 qui comprend 70 acides aminés, la protéine PRl est bien évidemment composée de 70 à 435 ou, de préférence, de 70 à 219 acides aminés. Les protéines PR2 correspondant à un analogue d'un tel fragment peuvent, quant à elles, être composées de 48 à 435, de préférence de 65 à 219 acides aminés.
De façon préférée, la première protéine recombinante PRl est un fragment contenu dans la portion d'EgA31 de séquence SEQ ID N°5 :
ISAAEKQAMDDSTASSDGIYFAIEEERKKSAELRRAUTQESRNLELQNDLERLQRET
RDELDEQKAEIEKLHKELVGADNSKTTVQSIRNEMRGIQVQIQLLRGGYLDLFHDKIG
HYKEKLQESETKLLELQGTHDQTKRIHDVEKDKLAQELKYMEKQINLCSNENNKLKD
AUSMENQRTGLLNGNELLKKKIEMLETRAETKEINTKLENLLKTETQELLTΠKDLDS
KLTESGEEVKELKKQLEKAEKQIRDAEVLTDEKNKIIEEMKKTINKLSETKKEVEDKNS
ELRKASIQKQSLIEEKEILGRQLELKDΠISAMKKEKDALRHELHEMRDTINTLTEKIAT
IKIPEPLPMKPIEIPKPLQKEGVNKAMENEIQTYKDΉKTLKDEIFDKSRVINENQVIIK
QLERD de préférence, dans la portion d'EgA31 de séquence SEQ ID N°6 :
ISAAEKQAMDDSTASSDGIYFAIEEERKKSAELRRALΓTQESRNLELQNDLERLQRET RDELDEQKAEIEKLHKELVGADNSKTTVQSIRNEMRGIQVQIQLLRGGYLDLFHDKIG HYKEKLQESEETKLLELQGTHDQTKRIHDVEKDKUQELKYMEKQINLCSNENNKLKD ALASMENQITGLLNGNELLKKKIEMLETRAETKEINTKLEN, ou un analogue d'un tel fragment.
Selon une variante particulièrement préférée, la première protéine recombinante PRl est un fragment qui comprend de 60 à 75 acides aminés et qui est contenu dans la séquence SEQ ID N°6 :
ISAAEKQAMDDSTASSDGIYFAIEEERKKSAELRRALΓΓQESRN LELQNDLERLQRET RDELDEQKAEIEKLHKELVGADNSKTTVQSIRNEMRGIQVQIQLLRGGYLDLFHDKIG HYKEKLQESETKLLELQGTHDQTKRIHDVEKDKLAQELKYMEKQINLCSNENNKLKD ALASMENQΓΓGLLNGNELLKKKIEMLETRAETKEINTKLEN, ou un analogue d'un tel fragment.
En particulier, la première protéine recombinante PRl correspond à la protéine de séquence SEQ ID N°3 :
ISAAEKQAMDDSTASSDGIYFAIEEERKKSAELRRALΓTQESRNLELQNDLERLQRET RDELDEQKAEIE ou à un analogue de cette protéine.
Egalement de façon avantageuse, la deuxième protéine PR2 présente la séquence SEQ ID N°4 :
ETSTKLDDASKAAEESERNRKTLETRSISDDERMAQLEEQVKEAKYIAEDAERKYDEA ARRLAVTEVDLERAESRLETSESKIVELEEELRIVGNNMKSLEVSEQESLQREESYEET IRDLTERLKTAEQRAAEAERQVSKLQNEVDRLEDELLSKERYRAISGELDTTFAELTSF
Les microorganismes utilisés pour l'expression des protéines recombinantes sont, avantageusement des microorganismes atténués, tel que des virus atténués ou des bactéries atténuées.
De façon avantageuse, le microorganisme utilisé permet une libération des protéines exprimées, au niveau des muqueuses de l'hôte à traiter.
Dans le cadre de l'invention, il est possible d'utiliser une seul microorganisme permettent l'expression des deux protéines PR1 et PR2 ou deux microorganismes permettant chacun l'expression de l'une des protéines.
La bactérie atténuée peut être choisie parmi différents genres dont les genres Salmonella, Bordetella, Vibrio, Haemophilus et Yersinia. La bactérie atténuée peut, également, être une souche atténuée de Escherichia coli entérotoxigène. En particulier, les espèces suivantes peuvent être mentionnées : S. enterica serovar Typhimurium - l'agent de la salmonellose chez plusieurs espèces animales, un des agents d'empoisonnement alimentaire chez l'homme ; S. cholerae suis - un agent de la salmonellose chez les porcins ; Bordetella bronchiseptica,; Haemophilus influenzae et Yersinia - un agent d'empoisonnement alimentaire.
Dans le cadre de l'invention, il est préférable de disposer d'un vaccin ayant pour cible le chien et permettant une diminution importante du nombre d'œufs du parasite disséminés dans l'environnement, et ainsi réduire la contamination du bétail et de l'homme. De plus le nombre de chiens à traiter est nettement inférieur à celui du bétail et la manipulation est plus simple, puisqu'une administration peros par appâts est possible.
Par conséquent, on utilisera de façon avantageuse, une souche de Salmonelle spécifique du chien, de préférence la Salmonella typhi ou la Salmonella enterica. A titre d'exemple particulièrement préféré, on peut citer, la LVR01, décrite dans Vaccine, 2001, 19, 460-469.
Parmi les virus atténués utilisés comme carriers, on peut citer la vaccine utilisée dans les vaccins contre la rage, la famille des Pox virus, Herpès simplex, le virus de la stomatite vésiculeuse.
