WO2006099126A2 - Biomarkers for ovarian cancer and endometrial cancer: hepcidin - Google Patents

Biomarkers for ovarian cancer and endometrial cancer: hepcidin Download PDF

Info

Publication number
WO2006099126A2
WO2006099126A2 PCT/US2006/008578 US2006008578W WO2006099126A2 WO 2006099126 A2 WO2006099126 A2 WO 2006099126A2 US 2006008578 W US2006008578 W US 2006008578W WO 2006099126 A2 WO2006099126 A2 WO 2006099126A2
Authority
WO
WIPO (PCT)
Prior art keywords
hepcidin
biomarkers
ovarian cancer
biomarker
transthyretin
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2006/008578
Other languages
English (en)
French (fr)
Other versions
WO2006099126A3 (en
Inventor
Eric Thomas Fung
Robert Bast
Daniel W. Chan
Jin Song
Vladimir Podust
Zhen Zhang
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Johns Hopkins University
University of Texas System
Aspira Womens Health Inc
Original Assignee
Johns Hopkins University
Ciphergen Biosystems Inc
University of Texas System
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to CA2602088A priority Critical patent/CA2602088C/en
Priority to EP06737729.1A priority patent/EP1869462B1/en
Priority to NZ560976A priority patent/NZ560976A/en
Priority to AU2006223374A priority patent/AU2006223374B2/en
Priority to JP2008500963A priority patent/JP5069214B2/ja
Priority to KR1020077023307A priority patent/KR101310000B1/ko
Application filed by Johns Hopkins University, Ciphergen Biosystems Inc, University of Texas System filed Critical Johns Hopkins University
Priority to MX2007011024A priority patent/MX2007011024A/es
Publication of WO2006099126A2 publication Critical patent/WO2006099126A2/en
Publication of WO2006099126A3 publication Critical patent/WO2006099126A3/en
Priority to IL185496A priority patent/IL185496A/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53Immunoassay; Biospecific binding assay; Materials therefor
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/68Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
    • G01N33/6803General methods of protein analysis not limited to specific proteins or families of proteins
    • G01N33/6848Methods of protein analysis involving mass spectrometry
    • G01N33/6851Methods of protein analysis involving laser desorption ionisation mass spectrometry
    • AHUMAN NECESSITIES
    • A01AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01NPRESERVATION OF BODIES OF HUMANS OR ANIMALS OR PLANTS OR PARTS THEREOF; BIOCIDES, e.g. AS DISINFECTANTS, AS PESTICIDES OR AS HERBICIDES; PEST REPELLANTS OR ATTRACTANTS; PLANT GROWTH REGULATORS
    • A01N37/00Biocides, pest repellants or attractants, or plant growth regulators containing organic compounds containing a carbon atom having three bonds to hetero atoms with at the most two bonds to halogen, e.g. carboxylic acids
    • A01N37/18Biocides, pest repellants or attractants, or plant growth regulators containing organic compounds containing a carbon atom having three bonds to hetero atoms with at the most two bonds to halogen, e.g. carboxylic acids containing the group —CO—N<, e.g. carboxylic acid amides or imides; Thio analogues thereof
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/574Immunoassay; Biospecific binding assay; Materials therefor for cancer
    • G01N33/57407Specifically defined cancers
    • G01N33/57442Specifically defined cancers of the uterus and endometrial
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/574Immunoassay; Biospecific binding assay; Materials therefor for cancer
    • G01N33/57407Specifically defined cancers
    • G01N33/57449Specifically defined cancers of ovaries
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/68Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/74Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving hormones or other non-cytokine intercellular protein regulatory factors such as growth factors, including receptors to hormones and growth factors
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2500/00Screening for compounds of potential therapeutic value

Definitions

  • the invention relates generally to clinical diagnostics.
  • Ovarian cancer is among the most lethal gynecologic malignancies in developed countries. Annually in the United States alone, approximately 23,000 women are diagnosed with the disease and almost 14,000 women die from it. (Jamal, A., et al., CA Cancer J. Clin, 2002; 52:23-47). Despite progress in cancer therapy, ovarian cancer mortality has remained virtually unchanged over the past two decades. (Id.) Given the steep survival gradient relative to the stage at which the disease is diagnosed, early detection remains the most important factor in improving long-term survival of ovarian cancer patients.
  • CA125 The best-characterized tumor marker, CA125, is negative in approximately 30- 40% of stage I ovarian carcinomas and its levels are elevated in a variety of benign diseases.
  • Its use as a population-based screening tool for early detection and diagnosis of ovarian cancer is hindered by its low sensitivity and specificity.
  • hepcidin is a biomarker for ovarian cancer (invasive epithelial cancer). It has further been found that hepcidin is a biomarker that is differentially present in subjects having endometrial cancer. More particularly, it has been found that the hepcidin level in a biological sample is increased in ovarian cancer versus non-ovarian cancer and in endometrial cancer versus non-endometrial cancer. Put another way, elevated hepcidin levels are correlated with ovarian cancer and with endometrial cancer.
  • the disease statuses to be distinguished are: ovarian cancer versus benign ovarian disease; ovarian cancer versus benign gynecologic disease; ovarian cancer versus a gynecological condition selected from endometriosis, uterine fibroma, breast cancer and cervical cancer; ovarian versus other malignancy (e.g., breast cancer or colon cancer); stage I ovarian cancer versus non-ovarian cancer; and recurrence of ovarian cancer versus non-ovarian cancer. Based on the status determined, further procedures may be indicated, including additional diagnostic tests or therapeutic procedures or regimens.
  • hepcidin level when used in combination with the level of other biomarkers, the predictive power of the diagnostic test is improved. More specifically, increased levels of hepcidin and decreased levels transthyretin are correlated with ovarian cancer. Increased levels of hepcidin and decreased levels of transthyretin, together with levels of one or more of Apo Al (decreased level), transferrin (decreased level), CTAP-III (elevated level) and an internal fragment of ITIH4 (elevated level) also are . correlated with ovarian cancer.
  • the present invention provides methods for qualifying ovarian cancer status in a subject comprising measuring one or more biomarkers in a biological sample from the subject, wherein at least one biomarker is hepcidin, and correlating the measurement or measurements with an ovarian cancer status selected from ovarian cancer and non-ovarian cancer.
  • a plurality of biomarkers in the biological sample are measured, wherein the measured biomarkers further comprise transthyretin in addition to hepcidin.
  • a plurality of biomarkers in the biological sample are measured, wherein the measured biomarkers further comprise in addition to hepicidin at least one biomarker selected from the group consisting of: Apo Al, transferrin, CTAP-III and ITIH4 fragment.
  • a plurality of biomarkers in the biological sample are measured, wherein the measured biomarkers further comprise in addition to hepcidin at least two biomarkers selected from the group consisting of Apo Al, transferrin, CTAP-III and ITIH4 fragment.
  • a plurality of biomarkers in the biological sample are measured, wherein the measured biomarkers further comprise in addition to hepcidin at least three biomarkers selected from the group consisting of Apo Al, transferrin, CTAP-III and ITIH4 fragment.
  • a plurality of biomarkers are measured, and the measured biomarkers comprise ⁇ -2 microglobulin.
  • hepcidin may be hepcidin-25
  • transthyretin may be cysteinylated transthyretin
  • ITIH4 fragment may be ITIH4 fragment 1.
  • one or more biomarkers are measured by mass spectrometry.
  • the mass spectrometry suitably may be SELDI-MS.
  • one or more biomarkers are measured by immunoassay.
  • a variety of biological samples may be employed in methods of the invention, including e.g. where the biological sample comprises blood or a blood derivative, or where the biological sample comprises ovarian cyst fluid, ascites, or urine.
  • non-ovarian cancer is benign ovarian disease.
  • non-ovarian cancer is a gynecological condition such as benign ovarian cyst, endometriosis, uterine fibroma, breast cancer and cervical cancer.
  • the ovarian cancer is stage I or II ovarian cancer.
  • the subject has been treated for ovarian cancer and the ovarian cancer is recurrence of cancer.
  • methods for qualifying endometrial cancer status is a subject comprising (a) measuring one or more biomarkers in a biological sample from the subject, wherein at least one biomarker is hepcidin; and (b) correlating the measurement or measurements with endometrial cancer status.
  • the status is endometrial cancer versus non-cancer.
  • Methods of the invention may further comprises reporting the status to the subject, recording the status on a tangible medium, and/or managing subject treatment based on the status.
  • One or more biomarker may be after subject management and the measurement correlated with disease progression.
  • methods for determining the course of ovarian cancer comprising (a)measuring, at a first time, one or more biomarkers in a biological sample from the subject, wherein at least one biomarker is hepcidin; (b) measuring, at a second time, at least one biomarker in a biological sample from the subject; and (c) comparing the first measurement and the second measurement; wherein the comparative measurements determine the course of the ovarian cancer.
  • methods comprise measuring hepcidin and transthyretin in a sample from a subject.
  • such methods may further comprise measuring at least one of Apo Al, transferrin, CTAP-III and ITIH4 fragment in the sample.
  • the invention provides a kit that comprises (a) a solid support comprising at least one capture reagent attached thereto, wherein the capture reagent binds hepcidin; and (b) instructions for using the solid support to detect hepcidin.
  • the solid support may comprise e.g. a SELDI probe.
  • the kit also may optionally comprise a standard reference of hepcidin.
  • the invention provides a kit that comprises (a) at least one solid support comprising at least one capture reagent attached thereto, wherein the capture reagent binds or reagents bind hepcidin and transthyretin; and (b) instructions for using the solid support or supports to detect hepcidin and transthyretin.
  • the solid support may comprise e.g. a SELDI probe.
  • the kit also may optionally comprise a standard reference of hepcidin and transthyretin.
  • the invention provides a kit that comprises (a) at least one solid support comprising at least one capture reagent attached thereto, wherein the capture reagent or reagents bind hepcidin, transthyretin and at least one of Apo Al, transferrin, CTAP-III and ITIH4 fragment; and (b) instructions for using the solid support or supports to detect hepcidin, transthyretin and at least one of Apo Al, transferrin, CTAP-III and ITIH4 fragment.
  • the solid support may comprise e.g. a SELDI probe.
  • the kit also may optionally comprise a standard reference of hepcidin and transthyretin and at least one of Apo Al, transferrin, CTAP-III and ITIH4 fragment.
  • the invention further includes software products that comprise (a) code that accesses data attributed to a sample, the data comprising measurement of at least one biomarker in the sample, wherein at least one biomarker is hepcidin; and (b) code that executes a classification algorithm that classifies the ovarian cancer status of the sample as a function of the measurement.
  • the at least one biomarker further comprises transthyretin.
  • the at least one biomarker further comprises at least one biomarker selected from Apo Al, transferrin, CTAP-III and ITIH4 fragment.
  • the at least one biomarker further comprises ⁇ -microglobulin.
  • the invention also provides methods comprising communicating to a subject a diagnosis relating to ovarian cancer status determined from the correlation of at least one biomarker in a sample from the subject, wherein at least one biomarker is hepcidin.
  • the at least one biomarker further comprises transthyretin.
  • the diagnosis may be suitably communicated to the subject e.g. via a computer-generated medium.
  • the invention further provides methods for identifying a compound that interacts with hepcidin, wherein said method comprises a) contacting hepcidin with a test compound; and b) determining whether the test compound interacts with hepcidin.
  • FIG. 1 shows ROC curve analysis showing the power of the hepcidin peak at m/z 2789 has in differentiating ovarian cancer from healthy controls.
  • the AUC is 0.876 and is significantly greater than 0.5 with p-value ⁇ 0.0001.
  • FIG. 2 shows the sequences of various hepcidin fragments, including the four correlated fragments, hepcidin-25 (SEQ ID NO: 13), hepcidin-24 (SEQ ID NO: 14), hepcidin- 22 (SEQ ID NO: 16), and hepcidin-20 (SEQ ID NO: 18).
  • the 21 sequences are numbered SEQ ID NO: 1 through SEQ ID NO: 22 from top'to bottom.
  • FIG. 3 shows the SELDI spectrum of the serum sample after immunoprecipitation/pull-down using an antibody against ITIH4 fragment (m/z 3272). Peaks with rectangle labels are known fragments of ITIH4. The four discovered hepcidin variants are in this spectrum at approximate m/z locations 2191, 2436, 2673, and 2788 (indicated by arrows).
  • FIG. 4 shows ROC curve analysis showing the power of the hepcidin peak at m/z 2789 has in differentiating ovarian cancer from other cancers.
  • the AUC is 0.774 and is significantly greater than 0.5 with p-value ⁇ 0.0001.
  • FIG. 5 shows ROC curve analysis showing the power of the hepcidin peak for the two independent validation sets.
  • the AUCs are 0.756 and 0.772, both greater than 0.5 with p-value O.0001.
  • FIG. 6 shows a scatterplot of the five groups of samples in two of the four peaks representing hepcidin variants.
  • FIG. 7 shows a scatterplot of five groups of patients from an independent validation set using two of the hepcidin peaks. It shows that these peaks are lower in patients free of cancer and patients after treatment, and are higher in patients with ovarian cancer pretreatment, as well as in those with recurrent ovarian cancer.
  • the hepcidin level correlates with the tumor load.
  • FIG. 8 shows a scatterplot of five groups of patients from a second independent validation set using two of the hepcidin peaks. It shows that these peaks are lower in healthy controls and patients with benign diseases, and are higher in patients with ovarian cancer.
  • FIGS 9A-9G show SELDI mass spectra displaying various biomarkers mentioned herein.
  • FIG. 9A shows ITIH4 fragment 1 captured on an IMAC-50 biochip charged with copper.
  • FIG. 9B shows hepcidin-25 captured on an IMAC-50 biochip charged with copper.
  • FIG. 9C shows CTAP-III captured on an IMAC-50 biochip charged with copper.
  • FIG. 9D shows ⁇ 2 microglobulin captured on an IMAC-50 biochip charged with copper.
  • FIG. 9E shows transthyretin captured on a Q-IO biochip.
  • FIG. 9F shows Apo Al captured on an H50 biochip.
  • FIG. 9G shows transferrin captured on an IMAC-50 biochipcharged with copper.
  • FIG. 10 shows a close-up of a mass spectrum of forms of transthyretin in serum.
  • FIG. 11 shows ROC curve analysis showing the mini-assay of Example 4, which follows.
  • a biomarker is an organic biomolecule which is differentially present in a sample taken from a subject of one phenotypic status (e.g., having a disease) as compared with another phenotypic status (e.g., not having the disease).
  • a biomarker is differentially present between different phenotypic statuses if the mean or median expression level of the biomarker in the different groups is calculated to be statistically significant. Common tests for statistical significance include, among others, t-test, ANOVA, Kruskal-Wallis, Wilcoxon, Mann-Whitney and odds ratio.
  • Biomarkers, alone or in combination provide measures of relative risk that a subject belongs to one phenotypic status or another. As such, they are useful as markers for disease (diagnostics), therapeutic effectiveness of a drug (theranostics) and of drug toxicity.
  • Biomarkers of this invention were discovered using SELDI. Accordingly, they are characterized, in part, by their mass-to-charge ratio, the shape of the peak in a mass spectrum and their binding characteristics. These characteristics represent inherent characteristics of the biomolecule and not process limitations in the manner in which the biomolecule is discriminated.
  • Biomarkers of this invention are characterized in part by their mass-to-charge ratio.
  • the mass-to-charge ratio of each biomarker is provided herein.
  • a particular molecular marker designated, for example, as "M2789” has a measured mass-to-charge ratio of 2789 D.
  • the mass-to-charge ratios were determined from mass spectra generated on a Ciphergen Biosystems, Inc. PBS II mass spectrometer or a Ciphergen PCS 4000 mass spectrometer.
  • the PBS II is instrument has a mass accuracy of about +/- 0.15 percent. Additionally, the instrument has a mass resolution of about 400 to 1000 m/dm, where m is mass and dm is the mass spectral peak width at 0.5 peak height.
  • the PCS4000 instrument has a mass accuracy of about +/- 0.12 % raw data with an expected externally calibrated mass accuracy of 0.1% and internally calibrated mass accuracy of 0.01%. Additionally, the instrument has a mass resolution of about 1000 to 2000 m/dm, where m is mass and dm is the mass spectral peak width at 0.5 peak height. The mass-to-charge ratio of the biomarkers was determined using Biomarker Wizard 1 " 1 software (Ciphergen Biosystems, Inc.).
  • Biomarker Wizard assigns a mass-to-charge ratio to a biomarker by clustering the mass-to-charge ratios of the same peaks from all the spectra analyzed, as determined by the PBSII or PCS4000, taking the maximum and minimum mass-to-charge-ratio in the cluster, and dividing by two. Accordingly, the masses provided reflect these specifications.
  • Biomarkers of this invention are further characterized by the shape of their spectral peak in time-of-flight mass spectrometry. Mass spectra showing peaks representing the biomarkers are presented in the Figures.
  • Biomarkers of this invention also are characterized by their binding characteristics to adsorbent surfaces. The binding characteristics of each biomarker also are described herein.
  • Hepcidin was originally identified as a 25 amino acid peptide (hepcidin-25) in human plasma and urine, exhibiting antimicrobial activity.
  • the full-length hepcidin precursor is an 84 amino acid protein (SwissProt Accession No. P81172) comprising a signal sequence and a pro-region (see Kulaksiz, H. et al. (2004) Gut 53:735-743).
  • the hepcidin biomarkers of the present invention are derived from the C-terminus of the full-length hepcidin protein. Hepcidin is recognized by antibodies available from, e.g., U.S. Biological (catalog H2008-51) (www.usbio.net, Swampscott, MA).
  • Four different variants of hepcidin useful as biomarkers of this invention are characterized by calculated mass-to-charge ratios of 2789, 2673, 2436, and 2191.
  • Hepcidin was discovered to be a biomarker for ovarian and endometrial cancer using SELDI technology employing ProteinChip arrays from Ciphergen Biosystems, Inc. (Fremont, CA) ("Ciphergen"). More specifically, hepcidin levels can distinguish ovarian cancer from each of non-cancer, cervical cancer and benign ovarian disease. It also can distinguish between endometrial cancer and non-cancer. Urine and serum samples were collected from subjects diagnosed with ovarian cancer, endometrial cancer, cervical cancer and subjects diagnosed as normal or as having benign disease.
  • the samples were applied to SELDI biochips, with or without co-immunoprecipitation with the ITIH4 3272 m/z fragment (see International Publication Number WO 2004/099432), using an antibody raised against ITIH4 fragment 1 (discussed in more detail below), and spectra of polypeptides in the samples were generated by time-of-flight mass spectrometry on a Ciphergen PBSIIc or PCS4000 mass spectrometer. The spectra thus obtained were analyzed by Ciphergen Express"" Data Manager Software with Biomarker Wizard and Biomarker Pattern Software from Ciphergen Biosystems, Inc. The mass spectra for each group were subjected to scatter plot analysis. A Mann-Whitney test analysis was employed to compare ovarian cancer and control groups for each protein cluster in the scatter plot, and proteins were selected that differed significantly (p ⁇ 0.01) between the two groups. This method is described in more detail in the Example Section.
  • the "ProteinChip assay” column refers to chromatographic fraction in which the biomarker is found, the type of biochip to which the biomarker binds and the wash conditions, as per the Examples. In each case, the biomarkers each may be found using a variety of alternate ProteinChip assays.
  • the "theoretical mass” provides the expected mass based on amino acid sequence and modifications such as disulfide bonds.
  • amino acid sequences of hepcidin-25, -24, -22 and -20 are:
  • Hepcidin-25 (SEQ ID NO: 13): DTHFPICIFCCGCCHRSKCGMCCKT Hepcidin-24 (SEQ ID NO: 14): THFPICIFCCGCCHRSKCGMCCKT Hepcidin-22 (SEQ ID NO: 16): FPICIFCCGCCHRSKCGM CCKT Hepcidin-20 (SEQ ID NO: 18): ICIFCCGCCHRSKCGMCCKT
  • the biomarkers of this invention are further characterized by their binding properties on chromatographic surfaces.
  • Hepcidin binds to cation exchange adsorbents (e.g., the Ciphergen ® CMlO ProteinChip ® array) after washing with 100 mM sodium acetate at pH 4.
  • Hepcidin also binds to metal chelate adsorbents (e.g., the Ciphergen® IMAC-Cu 4+ ProteinChip® array) after washing with 100 mM sodium phosphate, 0.5 M NaCl, pH 7 or organic buffer. Hepcidin may be visualized in the same assay as used to visualize ITIH4, as described below.
  • Hepcidin is urine or serum. Hepcidin may also be detected in ascites fluid and cyst fluid, tissues and organs such as liver, and in specific cells, such as macrophages.
  • Transthyretin also called “pre-albumin” is another biomarker that is useful in the methods of the present invention. Transthyretin and variants thereof are described as biomarkers for ovarian cancer in US patent publication 2005-0059013 Al and International Patent Publication WO 2005/098447. Unmodified transthyretin is a 127 amino acid protein deriving from a 147 amino acid precursor (SwissProt Accession No. P02766). The transthyretin biomarkers of the present invention include any or all of unmodified transthyretin and various modified forms. Transthyretin is recognized by antibodies available from, e.g., Dako (catalog A0002) fwww.dako.com, Glostrup, Denmark).
  • transthyretin appears as a cluster of peaks around 13.9K Daltons. This cluster includes several forms of transthyretin including unmodified transthyretin, S-sulfonated transthyretin, S-cysteinylated transthyretin, S-Gly-Cys transthyretin and S-glutathionylated transthryetin. Any and/or all of these is useful as a biomarker for ovarian cancer. However, the S-cysteinylated version represents the dominant form in the spectrum and is a preferred biomarker when using mass spectrometry. Another variant of transthyretin useful as a biomarker is transthyretin ⁇ N10. Specific transthyretin biomarkers thus discovered are presented in Table 2.
  • apolipoprotein Al also referred to as Apo Al .
  • Apo Al is described as a biomarker for ovarian cancer in US patent publication 2005-0059013 Al and International Patent Publication WO 2005/098447.
  • Apo Al is a 243 amino acid protein derived from a 267 amino acid precursor (SwissProt Accession No. P02647).
  • Apo Al is recognized by antibodies available from, e.g., EMD Biosciences, Inc. (catalog 178474) (www.emdbiosciences.com/home.asp, San Diego, CA). Specific Apo Al biomarkers are presented in Table 3. ApoAl can be visualized on H50 arrays or IMAC30 or IMAC50 arrays, but is preferentially visualized on H50 arrays.
  • Preferred methods of the present invention include the use of modified forms of Apo Al .
  • Modification of Apo Al may include the post-translational addition of various chemical groups, for example, glycosylation and lipidation.
  • Transferrrin is described as a biomarker for ovarian cancer in US patent- publication 2005-0214760 Al.
  • Transferrrin is a 679 amino acid protein derived from a 698 amino acid precursor (GenBank Accession No. NP_001054 GI:4557871 ; SwissProt Accesion No. P02787).
  • Transferrrin is recognized by antibodies available from, e.g., Dako (catalog A006) (www.dako.com, Glostrup, Denmark). Transferrin is glycosylated. Therefore, the measured molecular weight is higher than the theoretical weight, which does not take glycosylation into account. Specific transferrin biomarkers are presented in Table 4. TABLE 4
  • CTAP- III connective tissue activating peptide III
  • CTAP-III is described as a biomarker for ovarian cancer in US provisional patent application 60/693,324, filed June 22, 2005 (Zhang et al.).
  • CTAP-III is an 85 amino acid protein (SwissProt P02775).
  • CTAP-III is recognized by antibodies available from, e.g., Chemicon International (catalog 1484P) (www.chemicon.com, Temecula, CA.)
  • CTAP-III is a fragment of platelet basic protein and includes amino acids 44-128 of platelet basic protein. The specific CTAP-III biomarker is presented in Table 5.
  • ITIH4 fragments are described as biomarkers for ovarian cancer in US patent publication 2005-0059013 Al, International Patent Publication WO 2005/098447 and Fung et al., Int. J. Cancer 115:783-789 (2005). ITIH4 fragments can be selected from the group consisting of ITIH4 fragment no. 1, ITIH4 fragment no. 2, and ITIH4 fragment no. 3. Specific. ITIH4 internal fragment biomarkers are presented in Table 6.
  • ITIH4 fragment 1 SEQ ID NO: 23
  • MNFRPGVLS SRQLGLPGPPDVPDHAAYHPF ITIH4 fragment 2
  • PGVLSSRQLGLPGPPDVPDHAAYHPF ITIH4 fragment 3
  • ITIH4 precursor is a 930 amino acid protein (SwissProt Q14624).
  • ITIH4 fragment 1 spans amino acids 658-687 of human ITIH4 precursor.
  • ITIH4 fragment 2 spans amino acids 662-687 of ITIH4 precursor.
  • ITIH4 fragment 3 spans amino acids 663-687 of ITIH4 precursor.
  • preferred methods of the present invention include the use of modified forms of ITIH4 fragment.
  • Modification of ITIH4 fragment may include the post- translational addition of various chemical groups, for example, glycosylation, lipidation, cysteinylation, and glutathionylation.
  • /32- microglobulin Another biomarker that is useful in the methods of the present invention is /32- microglobulin.
  • ⁇ -microglobulin is described as a biomarker for ovarian cancer in US provisional patent publication 60/693,679, filed June 24, 2005 (Fung et al.).
  • /32- microglobulin is a 99 amino acid protein derived from an 119 amino acid precursor (GL179318; SwissProt Accession No. P61769).
  • 02-microglobulin is recognized by antibodies available from, e.g., Abeam (catalog AB759) (www.abcam.com, Cambridge, MA). Specific / ⁇ -microglobulin biomarkers are presented in Table 7.
  • Pre-translational modified forms include allelic variants, splice variants and RNA editing forms.
  • Post- translationally modified forms include forms resulting from proteolytic cleavage (e.g., fragments of a parent protein), glycosylation, phosphorylation, lipidation, oxidation, methylation, cysteinylation, sulphonation and acetylation.
  • an immunoassay using a monoclonal antibody will detect all forms of a protein containing the eptiope and will not distinguish between them.
  • a sandwich immunoassay that uses two antibodies directed against different epitopes on a protein will detect all forms of the protein that contain both epitopes and will not detect those forms that contain only one of the epitopes.
  • the inability to distinguish different forms of a protein has little impact when the forms detected by the particular method used are equally good biomarkers as any particular form.
  • the power of the assay may suffer.