L'atténuation du microorganisme est obtenue notamment par délétion des gènes de la pathogénicité. L'atténuation peut être attribuée à une mutation irréversible dans un gène de la voie de biosynthèse des acides aminés aromatiques de la bactérie. Il y a au moins dix gènes impliqués dans la synthèse du chorismate, composé situé au carrefour de la voie de biosynthèse des acides aminés aromatiques. Plusieurs d'entre eux sont localisés à des endroits très différents dans le génome bactérien, par exemple aroA (5-énolpyruvateshikimate-3-phosphate synthase), par exemple aroC (chorismate synthase), aroD (3-dihydroquinate déhydratase) et aroE (shikimate déshydrogénase). Une mutation peut donc apparaître dans le gène aroA, aroC, aroD ou aroE.
Cependant, de préférence, une bactérie atténuée contient une mutation irréversible dans chacun de deux gènes distincts de sa voie de biosynthèse des acides aminés aromatiques. De telles bactéries sont décrites dans EP-A-O 322237. Des doubles mutants aro appropriés sont aroA aroC, aroA aroD et aroA aroE. D'autres bactéries ayant des mutations dans d'autres combinaisons des gènes aroA, aroC, aroD et aroE sont cependant utilisables. Les doubles mutants aro de Salmonella sont particulièrement préférés, par exemple les double mutants aro de S. typhi ou de S. typhimurium ou avantageusement de S. enterica, en particulier les mutants aroA aroC, aroA aroD et aroA aroE. La bactérie atténuée peut, également, contenir une mutation irréversible dans un gène impliqué dans la régulation d'un ou plusieurs autres gènes (EP-A-O 400 958). De préférence, la mutation se produit dans le gène ompR ou un autre gène impliqué dans la régulation.
Ce type de bactérie atténuée peut contenir une seconde mutation dans un second gène. De préférence, le second gène est un gène codant pour une enzyme impliquée dans une voie de biosynthèse essentielle, en particulier des gènes impliqués dans la voie de synthèse du pré-chorismate impliqué dans la biosynthèse des composés aromatiques. La seconde mutation est donc, de préférence, dans le gène aroA, aroC ou aroD.
Un autre type de bactérie atténuée est une bactérie dans laquelle l'atténuation est due à la présence d'une mutation irréversible dans un des gènes impliqués dans la réponse à un stress de l'environnement. De telles bactéries sont décrites dans WO 91/15572. La mutation irréversible peut être une délétion, une insertion, une inversion ou une substitution- Une mutation par délétion peut être générée en utilisant un transposon.
Le gène codant pour les protéines induisant des réponses immunitaires, peut être inséré dans un plasmide ou directement incorporé dans le chromosome du microorganisme.
Un microorganisme atténué, utilisable dans un vaccin selon la présente invention, peut être préparé en transformant le microorganisme atténué avec une construction d'ADN, permettant l'expression de la protéine immunogène souhaitée. Toute technique de transformation appropriée peut être utilisée, telle que l'électroporation. De cette manière, on peut obtenir une bactérie atténuée capable d'exprimer une protéine ou des protéines hétérologues pour la bactérie. Une culture de la bactérie atténuée peut être cultivée dans des conditions aérobies. Une quantité suffisante de bactéries est donc préparée, en vue d'une formulation comme vaccin, avec une expression minimale de la protéine hétérologue.
Selon une technique avantageuse, il est possible d'utiliser un promoteur capable de promouvoir l'expression d'une séquence ADN et dont l'activité est inductible in vivo, dans des conditions anaérobies, et en particulier le promoteur de la nitrite réductase de E. coli nirB, comme décrit par N. S. Chatfield et al. Biotechnology, vol 10, 888-892, 1992. Le promoteur NirB a, par exemple, été décrit dans la demande de brevet WO 92/15689.
Selon un aspect avantageux, on utilise une construction d'ADN comprenant un promoteur tel que défini ci-dessus, lié de manière fonctionnelle à une séquence ADN codant pour deux séquences protéiques liées par une liaison charnière : l'une des séquences protéiques sera la première protéine PR1 et l'autre séquence sera de préférence une séquence antigénique comprenant le fragment C de la toxine tétanique ou des épitopes de celui-ci, comme décrit dans EP 0652962 auquel on pourra se référer.