  • Mass spectrometry is a particularly powerful methodology to resolve different forms of a protein because the different forms typically have different masses that can be resolved by mass spectrometry.
  • mass spectrometry may be able to specifically detect and measure the useful form where traditional immunoassay fails to distinguish the forms and fails to specifically detect to useful biomarker.
  • a biosepcific capture reagent e.g., an antibody, aptamer or Affibody that recognizes the biomarker and other forms of it
  • a biospecific capture reagent is bound to a solid phase, such as a bead, a plate, a membrane or a chip. After unbound materials are washed away, the captured analytes are detected and/or measured by mass spectrometry.
  • the step of "measuring hepcidin” includes measuring hepcidin by means that do not differentiate between various forms of the protein (e.g., certain immunoassays) as well as by means that differentiate some forms from other forms or that measure a specific form of the protein (e.g., any and/or all of hepcidin-25, hepcidin-24, hepcidin-22 and hepcidin-20, individually or in combination).
  • measuring hepcidin-25 means measuring hepcidin-25 in a way that distinguishes it from other forms of hepcidin, e.g., hepcidin-24, hepcidin-22 and hepcidin-20.
  • measuring transthyretin includes measuring any and/or all forms of transthyretin found in a subject test sample, individually or in combination
  • measuring cysteinlyated transthyretin means measuring transthryetin in a way that allows one to distinguish cysteinylated transthyretin from other forms of transthyretin found in a patient sample, e.g., transthyretin ⁇ N10, unmodified transthyretin, glutathionylated transthryetin, sulfonated transthryetin, etc.
  • Measured transthyretin means measuring any individual or combination of unmodified transthyretin, sulfonated transthryetin, cysteinylated transthyretin, CysGly modified transthyretin and glutathionylated transthryetin.
  • the biomarkers of this invention can be detected by any suitable method.
  • Detection paradigms include optical methods, electrochemical methods (voltametry and amperometry techniques), atomic force microscopy, and radio frequency methods, e.g., multipolar resonance spectroscopy.
  • Illustrative of optical methods, in addition to microscopy, both confocal and non-confocal, are detection of fluorescence, luminescence, chemiluminescence, absorbance, reflectance, transmittance, and birefringence or refractive index (e.g., surface plasmon resonance, ellipsometry, a resonant mirror method, a grating coupler waveguide method or interferometry).
  • a sample is analyzed by means of a biochip.
  • a biochip generally comprises a solid substrate having a substantially planar surface, to which a capture reagent (also called an adsorbent or affinity reagent) is attached.
  • a capture reagent also called an adsorbent or affinity reagent
  • the surface of a biochip comprises a plurality of addressable locations, each of which has the capture reagent bound there.
  • Protein biochips are biochips adapted for the capture of polypeptides. Many protein biochips are described in the art. These include, for example, protein biochips produced by Ciphergen Biosystems, Inc. (Fremont, CA), Zyomyx (Hayward, CA), Invitrogen (Carlsbad, CA), Biacore (Uppsala, Sweden) and Procognia (Berkshire, UK). Examples of such protein biochips are described in the following patents or published patent applications: U.S. Patent No. 6,225,047 (Hutchens & Yip); U.S. Patent No. 6,537,749 (Kuimelis and Wagner); U.S. Patent No.
  • the biomarkers of this invention are detected by mass spectrometry, a method that employs a mass spectrometer to detect gas phase ions.
  • mass spectrometers are time-of-flight, magnetic sector, quadrupole filter, ion trap, ion cyclotron resonance, electrostatic sector analyzer and hybrids of these.
  • the mass spectrometer is a laser desorption/ionization mass spectrometer.
  • the analytes are placed on the surface of a mass spectrometry probe, a device adapted to engage a probe interface of the mass spectrometer and to present an analyte to ionizing energy for ionization and introduction into a mass spectrometer.
  • a laser desorption mass spectrometer employs laser energy, typically from an ultraviolet laser, but also from an infrared laser, to desorb analytes from a surface, to volatilize and ionize them and make them available to the ion optics of the mass spectrometer.
  • the analyis of proteins by LDI can take the form of MALDI or of SELDI
  • a preferred mass spectrometric technique for use in the invention is "Surface Enhanced Laser Desorption and Ionization" or "SELDI," as described, for example, in U.S. Patents No. 5,719,060 and No. 6,225,047, both to Hutchens and Yip.
  • This refers to a method of desorption/ionization gas phase ion spectrometry (e.g., mass spectrometry) in which an analyte (here, one or more of the biomarkers) is captured on the surface of a SELDI mass spectrometry probe.
  • SELDI also has been called is called “affinity capture mass spectrometry” or “Surface-Enhanced Affinity Capture” (“SEAC”).
  • SELC Surface-Enhanced Affinity Capture
  • This version involves the use of probes that have a material on the probe surface that captures analytes through a non-covalent affinity interaction (adsorption) between the material and the analyte.
  • the material is variously called an “adsorbent,” a “capture reagent,” an “affinity reagent” or a “binding moiety.”
  • Such probes can be referred to as “affinity capture probes” and as having an “adsorbent surface.”
  • the capture reagent can be any material capable of binding an analyte.
  • the capture reagent is attached to the probe surface by physisorption or chemisorption.
  • the probes have the capture reagent already attached to the surface.
  • the probes are pre-activated and include a reactive moiety that is capable of binding the capture reagent, e.g., through a reaction forming a covalent or coordinate covalent bond.
  • Epoxide and acyl-imidizole are useful reactive moieties to covalently bind polypeptide capture reagents such as antibodies or cellular receptors.
  • Nitrilotriacetic acid and iminodiacetic acid are useful reactive moieties that function as chelating agents to bind metal ions that interact non-covalently with histidine containing peptides.
  • Adsorbents are generally classified as chromatographic adsorbents and biospecific adsorbents.
  • Chromatographic adsorbent refers to an adsorbent material typically used in chromatography.
  • Chromatographic adsorbents include, for example, ion exchange materials, metal chelators (e.g., nitrilotriacetic acid or iminodiacetic acid), immobilized metal chelates, hydrophobic interaction adsorbents, hydrophilic interaction adsorbents, dyes, simple biomolecules (e.g., nucleotides, amino acids, simple sugars and fatty acids) and mixed mode adsorbents (e.g., hydrophobic attraction/electrostatic repulsion adsorbents).
  • metal chelators e.g., nitrilotriacetic acid or iminodiacetic acid
  • immobilized metal chelates e.g., immobilized metal chelates
  • hydrophobic interaction adsorbents e.g., hydrophilic interaction adsorbents
  • dyes
  • Biospecif ⁇ c adsorbent refers to an adsorbent comprising a biomolecule, e.g., a nucleic acid molecule (e.g., an aptamer), a polypeptide, a polysaccharide, a lipid, a steroid or a conjugate of these (e.g., a glycoprotein, a lipoprotein, a glycolipid, a nucleic acid (e.g., DNA)-protein conjugate).
  • the biospecific adsorbent can be a macromolecular structure such as a multiprotein complex, a biological membrane or a virus. Examples of biospecif ⁇ c adsorbents are antibodies, receptor proteins and nucleic acids.
  • Biospecific adsorbents typically have higher specificity for a target analyte than chromatographic adsorbents. Further examples of adsorbents for use in SELDI can be found in U.S. Patent No. 6,225,047.
  • a "bioselective adsorbent” refers to an adsorbent that binds to an analyte with an affinity of at least 10 "8 M.
  • Ciphergen Biosystems, Inc. comprise surfaces having chromatographic or biospecif ⁇ c adsorbents attached thereto at addressable locations.
  • Ciphergen ProteinChip ® arrays include NP20 (hydrophilic); H4 and H50 (hydrophobic); SAX-2, Q-10 and (anion exchange); WCX-2 and CM-10 (cation exchange); IMAC-3, IMAC- 30 and IMAC-50 (metal chelate); and PS-IO, PS-20 (reactive surface with acyl-imidizole, epoxide) and PG-20 (protein G coupled through acyl-imidizole).
  • Hydrophobic ProteinChip arrays have isopropyl or nonylphenoxy-poly(ethylene glycol)methacrylate functionalities.
  • Anion exchange ProteinChip arrays have quaternary ammonium functionalities.
  • Cation exchange ProteinChip arrays have carboxylate functionalities.
  • Immobilized metal chelate ProteinChip arrays have nitrilotriacetic acid functionalities (IMAC 3 and IMAC 30) or O- methacryloyl-N,N-bis-carboxymethyl tyrosine funtionalities (IMAC 50) that adsorb transition metal ions, such as copper, nickel, zinc, and gallium, by chelation.
  • Preactivated ProteinChip arrays have acyl-imidizole or epoxide functional groups that can react with groups on proteins for covalent binding.
  • WO 03/040700 Um et al, "Hydrophobic Surface Chip,” May 15, 2003
  • U.S. Patent Publication No. US 2003-0218130 Al Boschetti et al, "Biochips With Surfaces Coated With Polysaccharide-Based Hydrogels," April 14, 2003
  • U.S. Patent Publication No. U.S. 2005-059086 Al Huang et al., "Photocrosslinked Hydrogel Blend Surface Coatings," March 17, 2005.
  • a probe with an adsorbent surface is contacted with the sample for a period of time sufficient to allow the biomarker or biomarkers that may be present in the sample to bind to the adsorbent. After an incubation period, the substrate is washed to remove unbound material. Any suitable washing solutions can be used; preferably, aqueous solutions are employed. The extent to which molecules remain bound can be manipulated by adjusting the stringency of the wash. The elution characteristics of a wash solution can depend, for example, on pH, ionic strength, hydrophobicity, degree of chaotropism, detergent strength, and temperature. Unless the probe has both SEAC and SEND properties (as described herein), an energy absorbing molecule then is applied to the substrate with the bound biomarkers.
  • the biomarkers bound to the substrates are detected in a gas phase ion spectrometer such as a time-of-flight mass spectrometer.
  • the biomarkers are ionized by an ionization source such as a laser, the generated ions are collected by an ion optic assembly, and then a mass analyzer disperses and analyzes the passing ions.
  • the detector then translates information of the detected ions into mass-to-charge ratios. Detection of a biomarker typically will involve detection of signal intensity. Thus, both the quantity and mass of the biomarker can be determined.
  • SEND Surface-Enhanced Neat Desorption
  • SEND probe The phrase “energy absorbing molecules” (EAM) denotes molecules that are capable of absorbing energy from a laser desorption/ionization source and, thereafter, contribute to desorption and ionization of analyte molecules in contact therewith.
  • the EAM category includes molecules used in MALDI, frequently referred to as "matrix,” and is exemplified by cinnamic acid derivatives, sinapinic acid (SPA), cyano-hydroxy-cinnamic acid (CHCA) and dihydroxybenzoic acid, ferulic acid, and hydroxyaceto-phenone derivatives.
  • the energy absorbing molecule is incorporated into a linear or cross-linked polymer, e.g., a polymethacrylate.
  • the composition can be a co-polymer of ⁇ - cyano-4-methacryloyloxycinnamic acid and acrylate.
  • the composition is a co-polymer of ⁇ -cyano-4-methacryloyloxycinnamic acid, acrylate and 3-(tri- ethoxy)silyl propyl methacrylate.
  • the composition is a co-polymer of ⁇ -cyano-4-methacryloyloxycinnamic acid and octadecylmethacrylate ("Cl 8 SEND"). SEND is further described in U.S. Patent No. 6,124,137 and PCT International Publication No. WO 03/64594 (Kitagawa, "Monomers And Polymers Having Energy Absorbing Moieties Of Use In Desorption/ionization Of Analytes," August 7, 2003).
  • SEAC/SEND is a version of laser desorption mass spectrometry in which both a capture reagent and an energy absorbing molecule are attached to the sample presenting surface. SEAC/SEND probes therefore allow the capture of analytes through affinity capture and ionization/desorption without the need to apply external matrix.
  • the Cl 8 SEND biochip is a version of SEAC/SEND, comprising a Cl 8 moiety which functions as a capture reagent, and a CHCA moiety which functions as an energy absorbing moiety.
  • SEPAR Surface-Enhanced Photolabile Attachment and Release
  • SEPAR involves the use of probes having moieties attached to the surface that can covalently bind an analyte, and then release the analyte through breaking a photolabile bond in the moiety after exposure to light, e.g., to laser light (see, U.S. Patent No. 5,719,060).
  • SEPAR and other forms of SELDI are readily adapted to detecting a biomarker or biomarker profile, pursuant to the present invention.
  • MALDI is a traditional method of laser desorption/ionization used to analyte biomolecules such as proteins and nucleic acids.
  • the sample is mixed with matrix and deposited directly on a MALDI chip.
  • biospecific e.g., an antibody
  • chromatographic materials coupled to a solid support such as a resin (e.g., in a spin column).
  • affinity materials that bind the biomarkers of this invention are described above. After purification on the affinity material, the biomarkers are eluted and then detected by MALDI.
  • the biomarkers are detected by LC-MS or LC-LC-MS. This involves resolving the proteins in a sample by one or two passes through liquid chromatography, followed by mass spectrometry analysis, typically electrospray ionization.
  • Time-of-flight mass spectrometry generates a time-of- flight spectrum.
  • the time-of-flight spectrum ultimately analyzed typically does not represent the signal from a single pulse of ionizing energy against a sample, but rather the sum of signals from a number of pulses. This reduces noise and increases dynamic range.
  • This time-of-flight data is then subject to data processing.
  • data processing typically includes TOF-to-M/Z transformation to generate a mass spectrum, baseline subtraction to eliminate instrument offsets and high frequency noise filtering to reduce high frequency noise.
  • Data generated by desorption and detection of biomarkers can be analyzed with the use of a programmable digital computer.
  • the computer program analyzes the data to indicate the number of biomarkers detected, and optionally the strength of the signal and the determined molecular mass for each biomarker detected.
  • Data analysis can include steps of determining signal strength of a biomarker and removing data deviating from a predetermined statistical distribution. For example, the observed peaks can be normalized, by calculating the height of each peak relative to some reference.
  • the computer can transform the resulting data into various formats for display.
  • the standard spectrum can be displayed, but in one useful format only the peak height and mass information are retained from the spectrum view, yielding a cleaner image and enabling biomarkers with nearly identical molecular weights to be more easily seen.
  • two or more spectra are compared, conveniently highlighting unique biomarkers and biomarkers that are up- or down-regulated between samples. Using any of these formats, one can readily determine whether a particular biomarker is present in a sample.
  • Analysis generally involves the identification of peaks in the spectrum that represent signal from an analyte.
  • Peak selection can be done visually, but software is available, as part of Ciphergen's ProteinChip® software package, that can automate the detection of peaks.
  • this software functions by identifying signals having a signal- to-noise ratio above a selected threshold and labeling the mass of the peak at the centroid of the peak signal.
  • many spectra are compared to identify identical peaks present in some selected percentage of the mass spectra.
  • One version of this software clusters all peaks appearing in the various spectra within a defined mass range, and assigns a mass (M/Z) to all the peaks that are near the mid-point of the mass (MJT) cluster.
  • Software used to analyze the data can include code that applies an algorithm to the analysis of the signal to determine whether the signal represents a peak in a signal that corresponds to a biomarker according to the present invention.
  • the software also can subject the data regarding observed biomarker peaks to classification tree or ANN analysis, to determine whether a biomarker peak or combination of biomarker peaks is present that indicates the status of the particular clinical parameter under examination. Analysis of the data may be "keyed" to a variety of parameters that are obtained, either directly or indirectly, from the mass spectrometric analysis of the sample.
  • These parameters include, but are not limited to, the presence or absence of one or more peaks, the shape of a peak or group of peaks, the height of one or more peaks, the log of the height of one or more peaks, and other arithmetic manipulations of peak height data.
  • a preferred protocol for the detection of the biomarkers of this invention is as follows.
  • the biological sample to be tested e.g., serum
  • preferably is subject to pre- fractionation before SELDI analysis. This simplifies the sample and improves sensitivity.
  • a preferred method of pre-fractionation involves contacting the sample with an anion exchange chromatographic material, such as Q HyperD (BioSepra, SA).
  • Q HyperD BioSepra, SA
  • the bound materials are then subject to stepwise pH elution using buffers at pH 9, pH 7, pH 5 and pH 4. (The fractions in which the biomarkers are eluted also is indicated in Table 1.)
  • Various fractions containing the biomarker are collected.
  • the sample to be tested (preferably pre-fractionated) is then contacted with an affinity capture probe comprising an cation exchange adsorbent (preferably a CMlO ProteinChip array (Ciphergen Biosystems, Inc.)) or an IMAC adsorbent (preferably an IMAC30 ProteinChip array (Ciphergen Biosystems, Inc.)), again as indicated in Table 1.
  • an affinity capture probe comprising an cation exchange adsorbent (preferably a CMlO ProteinChip array (Ciphergen Biosystems, Inc.)) or an IMAC adsorbent (preferably an IMAC30 ProteinChip array (Ciphergen Biosystems, Inc.)), again as indicated in Table 1.
  • the probe is washed with a buffer that will retain the biomarker while washing away unbound molecules.
  • a suitable wash for each biomarker is the buffer identified in Table 1.
  • the biomarkers are detected by laser desorption/ionization mass spectrometry.
  • samples may be diluted, with or without denaturing, in the appropriate array binding buffer and bound and washed under conditions optimized for detecting each analyte.
  • Denature serum add 7.5 ul 9M urea 2% CHAPS 5OmM Tris HCl pH9 to 5 ul of human serum, and mix at room temperature for 20min. Dilute 1 :400 with a solution containing: H50 buffer (10% acetonitrile, 0.1% TFA), and 0.12 mg/ml E. coli lysate.
  • H50 arrays wash each well of the BioProcessor with 50% acetonitrile per well. Incubate at room temp for 5 min. Remove solution. Equilibrate with 150 ⁇ l H50 wash buffer (10% acetonitrile/0.1% TFA) two times for 5 minutes each. Remove buffer.
  • Sample dilution 1 :250 dilution of serum sample in a solution containing: 10OmM Sodium Phosphate buffer, pH 7.0 (PB buffer) with addition of 0.05 mg/ml E. coli lysate. Mix well.
  • Sample dilution 1:50 dilution of serum sample in IMAC binding/washing buffer (5OmM Na phosphate 0.25M NaCl pH 6.0). Mix well.
  • IMAC50 arrays add 5OmM CuSO4 per well in a BioProcessor. Incubate at room temp for 10 min. Remove copper solution. Wash with water 4 times. Equilibrate IMAC50 arrays twice with the binding buffer.
  • biomarker antibodies that recognize the biomarker are available, for example from Dako, U.S. Biological, Chemicon, Abeam and Genway. These can be attached to the surface of a probe, such as a pre-activated PSlO or PS20 ProteinChip array (Ciphergen Biosystems, Inc.). These antibodies can capture the biomarkers from a sample onto the probe surface. Then the biomarkers can be detected by, e.g., laser desorption/ionization mass spectrometry.
  • a probe such as a pre-activated PSlO or PS20 ProteinChip array (Ciphergen Biosystems, Inc.). These antibodies can capture the biomarkers from a sample onto the probe surface. Then the biomarkers can be detected by, e.g., laser desorption/ionization mass spectrometry.
  • Any robot that performs fluidics operations can be used in these assays, for example, those available from Hewlett Packard and Hamilton.
  • the biomarkers of the invention are measured by a method other than mass spectrometry or other than methods that rely on a measurement of the mass of the biomarker.
  • the biomarkers of this invention are measured by immunoassay.
  • Immunoassay requires biospecif ⁇ c capture reagents, such as antibodies, to capture the biomarkers.
  • Antibodies can be produced by methods well known in the art, e.g., by immunizing animals with the biomarkers. Biomarkers can be isolated from samples based on their binding characteristics. Alternatively, if the amino acid sequence of a polypeptide biomarker is known, the polypeptide can be synthesized and used to generate antibodies by methods well known in the art.
  • This invention contemplates traditional immunoassays including, for example, sandwich immunoassays including ELISA or fluorescence-based immunoassays, as well as other enzyme immunoassays.
  • Nephelometry is an assay done in liquid phase, in which antibodies are in solution. Binding of the antigen to the antibody results in changes in absorbance, which is measured.
  • SELDI-based immunoassay a biospecific capture reagent for the biomarker is attached to the surface of an MS probe, such as a pre-activated ProteinChip array. The biomarker is then specifically captured on the biochip through this reagent, and the captured biomarker is detected by mass spectrometry.
  • the biomarkers of the invention can be used in diagnostic tests to assess ovarian cancer status in a subject, e.g., to diagnose ovarian cancer.
  • ovarian cancer status includes any distinguishable manifestation of the disease, including non-disease.
  • ovarian cancer status includes, without limitation, the presence or absence of disease (e.g., ovarian cancer v. non-ovarian cancer), the risk of developing disease, the stage of the disease, the progression of disease (e.g., progress of disease or remission of disease over time) and the effectiveness or response to treatment of disease.
  • the correlation of test results with ovarian cancer status involves applying a classification algorithm of some kind to the results to generate the status.
  • the classification algorithm may be as simple as determining whether or not the amount of hepcidin measured is above or below a particular cut-off number.
  • the classification algorithm may be a linear regression formula.
  • the classification algorithm may be the product of any of a number of learning algorithms described herein.
  • the power of a diagnostic test to correctly predict status is commonly measured as the sensitivity of the assay, the specificity of the assay or the area under a receiver operated characteristic ("ROC") curve.
  • Sensitivity is the percentage of true positives that are predicted by a test to be positive, while specificity is the percentage of true negatives that are predicted by a test to be negative.
  • An ROC curve provides the sensitivity of a test as a function of 1- specificity. The greater the area under the ROC curve, the more powerful the predictive value of the test. Other useful measures of the utility of a test are positive predictive value and negative predictive value. Positive predictive value is the percentage of people who test positive that are actually positive. Negative predictive value is the percentage of people who test negative that are actually negative.
  • the biomarkers of this invention show a statistical difference in different ovarian cancer statuses. Diagnostic tests that use these biomarkers alone or in combination show a sensitivity and specificity of at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98% and about 100%.