La construction d'ADN peut donc être un vecteur d'expression capable de se répliquer comprenant le promoteur nirB lié, de manière fonctionnelle, à une séquence d'ADN codant pour le fragment C de la toxine tétanique ou des épitopes de celui-ci et la seconde protéine hétérologue, liés par une région charnière. Le promoteur nirB peut être inséré dans un vecteur d'expression, dans lequel est déjà incorporé un gène codant pour l'une des protéines hétérologues (par exemple le fragment C de la toxine tétanique), à la place du promoteur existant, contrôlant l'expression de la protéine. La région charnière et le gène codant pour la seconde protéine hétérologue (par exemple une séquence antigénique) peuvent, ensuite, être insérés. Le vecteur d'expression doit, bien entendu, être compatible avec la bactérie atténuée dans laquelle le vecteur doit être inséré et sera, avantageusement, un plasmide.
Comme décrit dans ce document, incorporé ici par référence, il est préférable d'utiliser uniquement la partie du promoteur nirB qui répond uniquement à l'anaérobiose. Telles qu'utilisées ici, les référence au promoteur nirB désignent le promoteur lui-même ou une partie ou des dérivés de celui-ci qui sont capables de promouvoir l'expression d'une séquence codante dans des conditions anaérobies. La séquence préférée et qui contient le promoteur nirB est :
AATTCAGGTAAATTTGATGTACATCAAATGGTACCCCTTGCTGAATCGTT AAGGTAGGCGGTAGGGCC (SEQ ID N°7)
La région charnière est une région construite afin d'induire le repliement indépendant, à la fois de la première et de la seconde protéine en fournissant, à la fois une séparation spatiale et temporelle entre les domaines.
La région charnière est typiquement une séquence codant pour une proportion élevée d'acides aminés proline et/ou glycine. La région charnière peut être composée entièrement d'acides aminés proline et/ou glycine. La région charnière peut comprendre une ou plusieurs unités dipeptidiques glycine-proline.
La région charnière peut, par exemple contenir jusqu'à environ quinze acides aminés, par exemple au moins quatre et, de préférence, six à quatorze acides aminés, le nombre d'acides aminés étant tel qu'il confère la flexibilité entre la première et la seconde protéine.
Il a été démontré qu'en fournissant une séquence d'ADN codant pour le fragment C de la toxine tétanique (TetC) liée, via une région charnière, à une seconde séquence codant pour un antigène, l'expression de la séquence dans les cellules bactériennes est accrue par rapport à des constructions dans lesquelles le fragment C et la région charnière sont absents.
La composition de vaccin de la présente invention peut comprendre un ou plusieurs adjuvants appropriés.
Les vaccins selon l'invention sont de préférence adaptés pour une administration par voie orale et se présentent par exemple sous la forme de comprimés, d'une solution ou suspension buvable, de sachet ou granulés dispersibles dans l'eau. La dose de vaccin qui doit être administrée dépend du type, du poids, de la taille de l'homme ou de l'animal à qui le vaccin doit être administré et du degré d'immunogénicité de l'agent vaccinant.
Le vaccin de la présente invention peut être utilisé dans le traitement prophylactique d'un hôte, tel qu'un animal et, en particulier, d'un chien. Une infection, provoquée par des parasites de la famille Echinococcus, en particulier un vaccin selon l'invention. La bactérie exprime alors les protéines recombinantes PR1 et PR2 capables d'induire la production d'anticorps dirigés contre des parasites de la famille Echinococcus.
La présente invention a également pour objet l'utilisation d'au moins un microorganisme permettant :
- l'expression d'une première protéine recombinante PR1 comprenant de 48 à 435, de préférence de 65 à 219 acides aminés, qui correspond à un fragment d'EgA31 ou à un analogue d'un fragment d'EgA31 , ledit fragment d'EgA31 comprenant la séquence SEQ ID N°3 :
ISAAEKQAMDDSTASSDGIYFAIEEERKKSAELRRALΓΓQESRNLELQNDLERLQRET RDELDEQKAEIE
- et l'expression d'une deuxième protéine recombinante PR2 de séquence SEQ ID N°4 :
ETSTKLDDASKAAEESERNRKTLETRSISDDERMAQLEEQVKEAKYIAEDAERKYDEA ARRLAVTEVDLERAESRLETSESKIVELEEELRIVGNNMKSLEVSEQESLQREESYEET IRDLTERLKTAEQRAAEAERQVSKLQNEVDRLEDELLSKERYRAISGELDTTFAELTSF ou d'un de ses analogues, pour la fabrication d'un vaccin destiné à traiter ou prévenir une infection, provoquée par des parasites de la famille Echinococcus.
L'invention concerne également une méthode de traitement pour traiter ou prévenir une infection, provoquée par des parasites de la famille Echinococcus, qui met en œuvre :