  • Each biomarker listed in Table 1 is differentially present in ovarian cancer, and, therefore, each is individually useful in aiding in the determination of ovarian cancer status.
  • the method involves, first, measuring the selected biomarker in a subject sample using the methods described herein, e.g., capture on a SELDI biochip followed by detection by mass spectrometry and, second, comparing the measurement with a diagnostic amount or cut-off that distinguishes a positive ovarian cancer status from a negative ovarian cancer status.
  • the diagnostic amount represents a measured amount of a biomarker above which or below which a subject is classified as having a particular ovarian cancer status.
  • a measured amount of hepcidin above the diagnostic cutoff provides a diagnosis of ovarian cancer.
  • the particular diagnostic cut-off can be determined, for example, by measuring the amount of the biomarker in a statistically significant number of samples from subjects with the different ovarian cancer statuses, as was done here, and drawing the cut-off to suit the diagnostician's desired levels of specificity and sensitivity.
  • biomarkers While individual biomarkers are useful diagnostic biomarkers, it has been found that a combination of biomarkers can provide greater predictive value of a particular status than single biomarkers alone. Specifically, the detection of a plurality of biomarkers in a sample can increase the sensitivity and/or specificity of the test. A combination of at least two biomarkers is sometimes referred to as a "biomarker profile" or “biomarker fingerprint.” Accordingly, hepcidin can be combined with other biomarkers for ovarian or endometrial cancer to improve the sensitivity and/or specificity of the diagnostic test.
  • a diagnostic test for ovarian cancer status involving the measurement of both hepcidin and transthyretin has greater predictive power than the measurement of hepcidin alone. As indicated, hepcidin levels are increased in ovarian cancer and transthyretin levels are decreased. It further has been found that a diagnostic test combining at least three biomarkers or, in certain instances, seven biomarkers, provides greater predictive power than the measurement of both hepcidin and transthyretin.
  • a diagnostic test for ovarian cancer status will include measuring hepcidin, transthyretin and at least one of Apo Al, transferrin, CTAP-III and ITIH4 fragment, and correlating these measurements with ovarian cancer status. It is also contemplated that /32-microglobulin could be combined with hepcidin and transthyretin, along with any of the four aforementioned biomarkers.
  • the diagnosis of ovarian cancer typically involves the measurement of CA125, as increased levels of this marker are correlated with ovarian cancer. Therefore, levels of CAl 25 can be correlated with any combination of the above markers in determining ovarian cancer status.
  • biomarkers with which hepcidin can be combined include, but are not limited to, CA125, CA125 II, CA15-3, CA19-9, CA72-4, CA 195, tumor associated trypsin inhibitor (TATI), CEA, placental alkaline phosphatase (PLAP), Sialyl TN, galactosyltransferase, macrophage colony stimulating factor (M-CSF, CSF-I), lysophosphatidic acid (LPA), 110 kD component of the extracellular domain of the epidermal growth factor receptor (pi 1 OEGFR), tissue kallikreins, e.g., kallikrein 6 and kallikrein 10 (NES-I), prostasin, HE4, creatine kinase B (CKB), LASA, HER-2/neu, urinary gonadotropin peptide, Dianon NB 70/K, Tissue peptide antigen (TPA), osteopontin, and haptoglobin
  • TATI
  • Determining ovarian cancer status typically involves classifying an individual into one of two or more groups (statuses) based on the results of the diagnostic test.
  • the diagnostic tests described herein can be used to classify between a number of different states.
  • this invention provides methods for determining the presence or absence of ovarian cancer in a subject (status: ovarian cancer v. non-ovarian cancer).
  • the presence or absence of ovarian cancer is determined by measuring the relevant biomarker or biomarkers and then either submitting them to a classification algorithm or comparing them with a reference amount and/or pattern of biomarkers that is associated with the particular risk level.
  • this invention provides methods for determining the risk of developing ovarian cancer in a subject (status: low-risk v. high risk).
  • Biomarker amounts or patterns are characteristic of various risk states, e.g., high, medium or low.
  • the risk of developing a disease is determined by measuring the relevant biomarker or biomarkers and then either submitting them to a classification algorithm or comparing them with a reference amount and/or pattern of biomarkers that is associated with the particular risk level
  • this invention provides methods for determining the stage of disease in a subject.
  • Each stage of the disease has a characteristic amount of a biomarker or relative amounts of a set of biomarkers (a pattern).
  • the stage of a disease is determined by measuring the relevant biomarker or biomarkers and then either submitting them to a classification algorithm or comparing them with a reference amount and/or pattern of biomarkers that is associated with the particular stage. For example, one can classify between early stage ovarian cancer and non-ovarian cancer or among stage I ovarian cancer, stage II ovarian cancer and stage III ovarian cancer.
  • this invention provides methods for determining the course of disease in a subject.
  • Disease course refers to changes in disease status over time, including disease progression (worsening) and disease regression (improvement). Over time, the amounts or relative amounts (e.g., the pattern) of the biomarkers changes. For example, hepcidin is increased with disease, while transthryetin is decreased in disease. Therefore, the trend of these markers, either increased or decreased over time toward diseased or non- diseased indicates the course of the disease.
  • this method involves measuring one or more biomarkers in a subject for at least two different time points, e.g., a first time and a second time, and comparing the change in amounts, if any. The course of disease is determined based on these comparisons. 5.4. Reporting the Status
  • Additional embodiments of the invention relate to the communication of assay results or diagnoses or both to technicians, physicians or patients, for example.
  • computers will be used to communicate assay results or diagnoses or both to interested parties, e.g., physicians and their patients.
  • the assays will be performed or the assay results analyzed in a country or jurisdiction which differs from the country or jurisdiction to which the results or diagnoses are communicated.
  • a diagnosis based on the differential presence in a test subject of any the biomarkers of Table 1 is communicated to the subject as soon as possible after the diagnosis is obtained.
  • the diagnosis may be communicated to the subject by the subject's treating physician.
  • the diagnosis may be sent to a test subject by email or communicated to the subject by phone.
  • a computer may be used to communicate the diagnosis by email or phone.
  • the message containing results of a diagnostic test may be generated and delivered automatically to the subject using a combination of computer hardware and software which will be familiar to artisans skilled in telecommunications.
  • a healthcare-oriented communications system is described in U.S.
  • Patent Number 6,283,761 the present invention is not limited to methods which utilize this particular communications system.
  • all or some of the method steps, including the assaying of samples, diagnosing of diseases, and communicating of assay results or diagnoses maybe carried out in diverse (e.g., foreign) jurisdictions.
  • the methods further comprise managing subject treatment based on the status.
  • Such management includes the actions of the physician or clinician subsequent to determining ovarian cancer status. For example, if a physician makes a diagnosis of ovarian cancer, then a certain regime of treatment, such as prescription or administration of chemotherapy might follow. Alternatively, a diagnosis of non-ovarian cancer or non-ovarian cancer might be followed with further testing to determine a specific disease that might the patient might be suffering from. Also, if the diagnostic test gives an inconclusive result on ovarian cancer status, further tests may be called for. 6. GENERATION OF CLASSIFICATION ALGORITHMS FOR QUALIFYING OVARIAN CANCER STATUS
  • data derived from the spectra e.g., mass spectra or time- of-flight spectra
  • samples such as "known samples”
  • a "known sample” is a sample that has been pre-classif ⁇ ed.
  • the data that are derived from the spectra and are used to form the classification model can be referred to as a "training data set.”
  • the classification model can recognize patterns in data derived from spectra generated using unknown samples.
  • the classification model can then be used to classify the unknown samples into classes. This can be useful, for example, in predicting whether or not a particular biological sample is associated with a certain biological condition (e.g., diseased versus non-diseased).
  • the training data set that is used to form the classification model may comprise raw data or pre-processed data.
  • raw data can be obtained directly from time-of-flight spectra or mass spectra, and then may be optionally "pre-processed" as described above.
  • Classification models can be formed using any suitable statistical classification (or "learning") method that attempts to segregate bodies of data into classes based on objective parameters present in the data.
  • Classification methods may be either supervised or unsupervised. Examples of supervised and unsupervised classification processes are described in Jain, "Statistical Pattern Recognition: A Review", IEEE Transactions on Pattern Analysis and Machine Intelligence, Vol. 22, No. 1, January 2000, the teachings of which are incorporated by reference.
  • supervised classification training data containing examples of known categories are presented to a learning mechanism, which learns one or more sets of relationships that define each of the known classes. New data may then be applied to the learning mechanism, which then classifies the new data using the learned relationships.
  • supervised classification processes include linear regression processes (e.g., multiple linear regression (MLR), partial least squares (PLS) regression and principal components regression (PCR)), binary decision trees (e.g., recursive partitioning processes such as CART - classification and regression trees), artificial neural networks such as back propagation networks, discriminant analyses (e.g., Bayesian classifier or Fischer analysis), logistic classifiers, and support vector classifiers (support vector machines).
  • linear regression processes e.g., multiple linear regression (MLR), partial least squares (PLS) regression and principal components regression (PCR)
  • binary decision trees e.g., recursive partitioning processes such as CART - classification and regression trees
  • artificial neural networks such as back propagation networks
  • discriminant analyses e.g.,
  • a preferred supervised classification method is a recursive partitioning process.
  • Recursive partitioning processes use recursive partitioning trees to classify spectra derived from unknown samples. Further details about recursive partitioning processes are provided in U.S. Patent 6,675,104 (Paulse et al, "Method for analyzing mass spectra").
  • the classification models that are created can be formed using unsupervised learning methods.
  • Unsupervised classification attempts to learn classifications based on similarities in the training data set, without pre-classifying the spectra from which the training data set was derived.
  • Unsupervised learning methods include cluster analyses. A cluster analysis attempts to divide the data into "clusters" or groups that ideally should have members that are very similar to each other, and very dissimilar to members of other clusters. Similarity is then measured using some distance metric, which measures the distance between data items, and clusters together data items that are closer to each other.
  • Clustering techniques include the MacQueen's K-means algorithm and the Kohonen's Self- Organizing Map algorithm.
  • the classification models can be formed on and used on any suitable digital computer.
  • Suitable digital computers include micro, mini, or large computers using any standard or specialized operating system, such as a Unix, WindowsTM or LinuxTM based operating system.
  • the digital computer that is used may be physically separate from the mass spectrometer that is used to create the spectra of interest, or it may be coupled to the mass spectrometer.
  • the training data set and the classification models according to embodiments of the invention can be embodied by computer code that is executed or used by a digital computer.
  • the computer code can be stored on any suitable computer readable media including optical or magnetic disks, sticks, tapes, etc., and can be written in any suitable computer programming language including C, C++, visual basic, etc.
  • the learning algorithms described above are useful both for developing classification algorithms for the biomarkers already discovered, or for finding new biomarkers for ovarian cancer.
  • the classification algorithms form the base for diagnostic tests by providing diagnostic values (e.g., cut-off points) for biomarkers used singly or in combination.
  • a logistical regression analysis was performed on data generated from the experiments described in Example 4, below (smaller sample set).
  • the analysis generated a classification algorithm to distinguish ovarian cancer from non-ovarian cancer based on seven biomarkers: hepcidin, ITIH4 fragment 1, CTAP-III, transthyretin, transferrin, beta-2 microglobulin and Apo-Al .
  • the algorithm involved two steps. In the first step a number was generated from a test sample based on the following formula:
  • the measurements represented either normalized peak intensity or analyte concentration (designated "cone”).
  • Cone normalized peak intensity or analyte concentration
  • the probability that a sample came from a subject having ovarian cancer was determined by the formula: ⁇ 85 V(I+ e Loglt ).
  • a cut-off is then applied based on the desired sensitivity or specificity of the test. The higher the cut-off number, the better the sensitivity of the assay. The specific numbers used in this assay depend upon the assay conditions and instrument used, and need to be re-calibrated whenever an assay is set up.
  • this invention provides compositions of matter based on the biomarkers of this invention.
  • this invention provides biomarkers of this invention in purified form.
  • Purified biomarkers have utility as antigens to raise antibodies.
  • Purified biomarkers also have utility as standards in assay procedures.
  • a "purified biomarker” is a biomarker that has been isolated from other proteins and peptdies, and/or other material from the biological sample in which the biomarker is found.
  • the biomarkers can be isolated from biological fluids, such as urine or serum. Biomarkers may be purified using any method known in the art, including, but not limited to, mechanical separation (e.g., centrifugation), ammonium sulphate precipitation, dialysis (including size-exclusion dialysis), electrophoresis (e.g.
  • acrylamide gel electrophoresis size-exclusion chromatography, affinity chromatography, anion-exchange chromatography, cation-exchange chromatography, and methal-chelate chromatography.
  • Such methods may be performed at any appropriate scale, for example, in a chromatography column, or on a biochip.
  • this invention provides a biospecific capture reagent, optionally in purified form, that specifically binds a biomarker of this invention.
  • the biospecific capture reagent is an antibody.
  • Such compositions are useful for detecting the biomarker in a detection assay, e.g., for diagnostics.
  • this invention provides an article comprising a biospecific capture reagent that binds a biomarker of this invention, wherein the reagent is bound to a solid phase.
  • this invention contemplates a device comprising bead, chip, membrane, monolith or microtiter plate derivatized with the biospecific capture reagent. Such articles are useful in biomarker detection assays.
  • this invention provides a composition
  • a biospecific capture reagent such as an antibody
  • a biomarker of this invention the composition optionally being in purified form.
  • Such compositions are useful for purifying the biomarker or in assays for detecting the biomarker.
  • this invention provides an article comprising a solid substrate to which is attached an adsorbent, e.g., a chromatographic adsorbent or a biospecific capture reagent, to which is further bound a biomarker of this invention.
  • the article is a biochip or a probe for mass spectrometry, e.g., a SELDI probe.
  • Such articles are useful for purifying the biomarker or detecting the biomarker.
  • kits for qualifying ovarian cancer status which kits are used to detect biomarkers according to the invention.
  • the kit comprises a solid support, such as a chip, a microtiter plate or a bead or resin having a capture reagent attached thereon, wherein the capture reagent binds a biomarker of the invention.
  • the kits of the present invention can comprise mass spectrometry probes for SELDI, such as ProteinChip ® arrays.
  • the kit can comprise a solid support with a reactive surface, and a container comprising the biospecific capture reagent.
  • the kit can also comprise a washing solution or instructions for making a washing solution, in which the combination of the capture reagent and the washing solution allows capture of the biomarker or biomarkers on the solid support for subsequent detection by, e.g., mass spectrometry.
  • the kit may include more than type of adsorbent, each present on a different solid support.
  • such a kit can comprise instructions for suitable operational parameters in the form of a label or separate insert.
  • the instructions may inform a consumer about how to collect the sample, how to wash the probe or the particular biomarkers to be detected.
  • the kit can comprise one or more containers with biomarker samples, to be used as standard(s) for calibration.
  • this invention provides methods for determining the therapeutic efficacy of a pharmaceutical drug. These methods are useful in performing clinical trials of the drug, as well as monitoring the progress of a patient on the drug. Therapy or clinical trials involve administering the drug in a particular regimen. The regimen may involve a single dose of the drug or multiple doses of the drug over time. The doctor or clinical researcher monitors the effect of the drug on the patient or subject over the course of administration. If the drug has a pharmacological impact on the condition, the amounts or relative amounts (e.g., the pattern or profile) of the biomarkers of this invention changes toward a non-disease profile. For example, hepcidin is increased with disease, while transthyretin is decreased in disease.
  • this method involves measuring one or more biomarkers in a subject receiving drug therapy, and correlating the amounts of the biomarkers with the disease status of the subject.
  • One embodiment of this method involves determining the levels of the biomarkers for at least two different time points during a course of drug therapy, e.g., a first time and a second time, and comparing the change in amounts of the biomarkers, if any.
  • the biomarkers can be measured before and after drug administration or at two different time points during drug administration. The effect of therapy is determined based on these comparisons.
  • biomarkers will trend toward normal, while if treatment is ineffective, the biomarkers will trend toward disease indications. If a treatment is effective, then the biomarkers will trend toward normal, while if treatment is ineffective, the biomarkers will trend toward disease indications.
  • BIOMARKERS FOR OVARIAN CANCER ENf SCREENING ASSAYS AND METHODS OF TREATING OVARIAN CANCER
  • the biomarkers can be used to screen for compounds that modulate the expression of the biomarkers in vitro or in vivo, which compounds in turn may be useful in treating or preventing ovarian cancer in patients.
  • the biomarkers can be used to monitor the response to treatments for ovarian cancer.
  • the biomarkers can be used in heredity studies to determine if the subject is at risk for developing ovarian cancer.
  • Compounds suitable for therapeutic testing may be screened initially by identifying compounds which interact with hepcidin and one or more biomarkers listed herein.
  • screening might include recombinantly expressing a biomarker, purifying the biomarker, and affixing the biomarker to a substrate.
  • Test compounds would then be contacted with the substrate, typically in aqueous conditions, and interactions between the test compound and the biomarker are measured, for example, by measuring elution rates as a function of salt concentration.
  • Certain proteins may recognize and cleave one or more biomarkers of Table I, in which case the proteins may be detected by monitoring the digestion of one or more biomarkers in a standard assay, e.g., by gel electrophoresis of the proteins.
  • the ability of a test compound to inhibit the activity of one or more of the biomarkers may be measured.
  • One of skill in the art will recognize that the techniques used to measure the activity of a particular biomarker will vary depending on the function and properties of the biomarker. For example, an enzymatic activity of a biomarker may be assayed provided that an appropriate substrate is available and provided that the concentration of the substrate or the appearance of the reaction product is readily measurable.
  • the ability of potentially therapeutic test compounds to inhibit or enhance the activity of a given biomarker may be determined by measuring the rates of catalysis in the presence or absence of the test compounds.
  • test compounds to interfere with a non-enzymatic (e.g., structural) function or activity of hepcidin or another one or more of the biomarkers herein may also be measured.
  • a non-enzymatic function or activity of hepcidin or another one or more of the biomarkers herein may also be measured.
  • the self-assembly of a multi-protein complex which includes hepcidin may be monitored by spectroscopy in the presence or absence of a test compound.
  • test compounds which interfere with the ability of the biomarker to enhance transcription may be identified by measuring the levels of biomarker-dependent transcription in vivo or in vitro in the presence and absence of the test compound.
  • Test compounds capable of modulating the activity of any of the biomarkers of Table I may be administered to patients who are suffering from or are at risk of developing ovarian cancer or other cancer.
  • the administration of a test compound which increases the activity of a particular biomarker may decrease the risk of ovarian cancer in a patient if the activity of the particular biomarker in vivo prevents the accumulation of proteins for ovarian cancer.
  • the administration of a test compound which decreases the activity of a particular biomarker may decrease the risk of ovarian cancer in a patient if the increased activity of the biomarker is responsible, at least in part, for the onset of ovarian cancer.
  • the invention provides a method for identifying compounds useful for the treatment of disorders such as ovarian cancer which are associated with increased levels of modified forms of hepcidin.
  • cell extracts or expression libraries may be screened for compounds which catalyze the cleavage of full-length hepcidin to form truncated forms of hepcidin.
  • cleavage of hepcidin may be detected by attaching a fluorophore to hepcidin which remains quenched when hepcidin is uncleaved but which fluoresces when the protein is cleaved.
  • hepcidin modified so as to render the amide bond between amino acids x and y uncleavable may be used to selectively bind or "trap" the cellular protesase which cleaves full-length hepcidin at that site in vivo.
  • Methods for screening and identifying proteases and their targets are well-documented in the scientific literature, e.g., in Lopez-Ottin et al. (Nature Reviews, 3:509-519 (2002)).
  • the invention provides a method for treating or reducing the progression or likelihood of a disease, e.g., ovarian cancer, which is associated with the increased levels of truncated hepcidin.
  • a disease e.g., ovarian cancer
  • combinatorial libraries may be screened for compounds which inhibit the cleavage activity of the identified proteins. Methods of screening chemical libraries for such compounds are well-known in art. See, e.g., Lopez-Otin et al. (2002).
  • inhibitory compounds may be intelligently designed based on the structure of hepcidin.
  • hepcidin Full-length hepcidin is believed to be involved in regulation of the body's iron stores, as well as in hereditary hemochromatosis, chronic renal insufficiency, and renal anemia. Hepcidin expression is also induced as part of the body's immune response via the interleuking cascade. Because hepcidin is highly processed from its pre-pro and pro- forms, it is likely that there are proteases which target and cleave it. Therefore, in a further embodiment, the invention provides methods for identifying compounds which increase the affinity of truncated hepcidin for its target proteases. For example, compounds may be screened for their ability to cleave hepcidin.
  • Test compounds capable of modulating the cleavage of hepcidin or the activity of molecules which interact with hepcidin may then be tested in vivo for their ability to slow or stop the progression of ovarian and/or endometrial cancer in a subject.
  • screening a test compound includes obtaining samples from test subjects before and after the subjects have been exposed to a test compound.
  • the levels in the samples of one or more of the biomarkers listed in Table I may be measured and analyzed to determine whether the levels of the biomarkers change after exposure to a test compound.
  • the samples may be analyzed by mass spectrometry, as described herein, or the samples may be analyzed by any appropriate means known to one of skill in the art.
  • the levels of one or more of the biomarkers listed in Table I may be measured directly by Western blot using radio- or fluorescently-labeled antibodies which specifically bind to the biomarkers.
  • changes in the levels of mRNA encoding the one or more biomarkers may be measured and correlated with the administration of a given test compound to a subject.
  • the changes in the level of expression of one or more of the biomarkers may be measured using in vitro methods and materials.
  • human tissue cultured cells which express, or are capable of expressing, one or more of the biomarkers of Table I may be contacted with test compounds.
  • Subjects who have been treated with test compounds will be routinely examined for any physiological effects which may result from the treatment.
  • the test compounds will be evaluated for their ability to decrease disease likelihood in a subject.
  • test compounds will be screened for their ability to slow or stop the progression of the disease. 11.
  • Samples Serum and urine samples were acquired from the MDACC Ovarian cancer sample bank (MD Anderson). The samples had been collected from cancer patients pre-operatively from years 2000 to 2004 and stored at -8O 0 C. Sample distribution was as follows: ovarian cancer (OvCa), 200; endometrial cancer, 50; cervical cancer, 50 and benign, 50. Many, but not all, of the OvCa and benign serum and urine samples were from the same patient. The samples were run in two sets. The first set comprised the 200 ovarian cancer samples and 50 benign samples. This provided an initial list of candidate biomarkers. To test the tumor-type specificity of these candidate biomarkers, a subset (50) of ovarian cancer samples, along with the 50 benign samples, and the 50 endometrial and 50 cervical cancer samples were analyzed.
  • Serum profiling was performed only on the ovarian cancer and benign samples. Randomized templates containing the samples to be profiled were generated using the Ciphergen Express software program. Samples from the tumor bank were thawed on ice, added to a 96 well plate (following the template for arrangement), and centrifuged for 20 minutes at 4000 rpm. Aliquots of the serum were then put into fresh 96 well plates and stored at -8O 0 C until use. Serum samples were profiled on IMAC-Cu 1+ and on QlO (see protocol below) on triplicate ProteinChip Arrays. All replicates were prepared on the same day and were read on a PBSIIc (beginning the morning following preparation) and/or a PCS4000 (beginning a few days after preparation). Arrays were processed with sample using a Biomek 2000 robot.
  • binding buffer 50 mM sodium phosphate buffer, 250 mM NaCl, pH 6.0
  • IMAC arrays were pre- activated by adding 50 ⁇ l of 50 mM CuSO 4 per well and incubated at RmT for 10 minutes without shaking. The arrays were washed with 150 ⁇ l/spot of water by mixing up and down once, then washed with 50 ⁇ l of 50 mM NaAc pH 4 per spot, and incubated at RmT for 5 minutes without shaking. They were then washed with 150 ⁇ l water/spot twice, by mixing up and down once each time.
  • IMAC30 chips were equilibrated twice with binding buffer. The chips were incubated for 5 minutes each without shaking. 50 ⁇ l of 1 :200 diluted serum sample was added to each well and incubate dat RmT for 120 minutes without shaking. The chips were washed three times with 150 ⁇ l of binding buffer per well and then "sip and spit" mixed three times, without shaking. The chips were washed with 150 ⁇ l of water twice with three mixing cycles, and the bioprocessor reservoir was then removed. The water was aspirated off, and the chips were air dried for ten minutes. One ⁇ l of SPA matrix (12.5 mg/ml) in 50% acetonitrile / 0.5% TFA water was added per spot, and the chips were air dried for 10 minutes. The application was repeated, and the chips were air dried overnight.
  • Q-10 Serum profiling Protocol The samples were diluted into binding buffer. Sample dilution: 1 :250 patient serum sample dilution in 100 mM Phosphate buffer (PB), pH 7.0. The QlO chips were pretreated twice with 150 ⁇ l of 100 mM PB, pH 7.0, and incubated five minutes without shaking. 50 ⁇ l of 1 :250 diluted patient sample was added in each well. The chips were spun at 900 rpm for 45 seconds in a centrifuge and incubated 120 minutes at RmT without shaking. The chips were washed four times with 150 ⁇ l of 100 mM PB, pH 7 per well, and three "sip and spit" mixes, without shaking for each wash.
  • PB Phosphate buffer
  • the chips were washed with 150 ⁇ l of water one time with three mixing cycles.
  • the bioprocessor reservoir was removed, the water was removed, and the chips were air dried for ten minutes.
  • One ⁇ l of SPA matrix (12.5mg/ml) in 50% acetonitrile / 0.5% TFA water was added per spot, and the chips were air dried for 10 minutes. The application was repeated, and the chips were air dried overnight.
  • Urine profiling was performed on both the initial set (200 ovarian cancer samples and 50 benign samples) as well as the second set (50 each ovarian cancer, benign, endometrial cancer, and cervical cancer). Samples from the tumor bank were thawed on ice, added to a 96 well plate (following the above mentioned template for arrangement), and centrifuged for 20 minutes at 4000 rpm (urine had not been centrifuged prior to initial freezing and storage in the sample bank). Aliquots of the urine were then put into fresh 96 well plates and stored at -8O 0 C until use. Two runs of urine profiling were conducted. In the first run, only OvCa and benign samples were used.
  • CMlO Urine profiling Protocol 15 ⁇ L of urine sample were added to 23 ⁇ L of denaturing buffer (9 M urea/2% CHAPS) and ncubated for 30 min at 4°C. 263 ⁇ l of binding buffer (BB), 10OmM Sodium Acetate pH 4, was added to each denatured sample and mixed well. The chip surface was prepared with two five-minute BB washes. The buffer was removed, and 150 ⁇ l of the diluted urine sample was added to each well and incubated at RT with shaking for 30 minutes. The sample was removed and replaced with a fresh 125 ⁇ l of the same diluted sample on the appropriate spot, and then incubated at RT with shaking for 30 minutes.
  • BB binding buffer
  • 10OmM Sodium Acetate pH 4 10OmM Sodium Acetate pH 4
  • the sample was removed, and the chip was washed with thee five-minute BB washes.
  • the buffer was removed, and the chip was washed with water quickly (no incubation) two times.
  • the bioprocessor reservoir was removed, and the chip was air dried.
  • One ⁇ l of SPA matrix (12.5mg/ml) in 50% acetonitrile / 0.5% TFA water was added per spot, and the chip was air day for 10 minutes. The application was repeated, and the chips were air dried overnight.
  • IMAC_Cu ++ Urine profiling Protocol 15 ⁇ L of urine sample were added to 23 ⁇ L of denaturing buffer (9M urea/2% CHAPS). The samples were incubated for 30 minutes at 4 0 C. 263 ul of binding buffer (BB), 100 mM Sodium Phosphate + 0.5 M NaCl pH 7, were added to each denatured sample and mixed well. The IMAC chips were prepared with copper by adding 50 ul of 50 mM CuSO 4 per well and incubated at RmT for 10 minutes.
  • BB binding buffer
  • the IMAC chips were prepared with copper by adding 50 ul of 50 mM CuSO 4 per well and incubated at RmT for 10 minutes.
  • the chips were washed with 150 ul/spot of water once for two minutes and incubated with 50 ul of 50 mM NaAc pH4 per spot for five minuntes, then washed with water using 150 ul/spot water once for two minutes. The water was removed, and the IMAC30 chips were equilibrated twice for five minutes with binding buffer BB. The buffer was removed, and 150 ul diluted urine sample was added. The chips were incubated at RT with shaking for 30 minutes. The sample was removed and replaced with a fresh 125 ul of the same diluted sample on the appropriate spot, and the chips were incubated at RT with shaking for 30 minutes. The sample was removed, and the chips were washed with BB three times for five minutes.
  • the buffer was removed, and the chips were washed quickly with water twice (no incubation).
  • the bioprocessor reservoir was removed, and the chips were air dried.
  • One ul of SPA matrix (12.5mg/ml) in 50% acetonitrile / 0.5% TFA water was added per spot, and the chips were air dried for 10 minutes. The application was repeated, and the chips were air dried overnight.
  • CiphergenExpress software Data were acquired using CiphergenExpress software. Mass calibration was performed using external calibrants, intensity normalization was based on total ion current using an external normalization factor, and baseline subtraction was performed. Peak detection was performed in CiphergenExpress software using the criteria that a peak must have a signal/noise ratio of 3: 1 and be present in 20% of the spectra. Statistical analysis was performed in CiphergenExpress software using the Mann-Whitney test (for two groups, e.g. benign versus ovarian cancer) or Kruskal-Wallis test (for multiple group comparison, e.g. benign versus ovarian cancer vs endometrial cancer).
  • Results The data from the analysis of urine samples (200 ovarian cancer and 50 benign disease) were analyzed first.
  • Table 2 Peaks from with p ⁇ .05 using the Mann-Whitney test, when comparing benign versus ovarian cancer.
  • An AUC > 0.5 indicates that the peak is greater in the ovarian cancer group than in the benign group, while an AUC ⁇ 0.5 indicates that the peak is lower in the ovarian cancer group than in the benign group.
  • Table 3 Peaks with p ⁇ 05 for the respective comparisons. Ovarian and endometrial cancer specific markers are defined as peaks with p values ⁇ .O5 for the comparisons versus benign disease and cervical cancer.
  • Urine samples were acquired from the MDACC Ovarian cancer sample bank. The samples had been collected from cancer patients pre- operatively from years 2000 to 2004 and stored at -80oC. Sample distribution was as follows: ovarian cancer (OvCa), 200; endometrial cancer, 50; cervical cancer, 50 and benign, 50. The samples were run in two sets. Experiment #1: The first set comprised the 200 ovarian cancer samples and 50 benign samples. This provided an initial list of candidate biomarkers. Samples profiled on both CMlO and IMAC-Cu.
  • Experiment #2 To test the tumor-type specificity of these candidate biomarkers, a subset (50) of ovarian cancer samples, along with the 50 benign samples, and the 50 endometrial and 50 cervical cancer samples were analyzed. Samples profiled on both CMlO and IMAC-Cu.
  • the NP20 chip with 2789 Da on it were treated with SPA (Ciphergen C300-0002) and loaded onto a MicroMass Q-TOF which was equipped with a ProteinChip Interface (Ciphergen Z200-0003).
  • Ions were created using a pulsed nitrogen laser (Laser Science Inc. VSL 337 NDS, Franklin, MA) operated at 30 pulses per second delivering an average pulse fluence of 130 mJ/mm 2 .
  • Nitrogen gas, at 10 millitorr of pressure, was used for collisional cooling of formed ions and argon was used as collision gas for all low energy collision- induced dissociation experiments.
  • the previously described CHCA matrix system was used for tandem analysis of the acid hydrolysis products.
  • a total of 178 archived serum specimens were collected at the Johns Hopkins Medical Institutions with institutional approval.
  • the sample set included specimens from 40 healthy women (age, mean ⁇ SD, 42 ⁇ 7 years), 40 patients with stage IILTV (23/17 cases) ovarian cancer (age, mean ⁇ SD, 56 ⁇ 14 years), groups of 19 patients each with stage O/MI/III (3/5/8/3 cases) breast (age, mean ⁇ SD, 54 ⁇ 15 years) or stage I/II/III (1/10/8 cases) colon cancers (age, mean ⁇ SD, 69 ⁇ 16 years), and groups of 20 patients each with stage I/II/III (1/12/7 cases) prostate (age, mean ⁇ SD, 58 ⁇ 8 years), stage II/III (4/16 cases) pancreatic cancers (age, mean ⁇ SD, 66 ⁇ 8 years), or diabetes (age, mean ⁇ SD, 52 ⁇ 18 years).
  • 7.5 mg of rabbit anti-ITIH4 antibody (custom made antibody specific against MNFRPGVLSSRQLGLPGPPDVPDHAAYHPF (SEQ ID NO: 26)) was linked to 12.5 ml of AminoLink® coupling bead (Pierce P/N 20501B).
  • 70 ul serum sample were diluted with 630 ul of PBS pH 7.2 with 0.05% Tween and loaded onto 70 ul of anti-ITIH4 beads. After incubation at 4 0 C overnight, the beads were washed with 1 ml of PBS + 0.1% Tween buffer three times followed by 1 ml of water wash once.
  • the beads were then eluted with 50 ul of organic elution (33.3% isopropanol/ 16.7% acetonitrile/ 0.1% trifluroacetic acid) three times.
  • Flow through and three PBS washes along with organic eluents were profiled onto IMAC30- copper ProteinChip arrays (Ciphergen C553-0078) using a PBS II ProteinChip reader.
  • the 2789 Da protein was present in the flow through as well as all three PBS and organic eluents.
  • the flow through fraction from the IP was loaded onto YMlO membrane (Millipore 42407) and 50 ul of flow through fraction from YMlO was profiled on IMAC 30 copper (Ciphergen C553-0078) arrays
  • the IMAC30-copper arrays were treated with SPA (Ciphergen C300-
  • Ions were created using a pulsed nitrogen Laser, Laser Science Inc. VSL 337 NDS, (Franklin, Massachusetts) operated at 30 pulses per second delivering an average pulse fluence of 130 mJ/mm 2 .
  • Nitrogen gas at 10 millitorr of pressure, was used for collisional cooling of formed ions and argon was used as collision gas for all low energy collision- induced dissociation experiments.
  • the previously described CHCA matrix system was used for tandem analysis of the acid hydrolysis products. Applied collision energy general followed the rule of 50 eV/kD, and each acquisition was typically the sum of five-minute of spectra. For MS and MS/MS modes, the system was externally calibrated using a mixture of known peptides. The CID spectrum was smoothed and centroided and exported as a sequest file. Protein identification was carried out using Matrix Science Mascot Program (available on line at http://www.matrixscience.com).
  • CMlO chips were treated with SPA (Ciphergen C300-0002) and load onto Q-TOF which was equipped with Ciphergen Interface (Ciphergen Z200-0003) for tandem mass spectrometry.
  • spectra were acquired on a Micromass QTOF II tandem mass spectrometer equipped with a Ciphergen (Fremont, CA) ProteinChip Array interface (ProteinChip Qq-TOF). Ions were created using a pulsed nitrogen Laser, Laser Science Inc. VSL 337 NDS (Franklin, Massachusetts) operated at 30 pulses per second delivering an average pulse fiuence of 130 mJ/mrn 2 .
  • Nitrogen gas at 10 millitorr of pressure, was used for collisional cooling of formed ions and argon was used as collision gas for all low energy collision-induced dissociation experiments.
  • the previously described CHCA matrix system was used for tandem analysis of the acid hydrolysis products. Applied collision energy general followed the rule of 50 eV/kD, and each acquisition was typically the sum of five-minute of spectra. For MS and MS/MS modes, the system was externally calibrated using a mixture of known peptides. The CID spectrum was smoothed and centroided and exported as a sequest file. Protein identification was carried out using Matrix Science Mascot Program (available online at http://www.matrixscience.com).
  • ITIH4 inter-alpha trypsin inhibitor heavy chain 4
  • the first analysis was done using a panel of 142 serum samples (41 with ovarian cancer, 41 healthy controls, and 20 each with breast, colorectal, and prostate cancers). Expression data were generated in triplicate through immunoprecipitation/puU-down using a polyclonal antibody generated against the ITIH4 3272 m/z fragment, followed by surface- enhanced laser desorption/ionization mass spectrometry. For validation, samples from two additional sites were similarly processed. The first set consisted of 114 ovarian cancer samples (16 pretreatment, 17 post-treatment, 37 cancer-free monitoring cases, and 30 recurrent cases). The second set had 11 ovarian cancer cases, 16 benign cases, and 30 healthy controls.
  • FIG. 1 shows the sequences of various hepcidin fragments, including the four correlated fragments, hepcidin-25, hepcidin-24, hepcidin-22, and hepcidin-20.
  • the AUC was 0.722 (0.693-0.851) in separating ovarian cancer from benign and healthy controls (for both validation sets, all triplicates were included in the analysis; see Figure 5). Preliminary results indicated that hepcidin and I ⁇ H4 fragment are binding partners.
  • FIG 3 shows the SELDI spectrum of the serum sample after immunoprecipitation/pull-down using the antibody against ITIH4 fragment.
  • Correlation network analysis showed that the four peaks (m/z 2191, 2436, and 2788) are highly correlated among themselves and inversely correlated with the group of ITIH4 fragments in serum samples from ovarian cancer patients. The correlation is not as strong among healthy controls. Similar correlation network analysis was performed between ovarian cancer, prostate cancer, breast cancer, and healthy controls. The strongest correlation among the four peaks was the one with ovarian cancer.
  • Figure 6 shows a scatterplot of the five groups of samples in two of the four peaks representing hepcidin variants.
  • Figure 7 shows a scatterplot of five groups of patients from an independent validation set using two of the hepcidin peaks. It shows that these peaks are lower in patients free of cancer and patients after treatment, and are higher in patients with ovarian cancer pretreatment, as well as in those with recurrent ovarian cancer.
  • the hepcidin level correlates with the tumor load.
  • Figure 8 shows a scatterplot of five groups of patients from a second independent validation set using two of the hepcidin peaks. It shows that these peaks are lower in healthy controls and patients with benign diseases, and are higher in patients with ovarian cancer.
  • the median and quartiles of CA125 for benign, early stage, and late or unknown stage were 26/11/57 IU, 80/22/434 IU, and 34/40/1114 IU, respectively.
  • the biomarkers were assessed individually using the Mann-Whitney U Test. A linear composite index was derived in an unsupervised fashion using data from one site and then calculated for the remaining data using the fixed formula. ROC curve analyses were performed on data from individual sites and all sites combined. All seven biomarkers individually demonstrated statistically significant differentiating power, and the majority had p-value ⁇ 0.00001. AUCs of the composite index in ROC analyses for the six sites were 0.602, 0.566, 0.821, 0.813, and 0.592 in detecting cancer at all stages from benign.
  • the index did better at the high- sensitivity range.
  • the specificity of the index was 34% (77/226) compared to CA125 at 26% (42/163).
  • the specificity of the index was 24% (55/226) compared to CA125 at 14%% (22/163).
  • Pre-operative serum samples from 202 consecutive patients being evaluated for ovarian pathology were aliquotted, and frozen within six hours of collection.
  • the serum samples were evaluated using a SELDI-TOF-MS proteomics assay for the seven marker panel.
  • 126 samples were used to train a model and the remaining samples were used for blinded testing.
  • 132 had benign disease (including endometriosis, benign pelvic cyst, uterine fibromas), 11 had borderline tumors, 50 had invasive epithelial ovarian cancer, 3 had germ cell tumors, and the remaining had metastatic non-gynecologic cancers.
  • the median age in the benign disease group was 48.3 years (range 20-84), and 65.1 years (range 40-89) in the invasive ovarian cancer group.
  • Pre-operative serum samples from 202 consecutive patients being evaluated for ovarian pathology were aliquotted, and frozen within six hours of collection.
  • the serum samples were evaluated using a SELDI-TOF-MS proteomics assay for the seven marker panel.
  • 126 samples were used to train a model and the remaining samples were used for blinded testing.
  • 132 had benign disease (including endometriosis, benign pelvic cyst, uterine fibromas), 11 had borderline tumors, 50 had invasive epithelial ovarian cancer, 3 had germ cell tumors, and the remaining had metastatic non-gynecologic cancers.
  • the median age in the benign disease group was 48.3 years (range 20-84), and 65.1 years (range 40-89) in the invasive ovarian cancer group.
  • CA125 had a sensitivity of 100% (95% CI: 88.1-100.0%) and specificity of 63.3% (95% CI: 52.2-73.3%), while in the test set, CA125 had a sensitivity of 95.0% (95% CI: 75.1 - 99.9%) and specificity of 67.5% (95% CI: 50.9-81.4%).
  • a multivariable algorithm incorporating the seven markers and CA125 had a sensitivity of 86.2% (95% CI: 68.3 - 96.1%) and specificity of 94.4% (95% CI: 87.5-98.2%) in the training set and a sensitivity of 80.0% (95% CI: 68.3 - 96.1%) and specificity of 90.0% (95% CI: 76.4-97.2%) in the test set.
  • the seven marker panel may be useful in helping triage patients being evaluated for a persistent pelvic mass. This marker panel improves specificity of CAl 25, although diminishes its sensitivity.
  • the sensitivity is 85.2% with 95% CI 65.4% ⁇ 95.1%; the specificity is 96.7% with 95% CI 89.9% ⁇ 99.1%.
  • the sensitivity is 81.5% with 95% CI 61.3% ⁇ 93.0%; the specificity is 97.8% with 95% CI 91.4% ⁇ 99.6%.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Molecular Biology (AREA)
  • Immunology (AREA)
  • Chemical & Material Sciences (AREA)
  • Biomedical Technology (AREA)
  • Urology & Nephrology (AREA)
  • Hematology (AREA)
  • Physics & Mathematics (AREA)
  • General Health & Medical Sciences (AREA)
  • Biochemistry (AREA)
  • Medicinal Chemistry (AREA)
  • Biotechnology (AREA)
  • Cell Biology (AREA)
  • General Physics & Mathematics (AREA)
  • Pathology (AREA)
  • Microbiology (AREA)
  • Food Science & Technology (AREA)
  • Analytical Chemistry (AREA)
  • Bioinformatics & Computational Biology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Spectroscopy & Molecular Physics (AREA)
  • Hospice & Palliative Care (AREA)
  • Oncology (AREA)
  • Biophysics (AREA)
  • Optics & Photonics (AREA)
  • Reproductive Health (AREA)
  • Endocrinology (AREA)
  • Organic Chemistry (AREA)
  • Pest Control & Pesticides (AREA)
  • Plant Pathology (AREA)
  • Dentistry (AREA)
  • Wood Science & Technology (AREA)
  • Zoology (AREA)
  • Environmental Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Agronomy & Crop Science (AREA)
  • Investigating Or Analysing Biological Materials (AREA)
PCT/US2006/008578 2005-03-11 2006-03-10 Biomarkers for ovarian cancer and endometrial cancer: hepcidin Ceased WO2006099126A2 (en)