- une première protéine recombinante PR1 comprenant de 48 à 435, de préférence de 65 à 219 acides aminés, qui correspond à un fragment d'EgA31 ou à un analogue d'un fragment d'EgA31 , ledit fragment d'EgA31 comprenant la séquence SEQ ID N°3 :
ISAAEKQAMDDSTASSDGIYFAIEEERKKSAELRRALΓTQESRNLELQNDLERLQRET RDELDEQKAEIE
- et une deuxième protéine recombinante PR2 de séquence SEQ ID N°4 :
ETSTKLDDASKAAEESERNRKTLETRSISDDERMAQLEEQVKEAKYIAEDAERKYDEA ARRLAVTEVDLERAESRLETSESKIVELEEELRIVGNNMKSLEVSEQESLQREESYEET IRDLTERLKTAEQRAAEAERQVSKLQNEVDRLEDELLSKERYRAISGELDTTFAELTSF ou d'un de ses analogues.
Ces protéines sont avantageusement des protéines recombinantes et sont, de préférence, administrées sous la forme d'un microorganisme, tel que précédemment défini, assurant leur expression.
Toutes les variantes préférées décrites précédemment, dans le cadre de la description des vaccins conformes à l'invention, s'appliquent à l'utilisation et à la méthode de traitement ci-dessus définies. L'utilisation et la méthode selon l'invention, sont, en particulier, en particulier appliquées au traitement des chiens et au traitement par voie orale.
Les exemples ci-après mettent en évidence l'efficacité de l'association de de deux protéines PR1 et PR2. A/ Fragment de la tropomyosine
La séquence de cDNa de la tropomyosine est accessible dans GenBank avec le N° AF011923. On pourra se référer à la publication de Esteves, A., Senorale, M., and Ehrlich R. A "Tropomyosin gène is differentially expressed in the larval stage of Echinococcus granulosus" Parasitol. Res. 2003 Apr,89(6):501-2.
La construction utilisée pour la préparation du vaccin a été obtenue de la manière suivante :
La région clonée correspondant au numéro AF011923 dans GenBank codant pour EgTrp (Tropomysin-like gène d'Echinococcus granulosus) a été amplifiée par PCR en utilisant des primers spécifiques puis clonée dans le vecteur pTECH 2 aux sites Bam Hl-Hind III.
Une fois clonée, elle a été séquencée de nouveau, ce qui a montré la présence d'une erreur probablement introduite par la Taq polymerase. La nouvelle séquence (n°AAB65799 dans GenBank), est la suivante : SEQ ID N° 8 gaaacatctactaagcttgacgatgctagcaaagctgctgaggagagcgaaaggaatcgaaaaaccctt gagaccaggtctatttctgacgatgaacgaaaggcccaactagaagaacaggtaaaggaggcgaagt acatcgctgaagatgccgaacggaaatacgatgaagctgctcgccgcttggcagtgaccgaggtcgact tggagcgagcggagtctcgtttggaaacctcggagagcaaaatcgttgaacttgaggaagaactgcgca ttgttggtaacaacatgaaatctctcgaagtctccgagcaagagtctcttcagcgcgaagaaagttacgaa gaaaccattcgagatttgacagagcgcttgaagacggcagagcagcgtgctgccgaagctgaacgcca agtgtccaagctccaaaatgaagttgaccgccttgaagatgagctactatccgagaaggaacgttaccga gccatcagcggagaactggatactaccttcgcggagctcacttccttctga
B/ Les Salmonelies
Leur préparation a été décrite dans : « Construction, expression and immunogenicity of the Schistosoma mansoni P28 glutathion S- transferase as a genetic fusion to tetanus toxin fragment C in a live Aro attenuated vaccine strain of Salmonella -Anjam Khan CM. et al, Proc. Natl. Acad. ScL
USA, 1994, 91,11261-11265."
Le principe repose sur l'utilisation de Salmonelies, souche Aro, dans lesquelles un plasmide permet l'expression du fragment C de la toxine tétanique (Tet C) sous contrôle du promoteur nirB (promoteur de la nitrite réductase) d'E. coli. Ce promoteur est induit par I' anaérobiose.
Le fragment TetC est non toxique mais fortement immunogène et peut fonctionner comme adjuvant pour un antigène associé.
La souche P228067 de Salmonella typhi a été délétée de 600 paires de base dans la phase de lecture ouverte du gène AroC comme décrit dans
Chabalgoity et al., Vaccine ,19, 2001,460-469.
L'un des mutants (LVR01), ampicilline sensible et dépendant de la présence de composés aromatiques pour sa croissance, a été sélectionné et utilisé pour la suite du travail.
C/ Les Plasmides pTECH EgA31 : II est préparé à partir du plasmide pTETmir 15 déjà existant
(Chatfield et al., Biotechnology, 10,1992,888-892.) comme décrit par Anjam
Khan et al., dans PNAS, 91,1994,11261-11265. Brièvement des sites de restriction permettant l'insertion du fragment d'ADN codant pour la séquence
SEQ ID N° 3 ont été incérés à proximité d'un domaine codant pour un motif
Gly-Pro-Gly-Pro . Ce type de domaine crée une charnière qui permet l'individualisation du domaine protéique qui le suit. pTECH Df5 : Le protocole est le même que le précédent. Les sites de restriction permettent l'insertion du fragment d'ADN codant pour le fragment de la tropomyosine (SEQ ID N° 4) pFES EgA31 : Le fragment d'ADN codant pour la séquence SEQ ID N° 3 est d'abord fusionné au gène SseA (Protéines du groupe SPI2 de Salmonelles associées au système de sécrétion de type III). Une meilleure exportation de l'antigène est attendue de cette association. Trois cultures de Salmonelles LVR01 sont transformées chacune par un de ces trois plasmides selon les méthodes décrites dans Sambrook J. Fritsch E. F. , Maniatis T. 1989, Molecular cloning Laborarory Manual (CoId spring harbor Lab. Press, Plainview, N. Y.) tel que décrit dans Proc. Natl. Acad. Sci. USA, 911 11261-11265, 1994. Les bactéries sont cultivées sur milieu LB sous agitation à 37°C. Lorsque la culture atteint la phase exponentielle de croissance, elle est centrifugée, et les bactéries sont lavées 1 fois dans 10ml d'eau distillée, glycérol 10% (volume-volume) à 40C, puis resuspendues à la concentration de 1010 cellules/ml. 60μl de cette suspension et lμg d'ADN plasmidien repris dans 5μl d'eau distillée sont déposés dans une cellule d'électroporation (0,2cm, Biorad, Richmond) prérefroidie à 00C. L'électroporation est faite dans un électroporateur Biorad (1750 volts, 25μF, 800ohms; la durée des chocs électriques est de 12 à 15 millisecondes). Le mélange est ensuite transféré immédiatement dans de milieu LB froid, puis incubé à 37°C sous agitation pendant lh30. Les bactéries sont étalées sur boite de Pétri et cultivées à 37°C sur milieu LB contenant lOOμg/ml d'ampicilline pour sélection des colonies transformées. La production in vitro des protéines recombinantes est contrôlée par électrophorèse et utilisation d'anticorps spécifiques.
D/ Protocole d'administration et d'infestation
Les Salmonelles LVR01 ont été cultivées sur milieu LB comme décrit par
Chabalgoity et al., dans Vaccine ,19, 2001 ,460-469.
Les essais de vaccination ont été réalisés parallèlement au Maroc et en
Tunisie. Dans chaque cas, les animaux provenaient d'élevages locaux. Ils ont été vermifuges 3 semaines à 1 mois et demi, avant le début de l'expérimentation par du Praziquantel et de I' Albendazole au Maroc et en
Tunisie.
Leur âge variait de 2 à 5 mois au Maroc, de 4 mois à 1 an en Tunisie. Les chiens ont été mis à jeun 24 h avant le début de l'expérimentation. Ils ont reçu soit :
- le vaccin composé de 33% de chacune des 3 constructions dans les Salmonelles
- des Salmonelles sans plasmide
- du PBS
- rien
Le vaccin, les salmonelles vides et le PBS ont été administrés deux fois à 20 jours d'intervalle, per os, dans 4ml de PBS.
Préalablement à l'administration des Salmonelles, le comptage des colonies a été effectué en boite de Pétri sur gélose-Agar.
Les Salmonelles renfermant les plasmides ont été administrées à la dose de
1,8 X1011 salmonelles puis de 3,4X 1011 pour la seconde administration.
26 jours après la seconde administration, tous les animaux ont reçu une dose challenge de 75000 protoscolex viables. Le taux de viabilité a été évalué par le test de coloration à l'éosine.
Les animaux ont été euthanasiés 26 jours plus tard, à l'aide d'une solution de barbituriques. Les vers présents dans la partie antérieure de l'intestin ont été comptés après lavage et raclage de la muqueuse puis sédimentation.
Au Maroc : 5 animaux ont reçu les constructions vaccinales.
3 animaux ont reçu des Salmonelles sans plasmides
6 animaux ont servi de témoins (PBS + challenge et challenge seul)
Le total des vers pour chaque lot a été respectivement de : 2820, 4495,
15765 soit une moyenne de 564, 1498, 2627 soit une diminution de 78% du nombre de vers.
En Tunisie : 6 animaux ont reçu les constructions vaccinales.
3 animaux ont reçu des Salmonelles sans plasmides
5 animaux ont servi de témoins (PBS + challenge et challenge seul
Le nombre de vers a été évalué par 100ml de remise en suspension dans le liquide de lavage.
Animaux vaccinés : moyenne 65 vers /100ml Animaux avec Salmonelles seules : 135 vers /100ml
Animaux témoins d'infestation : 246 vers/100ml soit une réduction de 73% du nombre de vers
Dans les deux cas, au Maroc comme en Tunisie, un retard de croissance des vers a été observé chez les animaux vaccinés. Il correspond à 44 % des vers encore présents dans l'intestin des chiens après vaccination au Maroc. Or, la diminution du nombre de vers et le retard de croissance constituent les deux critères d'efficacité pour un vaccin en parasitologie.