Priority Applications (8)

Application Number Priority Date Filing Date Title
EP06737729.1A EP1869462B1 (en) 2005-03-11 2006-03-10 Biomarkers for ovarian cancer and endometrial cancer: hepcidin
NZ560976A NZ560976A (en) 2005-03-11 2006-03-10 Biomarkers for ovarian cancer and endometrial cancer: hepcidin
AU2006223374A AU2006223374B2 (en) 2005-03-11 2006-03-10 Biomarkers for ovarian cancer and endometrial cancer: hepcidin
JP2008500963A JP5069214B2 (ja) 2005-03-11 2006-03-10 卵巣癌及び子宮内膜癌のバイオマーカー:ヘプシジン
KR1020077023307A KR101310000B1 (ko) 2005-03-11 2006-03-10 난소암 및 자궁내막암에 대한 바이오마커 : 헵시딘
CA2602088A CA2602088C (en) 2005-03-11 2006-03-10 Biomarkers for ovarian cancer and endometrial cancer
MX2007011024A MX2007011024A (es) 2005-03-11 2006-03-10 Biomarcadores para cancer de ovario y cancer de endometrio: hepcidin.
IL185496A IL185496A (en) 2005-03-11 2007-08-23 Biomarkers for Ovarian Cancer and Endometrial Cancer: Pseudine