Claims

REVENDICATIONS
1 - Composition vaccinale, caractérisée en ce qu'elle comprend au moins un microorganisme permettant :
- l'expression d'une première protéine recombinante PR1 comprenant de 48 à 435, de préférence de 65 à 219 acides aminés, qui correspond à un fragment d'EgA31 ou à un analogue d'un fragment d'EgA31, ledit fragment d'EgA31 comprenant la séquence SEQ ID N°3 :
ISAAEKQAMDDSTASSDGIYFAIEEERKKSAELRRALITQESRNLELQNDLERLQRET RDELDEQKAEIE
- et l'expression d'une deuxième protéine recombinante PR2 de séquence SEQ ID N°4 :
ETSTKLDDASKAAEESERNRKTLETRSISDDERMAQLEEQVKEAKYIAEDAERKYDEA ARRLAVTEVDLERAESRLETSESKIVELEEELRIVGNNMKSLEVSEQESLQREESYEET IRDLTERLKTAEQRAAEAERQVSKLQNEVDRLEDELLSKERYRAISGELDTTFAELTSF ou d'un de ses analogues.
2 - Composition vaccinale selon la revendication 1, caractérisée en ce que la première protéine recombinante PRl est un fragment contenu dans la portion d'EgA31 de séquence SEQ ID N°5 :
ISAAEKQAMDDSTASSDGIYFAIEEERKKSAELRRALΓΓQESRNLELQNDLERLQRET
RDELDEQKAEIEKLHKELVGADNSKTTVQSIRNEMRGIQVQIQLLRGGYLDLFHDKIG
HYKEKLQESETKLLELQGTHDQTKRIHDVEKDKLAQELKYMEKQINLCSNENNKLKD
ALASMENQΓΓGLLNGNELLKKKIEMLETRAETKBNTKLENLLKTETQELLTΠKDLDS
KLTESGEEVKELKKQLEKAEKQIRDAEVLTDEKNKIIEEMKKTINKLSETKKEVEDKNS
ELRKASIQKQSLIEEKEILGRQLELKDΠISAMKKEKDALRHELHEMRDΠNTLTEKIAT
IKIPEPLPMKPIEIPKPLQKEGVNKAMENEIQTYKDTIKTLKDEIFDKSRVINENQVIIK
QLERD de préférence, dans la portion d'EgA31 de séquence SEQ ID N°6 :
ISAAEKQAMDDSTASSDGIYFAIEEERKKSAELRRALΓΓQESRNLELQNDLERLQRET RDELDEQKAEIEKLHKELVGADNSKTTVQSIRNEMRGIQVQIQLLRGGYLDLFHDKIG HYKEKLQESETKLLELQGTHDQTKRIHDVEKDKLAQELKYMEKQINLCSNENNKLKD ALASMENQΓΓGLLNGNELLKKKIEMLETRAETKEINTKLEN, ou un analogue d'un tel fragment. 3 - Composition vaccinale selon la revendication 1 ou 2, caractérisée en ce que la première protéine recombinante PRl est un fragment qui comprend de 60 à 75 acides aminés et qui est contenu dans la séquence SEQ ID N°6 :
ISAAEKQAMDDSTASSDGIYFAIEEERKKSAELRRALΓTQESRNLELQNDLERLQRET RDELDEQKAEIEKLHKELVGADNSKTTVQSIRNEMRGIQVQIQLLRGGYLDLFHDKIG HYKEKLQESETKLLELQGTHDQTKRIHDVEKDKLAQELKYMEKQINLCSNENNKLKD ALASMENQUGLLNGNELLKKKIEMLEΓRAETKEINTKLEN, ou un analogue d'un tel fragment.
4 - Composition vaccinale selon l'une des revendications 1 à 3, caractérisée en ce que la première protéine recombinante PRl correspond à la protéine de séquence SEQ ID N°3 :
ISAAEKQAMDDSTASSDGIYFAIEEERKKSAELRRALΓΓQESRNLELQNDLERLQRET RDELDEQKAEIE.
5 - Composition vaccinale selon l'une des revendications 1 à 4, caractérisée en ce que le microorganisme est un microorganisme atténué qui permet une libération des protéines exprimées, au niveau des muqueuses de l'hôte à traiter.
6 - Composition vaccinale selon l'une des revendications 1 à 5, caractérisée en ce qu'elle est destinée et adaptée à une administration par voie orale.
7 - Composition vaccinale selon l'une des revendications 1 à 6, caractérisée en ce que le ou les microorganismes utilisés sont des bactéries atténuées, et en particulier des Salmonelles atténuées.
8 - Composition vaccinale selon l'une des revendications 1 à 7, caractérisée en ce qu'elle comprend une première bactérie atténuée permettant l'expression de la première protéine recombinante PRl et une deuxième bactérie permettant l'expression de la deuxième protéine recombinante PR2.
9 - Composition vaccinale selon l'une des revendications 1 à 8, caractérisée en ce que la ou les bactéries sont des Salmonella enterica. 10 - Composition vaccinale selon l'une des revendications 1 à 9, caractérisée en ce que la ou les bactéries sont LVROl.
11 - Composition vaccinale selon l'une des revendications 1 à 10, caractérisée en ce que les protéines recombinantes PRl et PR2 sont exprimées par l'intermédiaire d'un vecteur d'expression inséré dans le(s) microorganismes.
12 - Composition vaccinale selon l'une des revendications 1 à 11, caractérisée en ce qu'un plasmide est utilisé en tant que vecteur d'expression.
13 - Composition vaccinale selon l'une des revendications 1 à 12, caractérisée en ce que l'ADN codant pour la première protéine recombinante PRl est fusionné avec une séquence nucléotidique d'exportation.
14 - Composition vaccinale selon l'une des revendications 1 à 13, caractérisée en ce qu'elle est destinée au traitement ou à la prévention des infections par parasites de la famille Echinococcus, et en particulier E granulosuset E. multilocularis, chez l'homme ou chez l'animal.
15 - Composition vaccinale selon l'une des revendications 1 à 14, caractérisée en ce qu'elle est destinée au traitement des chiens.
16 - Composition vaccinale selon l'une des revendications 1 à 15, caractérisée en ce qu'elle est destinée au traitement de l'hydatidose.
17 - Protéine de SEQ ID N° 3 :
ISAAEKQAMDDSTASSDGIYFAIEEERKKSAELRRALΓTQESRNLELQNDLERLQREΞΓ RDELDEQKAEIE
PCT/FR2007/000417 2006-03-08 2007-03-08 Nouveaux vaccins destines au traitement ou a la prevention des infections par parasites de la famille des taenidae et en particulier du genre echinococcus WO2007101948A2 (fr)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
FR0650799A FR2898276B1 (fr) 2006-03-08 2006-03-08 Nouveaux vaccins destines au traitement ou a la prevention des infections par parasites de la famille des taenidae et en particulier du genre echinococcus
FR0650799 2006-03-08

Publications (2)

Publication Number Publication Date
WO2007101948A2 true WO2007101948A2 (fr) 2007-09-13
WO2007101948A3 WO2007101948A3 (fr) 2007-11-15

Family

ID=37335257

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/FR2007/000417 WO2007101948A2 (fr) 2006-03-08 2007-03-08 Nouveaux vaccins destines au traitement ou a la prevention des infections par parasites de la famille des taenidae et en particulier du genre echinococcus

Country Status (2)

Country Link
FR (1) FR2898276B1 (fr)
WO (1) WO2007101948A2 (fr)

Cited By (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN105039349A (zh) * 2015-05-28 2015-11-11 吉林大学 一种细粒棘球绦虫成虫诊断蛋白基因及其医用用途
CN113372452A (zh) * 2021-06-08 2021-09-10 新疆医科大学 一种细粒棘球绦虫重组蛋白CTLA4-IgV-EgG1Y162及其应用
CN114196691A (zh) * 2021-12-28 2022-03-18 重庆澳龙生物制品有限公司 一种制备防治牛、羊棘球蚴病多表位重组疫苗的基因、蛋白质、疫苗和应用

Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP0322237A1 (fr) * 1987-12-23 1989-06-28 The Wellcome Foundation Limited Vaccins
EP0400958A2 (fr) * 1989-05-30 1990-12-05 The Wellcome Foundation Limited Vaccins vivants
WO2005058350A1 (fr) * 2003-12-12 2005-06-30 Universite Claude Bernard Lyon I Nouveaux vaccins destines au traitement ou a la prevention des infections par parasites de la famille echinococcus

Patent Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP0322237A1 (fr) * 1987-12-23 1989-06-28 The Wellcome Foundation Limited Vaccins
EP0400958A2 (fr) * 1989-05-30 1990-12-05 The Wellcome Foundation Limited Vaccins vivants
WO2005058350A1 (fr) * 2003-12-12 2005-06-30 Universite Claude Bernard Lyon I Nouveaux vaccins destines au traitement ou a la prevention des infections par parasites de la famille echinococcus

Non-Patent Citations (3)

* Cited by examiner, † Cited by third party
Title
CHABALGOITY J A ET AL: "Expression and immunogenicity of an Echinococcus granulosus fatty acid-binding protein in live attenuated Salmonella vaccine strains." INFECTION AND IMMUNITY. JUN 1997, vol. 65, no. 6, juin 1997 (1997-06), pages 2402-2412, XP002407588 ISSN: 0019-9567 *
ESTEVES ADRIANA ET AL: "A tropomyosin gene is differentially expressed in the larval stage of Echinococcus granulosus." PARASITOLOGY RESEARCH. APR 2003, vol. 89, no. 6, avril 2003 (2003-04), pages 501-502, XP002407589 ISSN: 0932-0113 *
FRAIZE M ET AL: "Immunogenicity of two Echinococcus granulosus antigens EgA31 and EgTrp in mice" PARASITOLOGY RESEARCH, SPRINGER VERLAG, BERLIN, DE, vol. 96, no. 2, mai 2005 (2005-05), pages 113-120, XP002330442 ISSN: 0932-0113 *

Cited By (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN105039349A (zh) * 2015-05-28 2015-11-11 吉林大学 一种细粒棘球绦虫成虫诊断蛋白基因及其医用用途
CN105039349B (zh) * 2015-05-28 2021-06-25 吉林大学 一种细粒棘球绦虫成虫诊断蛋白基因及其医用用途
CN113372452A (zh) * 2021-06-08 2021-09-10 新疆医科大学 一种细粒棘球绦虫重组蛋白CTLA4-IgV-EgG1Y162及其应用
CN113372452B (zh) * 2021-06-08 2022-11-29 新疆医科大学 一种细粒棘球绦虫重组蛋白CTLA4-IgV-EgG1Y162及其应用
CN114196691A (zh) * 2021-12-28 2022-03-18 重庆澳龙生物制品有限公司 一种制备防治牛、羊棘球蚴病多表位重组疫苗的基因、蛋白质、疫苗和应用
CN114196691B (zh) * 2021-12-28 2023-08-11 重庆澳龙生物制品有限公司 一种制备防治牛、羊棘球蚴病多表位重组疫苗的基因、蛋白质、疫苗和应用

Also Published As

Publication number Publication date
WO2007101948A3 (fr) 2007-11-15
FR2898276B1 (fr) 2008-07-25
FR2898276A1 (fr) 2007-09-14

Similar Documents

Publication Publication Date Title
US8669355B2 (en) Vaccine
CA2862284C (fr) Proteines 28kda gst provenant de schistosomes pour leur utilisation dans le traitement des maladies inflammatoires auto-immunes engendrant une reponse de type th1 et/ou th17
WO1993015212A1 (fr) Mutant attenue de listeria monocytogenes; souche recombinante de listeria monocytogenes, utilisation comme vecteurs heterologues d'antigene vaccinal et utilisation comme vaccin ou composition diagnostique
JP2000502054A (ja) 治療用および診断用の組成物
CA2466937C (fr) Antigene mycobacterien recombinant de type hemagglutinine de liaison a l'heparine methylee, procedes de preparation et compositions immunogenes comprenant un tel antigene
US7674892B2 (en) Hsp70 from Arthrobacter
WO2007101948A2 (fr) Nouveaux vaccins destines au traitement ou a la prevention des infections par parasites de la famille des taenidae et en particulier du genre echinococcus
WO2018107083A2 (fr) Vaccins contre des bactéries aeromonas virulentes et méthodes associées
US7803924B2 (en) HSP60 from arthrobacter
WO2003102170A1 (fr) Souches de bordetella rendues deficientes par attenuation genetique
FR2736064A1 (fr) Epitopes protecteurs de l'adenyl cyclase-hemolysine(ac-hty). leur application au traitement ou a la prevention des infections par bordetella
FR2863499A1 (fr) Nouveaux vaccins destines au traitement ou a la prevention des infections par parasites de la famille echinococcus
WO2019008272A1 (fr) Nouvelles souches attenuees d'apicomplexes et leur utilisation comme vecteurs d'antigene pour la prevention de maladies infectieuses
EP1292333A1 (fr) Composition adjuvante comprenant la proteine fha ou un fragment de la proteine fha sous forme libre
FR3068364A1 (fr) Utilisation de souches de sarcocystidae comme vecteurs multirecombinants d'antigenes pour la prevention de maladies infectieuses
WO2010112707A1 (fr) Utilisation vaccinale d'un fragment d'adhesine de bartonella
WO2019008273A1 (fr) Utilisation de souches de sarcocystidae dans la prevention de maladies infectieuses de la volaille

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application
NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 07731114

Country of ref document: EP

Kind code of ref document: A2