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US66209005P 2005-03-11 2005-03-11
US60/662,090 2005-03-11

Publications (2)

Publication Number Publication Date
WO2006099126A2 true WO2006099126A2 (en) 2006-09-21
WO2006099126A3 WO2006099126A3 (en) 2006-12-07

Family

ID=36992262

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2006/008578 Ceased WO2006099126A2 (en) 2005-03-11 2006-03-10 Biomarkers for ovarian cancer and endometrial cancer: hepcidin

Country Status (11)

Country Link
US (2) US7510842B2 (enExample)
EP (1) EP1869462B1 (enExample)
JP (1) JP5069214B2 (enExample)
KR (1) KR101310000B1 (enExample)
CN (1) CN101189516A (enExample)
AU (1) AU2006223374B2 (enExample)
CA (1) CA2602088C (enExample)
IL (1) IL185496A (enExample)
MX (1) MX2007011024A (enExample)
NZ (1) NZ560976A (enExample)
WO (1) WO2006099126A2 (enExample)

Cited By (19)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JP2006308533A (ja) * 2005-05-02 2006-11-09 Mcbi:Kk 新規肝がんバイオマーカーおよび該バイオマーカーを用いた肝がんの検出方法
WO2008049175A1 (en) * 2006-10-24 2008-05-02 Katholieke Universiteit Leuven High discriminating power biomarker diagnosing
WO2008011158A3 (en) * 2006-07-21 2008-06-05 Amgen Inc Method of detecting and/ or measuring hepcidin in a sample
WO2008123948A1 (en) * 2007-03-27 2008-10-16 Vermillion, Inc. Biomarkers for ovarian cancer
WO2008060376A3 (en) * 2006-10-04 2008-11-20 Univ Johns Hopkins Algorithims for multivariant models to combine a panel of biomarkers for assessing the risk of developing ovarian cancer
WO2008097461A3 (en) * 2007-02-02 2009-05-14 Amgen Inc Hepcidin and hepcidin antibodies
WO2007022248A3 (en) * 2005-08-16 2009-05-14 Sloan Kettering Inst Cancer Methods of detection of cancer using peptide profiles
WO2009058331A3 (en) * 2007-10-29 2009-07-16 Vermilllion Inc Biomarkers for the detection of early stage ovarian cancer
US7820163B2 (en) 2007-11-02 2010-10-26 Eli Lilly And Company Anti-hepcidin antibodies and uses thereof
EP2273272A1 (en) 2009-07-06 2011-01-12 Stichting Katholieke Universiteit Method for predicting the outcome of chemotherapy in ovarian cancer
US20110027894A1 (en) * 2004-07-14 2011-02-03 The Regents Of The University Of California Biomarkers for detection of early- and late-stage endometrial cancer
EP2261672A3 (en) * 2004-07-14 2011-10-05 The Regents of the University of California Biomarkers for early detection of ovarian cancer
JP2011530514A (ja) * 2008-08-06 2011-12-22 イーライ リリー アンド カンパニー 抗ヘプシジン−25選択的抗体およびその使用
US8187827B2 (en) 2007-05-31 2012-05-29 Naohisa Tomosugi Diagnostic methods for acute ischemic disease using activated hepcidin as an indicator
US20140274787A1 (en) * 2005-06-22 2014-09-18 Vermillion, Inc. Biomarker for ovarian cancer ctap3-related proteins
EP2955517A1 (de) * 2014-06-10 2015-12-16 Siemens Healthcare Diagnostics Products GmbH Verfahren zur Stabilisierung von Körperflüssigkeitsproben durch die Zugabe von Detergenz
US9241976B2 (en) 2011-08-29 2016-01-26 The Regents Of The University Of California Use of HDL-related molecules to treat and prevent proinflammatory conditions
GB2530521A (en) * 2014-09-24 2016-03-30 Raymond Kruse Iles Mass spectral analysis of urine and other bodily fluids for the detection of cancer biomarkers
US9487575B2 (en) 2004-07-14 2016-11-08 The Regents Of The University Of California Compositions and methods for treatment of gynecologic cancers

Families Citing this family (86)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10533998B2 (en) 2008-07-18 2020-01-14 Bio-Rad Laboratories, Inc. Enzyme quantification
GB0307428D0 (en) 2003-03-31 2003-05-07 Medical Res Council Compartmentalised combinatorial chemistry
US20060078893A1 (en) 2004-10-12 2006-04-13 Medical Research Council Compartmentalised combinatorial chemistry by microfluidic control
GB0307403D0 (en) 2003-03-31 2003-05-07 Medical Res Council Selection by compartmentalised screening
US20050221339A1 (en) 2004-03-31 2005-10-06 Medical Research Council Harvard University Compartmentalised screening by microfluidic control
US7968287B2 (en) 2004-10-08 2011-06-28 Medical Research Council Harvard University In vitro evolution in microfluidic systems
US8465929B2 (en) * 2005-06-24 2013-06-18 Vermillion, Inc. Biomarkers for ovarian cancer
US7672916B2 (en) * 2005-08-16 2010-03-02 The Trustees Of Columbia University In The City Of New York Methods, systems, and media for music classification
EP3913375A1 (en) 2006-01-11 2021-11-24 Bio-Rad Laboratories, Inc. Microfluidic devices and methods of use in the formation and control of nanoreactors
EP2021113A2 (en) 2006-05-11 2009-02-11 Raindance Technologies, Inc. Microfluidic devices
US9562837B2 (en) 2006-05-11 2017-02-07 Raindance Technologies, Inc. Systems for handling microfludic droplets
US9012390B2 (en) 2006-08-07 2015-04-21 Raindance Technologies, Inc. Fluorocarbon emulsion stabilizing surfactants
WO2008048508A2 (en) * 2006-10-13 2008-04-24 Vermillion, Inc. Prognostic biomarkers in patients with ovarian cancer
JPWO2008047485A1 (ja) * 2006-10-17 2010-02-18 直久 友杉 活性型ヘプシジンを指標とした、鉄代謝異常の診断方法
US8329399B2 (en) * 2006-10-27 2012-12-11 Siu K W Michael Endometrial biomarkers
US8772046B2 (en) 2007-02-06 2014-07-08 Brandeis University Manipulation of fluids and reactions in microfluidic systems
WO2008130623A1 (en) 2007-04-19 2008-10-30 Brandeis University Manipulation of fluids, fluid components and reactions in microfluidic systems
EP2637020A3 (en) 2007-06-29 2014-01-08 Correlogic Systems Inc. Predictive markers for ovarian cancer
CA2694112A1 (en) * 2007-07-20 2009-01-29 The University Of Utah Research Foundation Identification and quantification of biomarkers for evaluating the risk of preterm birth
US8039227B2 (en) * 2007-09-20 2011-10-18 University Of Louisville Research Foundation, Inc. Peptide biomarkers predictive of renal function decline and kidney disease
EP2222345B1 (en) * 2007-11-23 2016-03-23 British Columbia Cancer Agency Branch Methods for detecting lung cancer and monitoring treatment response
US12038438B2 (en) 2008-07-18 2024-07-16 Bio-Rad Laboratories, Inc. Enzyme quantification
WO2010009365A1 (en) 2008-07-18 2010-01-21 Raindance Technologies, Inc. Droplet libraries
AU2009278386B2 (en) 2008-08-05 2015-05-21 Toray Industries, Inc. Pharmaceutical composition for treatment and prevention of cancers
PL2733492T3 (pl) 2008-08-05 2016-08-31 Toray Industries Sposób wykrywania nowotworów
US20100068737A1 (en) * 2008-09-16 2010-03-18 University Of Tennessee Research Foundation Enzyme-linked Immunosorbent Assay (ELISA) for Canine Hepcidin
WO2010111231A1 (en) 2009-03-23 2010-09-30 Raindance Technologies, Inc. Manipulation of microfluidic droplets
WO2011042564A1 (en) 2009-10-09 2011-04-14 Universite De Strasbourg Labelled silica-based nanomaterial with enhanced properties and uses thereof
EP2517025B1 (en) 2009-12-23 2019-11-27 Bio-Rad Laboratories, Inc. Methods for reducing the exchange of molecules between droplets
BR112012018943A8 (pt) 2010-02-04 2017-12-19 Toray Industries medicamento e método para o tratamento e/ou prevenção de um câncer
WO2011096533A1 (ja) 2010-02-04 2011-08-11 東レ株式会社 癌の治療及び/又は予防用医薬組成物
RU2567657C2 (ru) 2010-02-04 2015-11-10 Торэй Индастриз, Инк. Фармацевтическая композиция для лечения и/или профилактики рака
MX340014B (es) 2010-02-04 2016-06-22 Toray Industries Composicion farmaceutica para el tratamiento y/o prevencion del cancer.
CA2788718C (en) 2010-02-04 2019-05-21 Shinichi Kobayashi Caprin-1 antibody for treating and/or preventing cancer
RU2598258C2 (ru) 2010-02-04 2016-09-20 Торэй Индастриз, Инк. Фармацевтическая композиция для лечения и/или профилактики рака
US9321818B2 (en) * 2010-02-09 2016-04-26 Academia Sinica Dermcidin-derived peptides for lung cancer diagnostics
US9366632B2 (en) 2010-02-12 2016-06-14 Raindance Technologies, Inc. Digital analyte analysis
US9399797B2 (en) 2010-02-12 2016-07-26 Raindance Technologies, Inc. Digital analyte analysis
EP4484577A3 (en) 2010-02-12 2025-03-26 Bio-Rad Laboratories, Inc. Digital analyte analysis
US10351905B2 (en) 2010-02-12 2019-07-16 Bio-Rad Laboratories, Inc. Digital analyte analysis
WO2011149942A2 (en) * 2010-05-24 2011-12-01 Children's Medical Center Corporation Compositions and methods for plasma peptide analysis
US20120046185A1 (en) * 2010-08-06 2012-02-23 Vermillion, Inc. Panel of biomarkers for ovarian cancer
CN102375063A (zh) * 2010-08-23 2012-03-14 湖州赛尔迪生物医药科技有限公司 一种常见蛋白质的免疫质谱试剂盒及制备方法
EP2622103B2 (en) 2010-09-30 2022-11-16 Bio-Rad Laboratories, Inc. Sandwich assays in droplets
EP2630498A4 (en) * 2010-10-22 2014-10-01 Vermillion Inc PROGNOSTIC BIOMARKERS IN PATIENTS WITH OVARIAN CANCER
WO2012109600A2 (en) 2011-02-11 2012-08-16 Raindance Technologies, Inc. Methods for forming mixed droplets
US9150852B2 (en) 2011-02-18 2015-10-06 Raindance Technologies, Inc. Compositions and methods for molecular labeling
US8841071B2 (en) 2011-06-02 2014-09-23 Raindance Technologies, Inc. Sample multiplexing
US8658430B2 (en) 2011-07-20 2014-02-25 Raindance Technologies, Inc. Manipulating droplet size
CN103717739B (zh) 2011-08-04 2015-07-29 东丽株式会社 癌的治疗和/或预防用药物组合物
EP2740798B1 (en) 2011-08-04 2016-12-07 Toray Industries, Inc. Cancer treatment and/or prevention drug composition
CN103717238B (zh) 2011-08-04 2016-10-12 东丽株式会社 胰癌的治疗和/或预防用药物组合物
CA2844033C (en) 2011-08-04 2021-07-27 Toray Industries, Inc. Method for detecting pancreatic cancer
CN103764825B (zh) 2011-08-04 2015-09-02 东丽株式会社 癌的治疗和/或预防用药物组合物
CA2844042C (en) 2011-08-04 2019-06-18 Toray Industries, Inc. Pharmaceutical composition for treatment and/or prophylaxis of cancer
CA2844038C (en) 2011-08-04 2019-05-07 Toray Industries, Inc. Pharmaceutical composition for treatment and/or prophylaxis of cancer
WO2013120089A1 (en) 2012-02-10 2013-08-15 Raindance Technologies, Inc. Molecular diagnostic screening assay
MX360208B (es) 2012-02-21 2018-10-24 Toray Industries Composicion farmaceutica para el tratamiento y/o prevencion del cancer.
AU2013223147B2 (en) 2012-02-21 2017-10-05 Toray Industries, Inc. Pharmaceutical composition for treatment and/or prevention of cancer
WO2013125654A1 (ja) 2012-02-21 2013-08-29 東レ株式会社 癌の治療及び/又は予防用医薬組成物
PT2818481T (pt) 2012-02-21 2019-10-25 Toray Industries Composição farmacêutica para tratamento e/ou prevenção de cancro
EP2832365B1 (en) 2012-03-30 2017-11-01 Toray Industries, Inc. Pharmaceutical composition for treatment and/or prevention of liver cancer
JP6107655B2 (ja) 2012-03-30 2017-04-05 東レ株式会社 胆嚢癌の治療及び/又は予防用医薬組成物
WO2013165748A1 (en) 2012-04-30 2013-11-07 Raindance Technologies, Inc Digital analyte analysis
RU2646464C2 (ru) 2012-07-19 2018-03-05 Торэй Индастриз, Инк. Метод детекции рака
PT2876446T (pt) 2012-07-19 2019-03-25 Toray Industries Método para deteção de cancro
DK2968503T3 (en) * 2013-03-15 2018-12-03 Intrinsic Lifesciences Llc ANTI-HEPCIDIN ANTIBODIES AND APPLICATIONS THEREOF
EP2986762B1 (en) 2013-04-19 2019-11-06 Bio-Rad Laboratories, Inc. Digital analyte analysis
PT3031826T (pt) 2013-08-09 2019-01-18 Toray Industries Composição farmacêutica para o tratamento e/ou a prevenção do cancro
US11901041B2 (en) 2013-10-04 2024-02-13 Bio-Rad Laboratories, Inc. Digital analysis of nucleic acid modification
US9944977B2 (en) 2013-12-12 2018-04-17 Raindance Technologies, Inc. Distinguishing rare variations in a nucleic acid sequence from a sample
US11193176B2 (en) 2013-12-31 2021-12-07 Bio-Rad Laboratories, Inc. Method for detecting and quantifying latent retroviral RNA species
TWI598577B (zh) * 2014-03-28 2017-09-11 Metallogenics Co Ltd Method for obtaining data for determining possibility of carcinogenesis of endometriotic ovarian cysts, and diagnostic apparatus thereof
EP3197915A4 (en) 2014-09-22 2018-12-19 Intrinsic Lifesciences LLC Humanized anti-hepcidin antibodies and uses thereof
WO2016046558A1 (en) * 2014-09-24 2016-03-31 Map Ip Holding Limited Methods for providing a prognosis of pregnancy
IL256399B (en) 2015-06-19 2022-09-01 Sera Prognostics Inc Biomarker pairs for predicting preterm birth
US10647981B1 (en) 2015-09-08 2020-05-12 Bio-Rad Laboratories, Inc. Nucleic acid library generation methods and compositions
CN106872593B (zh) * 2017-02-04 2021-05-04 江西省妇幼保健院 溶血磷脂酸作为标志物在检测子宫内膜异位症中的应用
WO2019036032A1 (en) 2017-08-18 2019-02-21 Sera Prognostics, Inc PREGNANCY CLOCK PROTEINS FOR PREDICTING THE DATE AND MOMENT OF BIRTH
US10998178B2 (en) 2017-08-28 2021-05-04 Purdue Research Foundation Systems and methods for sample analysis using swabs
WO2019046814A1 (en) 2017-09-01 2019-03-07 Venn Biosciences Corporation IDENTIFICATION AND USE OF GLYCOPEPTIDES AS BIOMARKERS FOR THE DIAGNOSIS AND MONITORING OF TREATMENT
CN108152430A (zh) * 2017-12-21 2018-06-12 上海中科新生命生物科技有限公司 基于prm检测的卵巢癌标志物检测试剂盒及检测方法
CN115997121A (zh) * 2020-02-19 2023-04-21 艾思彼拉妇女保健公司 具有改善特异性的子宫内膜异位症评估的组成物
AU2023406952A1 (en) * 2022-12-02 2025-06-19 Aspira Women's Health Inc. Compositions for endometriosis assessment having improved specificity
WO2024192014A1 (en) * 2023-03-12 2024-09-19 Novelna Inc. Endometrial cancer detection proteins and methods of use thereof
CN119757576A (zh) * 2024-12-26 2025-04-04 哈尔滨脉图精准技术有限公司 一种用于区分健康与宫颈癌的代谢标志物组合及其应用

Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6283761B1 (en) 1992-09-08 2001-09-04 Raymond Anthony Joao Apparatus and method for processing and/or for providing healthcare information and/or healthcare-related information
WO2004058044A2 (en) 2002-11-19 2004-07-15 Drg International, Inc. Diagnostic method for diseases by screening for hepcidin in human or animal tissues, blood or body fluids and therapeutic uses therefor

Family Cites Families (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6177545B1 (en) * 1997-09-02 2001-01-23 Insight Strategy & Marketing Ltd. Heparanase specific molecular probes and their use in research and medical applications
WO2003057014A2 (en) * 2002-01-07 2003-07-17 John Hopkins University Biomarkers for detecting ovarian cancer
EP1540010B8 (en) * 2002-08-06 2010-07-14 The Johns Hopkins University Use of biomarkers for detecting ovarian cancer
WO2004105573A2 (en) * 2003-05-21 2004-12-09 The Wistar Institute Of Anatomy And Biology Method of diagnosis of cancer based on gene expression profiles in cells
KR20060031809A (ko) * 2003-06-09 2006-04-13 더 리젠츠 오브 더 유니버시티 오브 미시간 암 치료 및 진단용 조성물 및 방법
US7670792B2 (en) * 2004-07-14 2010-03-02 The Regents Of The University Of California Biomarkers for early detection of ovarian cancer
US8465929B2 (en) * 2005-06-24 2013-06-18 Vermillion, Inc. Biomarkers for ovarian cancer

Patent Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6283761B1 (en) 1992-09-08 2001-09-04 Raymond Anthony Joao Apparatus and method for processing and/or for providing healthcare information and/or healthcare-related information
WO2004058044A2 (en) 2002-11-19 2004-07-15 Drg International, Inc. Diagnostic method for diseases by screening for hepcidin in human or animal tissues, blood or body fluids and therapeutic uses therefor

Non-Patent Citations (10)

* Cited by examiner, † Cited by third party
Title
BUAMAH P., J SURG ONCOL, vol. 75, no. 4, 2000, pages 264 - 5
CRAIG, CC ET AL.: "Effect of surgeon specialty on processes of care and outcomes for ovarian cancer patients", J NATL CANC INST, vol. 98, 2006, pages 172 - 80
JAMAL, A. ET AL., CA CANCER J. CLIN, vol. 52, 2002, pages 23 - 47
LOPEZ-OTTIN ET AL., NATURE REVIEWS, vol. 3, 2002, pages 509 - 519
MEYER T ET AL., BR J CANCER, vol. 82, no. 9, 2000, pages 1535 - 8
OZOLS RF: "Principles and Practice of Gynecologic Oncology", 2000, LIPPINCOTT, WILLIAMS AND WILKINS, article "Epithelial ovarian cancer", pages: 981 - 1057
PALEY PJ., CURR OPIN ONCOL, vol. 13, no. 5, 2001, pages 399 - 402
See also references of EP1869462A4
TUXEN MK ET AL., CANCER TREAT REV, vol. 21, no. 3, 1995, pages 215 - 45
WALKER ET AL.: "Hepcidin: what every gastroenterologist should know", GUT MAY 2004, vol. 53, no. 5, May 2004 (2004-05-01), pages 624 - 627, XP002504151, DOI: doi:10.1136/gut.2003.030304

Cited By (37)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US9110083B2 (en) 2004-07-14 2015-08-18 The Regents Of The University Of California Biomarkers for early detection of ovarian cancer
US9487575B2 (en) 2004-07-14 2016-11-08 The Regents Of The University Of California Compositions and methods for treatment of gynecologic cancers
US8323915B2 (en) 2004-07-14 2012-12-04 The Regents Of The University Of California Biomarkers for early detection of ovarian cancer
US9488655B2 (en) 2004-07-14 2016-11-08 The Regents Of The University Of California Biomarkers for detection of early- and late-stage endometrial cancer
EP2261672A3 (en) * 2004-07-14 2011-10-05 The Regents of the University of California Biomarkers for early detection of ovarian cancer
US20110027894A1 (en) * 2004-07-14 2011-02-03 The Regents Of The University Of California Biomarkers for detection of early- and late-stage endometrial cancer
EP3203241A1 (en) * 2004-07-14 2017-08-09 The Regents of The University of California Biomarkers for early detection of ovarian cancer
JP2006308533A (ja) * 2005-05-02 2006-11-09 Mcbi:Kk 新規肝がんバイオマーカーおよび該バイオマーカーを用いた肝がんの検出方法
US9816995B2 (en) * 2005-06-22 2017-11-14 Vermillion, Inc. Biomarker for ovarian cancer CTAP3-related proteins
US11255857B2 (en) 2005-06-22 2022-02-22 Aspira Women's Health Inc. Biomarkers for ovarian cancer CTAP3-related proteins
US20140274787A1 (en) * 2005-06-22 2014-09-18 Vermillion, Inc. Biomarker for ovarian cancer ctap3-related proteins
US20220317126A1 (en) * 2005-06-22 2022-10-06 Aspira Women's Health Inc. Biomarkers for ovarian cancer ctap3-related proteins
WO2007022248A3 (en) * 2005-08-16 2009-05-14 Sloan Kettering Inst Cancer Methods of detection of cancer using peptide profiles
US7972770B2 (en) 2005-08-16 2011-07-05 Memorial Sloan-Kettering Cancer Center Methods of detection of cancer using peptide profiles
EP2498096A1 (en) * 2006-07-21 2012-09-12 Amgen Inc. Method of detecting and/or measuring hepcidin in a sample
WO2008011158A3 (en) * 2006-07-21 2008-06-05 Amgen Inc Method of detecting and/ or measuring hepcidin in a sample
WO2008060376A3 (en) * 2006-10-04 2008-11-20 Univ Johns Hopkins Algorithims for multivariant models to combine a panel of biomarkers for assessing the risk of developing ovarian cancer
WO2008049175A1 (en) * 2006-10-24 2008-05-02 Katholieke Universiteit Leuven High discriminating power biomarker diagnosing
WO2008097461A3 (en) * 2007-02-02 2009-05-14 Amgen Inc Hepcidin and hepcidin antibodies
US8221984B2 (en) 2007-03-27 2012-07-17 Vermillion, Inc. Biomarkers for ovarian cancer
WO2008123948A1 (en) * 2007-03-27 2008-10-16 Vermillion, Inc. Biomarkers for ovarian cancer
US8187827B2 (en) 2007-05-31 2012-05-29 Naohisa Tomosugi Diagnostic methods for acute ischemic disease using activated hepcidin as an indicator
US20100304993A1 (en) * 2007-10-29 2010-12-02 Vermilllion, Inc. Biomarkers for the detection of early stage ovarian cancer
US20140038837A1 (en) * 2007-10-29 2014-02-06 Board Of Regents, The University Of Texas System Biomarkers for the detection of early stage ovarian cancer
WO2009058331A3 (en) * 2007-10-29 2009-07-16 Vermilllion Inc Biomarkers for the detection of early stage ovarian cancer
US7820163B2 (en) 2007-11-02 2010-10-26 Eli Lilly And Company Anti-hepcidin antibodies and uses thereof
US8765129B2 (en) 2007-11-02 2014-07-01 Eli Lilly And Company Anti-hepcidin antibodies and uses thereof
US8329174B2 (en) 2007-11-02 2012-12-11 Eli Lilly And Company Anti-hepcidin antibodies and uses thereof
JP2011530514A (ja) * 2008-08-06 2011-12-22 イーライ リリー アンド カンパニー 抗ヘプシジン−25選択的抗体およびその使用
US8609817B2 (en) 2008-08-06 2013-12-17 Eli Lilly And Company Anti-hepcidin-25 selective antibodies and uses thereof
EP2273272A1 (en) 2009-07-06 2011-01-12 Stichting Katholieke Universiteit Method for predicting the outcome of chemotherapy in ovarian cancer
WO2011003885A1 (en) 2009-07-06 2011-01-13 Stichting Katholieke Universiteit Method for predicting disease free survival in patients with ovarian cancer
US10208103B2 (en) 2011-08-29 2019-02-19 The Regents Of The University Of California Use of HDL-related molecules to treat and prevent proinflammatory conditions
US9241976B2 (en) 2011-08-29 2016-01-26 The Regents Of The University Of California Use of HDL-related molecules to treat and prevent proinflammatory conditions
EP2955517A1 (de) * 2014-06-10 2015-12-16 Siemens Healthcare Diagnostics Products GmbH Verfahren zur Stabilisierung von Körperflüssigkeitsproben durch die Zugabe von Detergenz
GB2530521A (en) * 2014-09-24 2016-03-30 Raymond Kruse Iles Mass spectral analysis of urine and other bodily fluids for the detection of cancer biomarkers
GB2530521B (en) * 2014-09-24 2020-06-10 Map Ip Holding Ltd Mass spectral analysis of patient samples for the detection of the human chorionic gonadotropin

Also Published As

Publication number Publication date
CA2602088A1 (en) 2006-09-21
CA2602088C (en) 2021-07-27
IL185496A0 (en) 2008-01-06
MX2007011024A (es) 2009-11-23
US7510842B2 (en) 2009-03-31
KR20080044801A (ko) 2008-05-21
US20100068724A1 (en) 2010-03-18
CN101189516A (zh) 2008-05-28
AU2006223374B2 (en) 2011-07-21
AU2006223374A1 (en) 2006-09-21
EP1869462A4 (en) 2009-01-14
JP5069214B2 (ja) 2012-11-07
EP1869462A2 (en) 2007-12-26
EP1869462B1 (en) 2013-05-08
IL185496A (en) 2012-07-31
KR101310000B1 (ko) 2013-09-25
US20070054329A1 (en) 2007-03-08
WO2006099126A3 (en) 2006-12-07
NZ560976A (en) 2011-06-30
JP2008533471A (ja) 2008-08-21

Similar Documents

Publication Publication Date Title
US7510842B2 (en) Biomarker for ovarian and endometrial cancer: hepcidin
US11255857B2 (en) Biomarkers for ovarian cancer CTAP3-related proteins
US20210181207A1 (en) Biomarkers for Ovarian Cancer: B2 Microglobulin
WO2007002535A2 (en) Biomarkers for ovarian cancer
WO2005098447A2 (en) Biomarkers for ovarian cancer
US8221984B2 (en) Biomarkers for ovarian cancer
AU2015210343B2 (en) BIOMARKERS FOR OVARIAN CANCER: ß-2 MICROGLOBULIN
AU2012216473B2 (en) Biomarkers for ovarian cancer: beta-2 microglobulin
US20150153348A1 (en) BIOMARKERS FOR OVARIAN CANCER: Beta 2 MICROGLOBULIN

Legal Events

Date Code Title Description
WWE Wipo information: entry into national phase

Ref document number: 200680007808.6

Country of ref document: CN

121 Ep: the epo has been informed by wipo that ep was designated in this application
WWE Wipo information: entry into national phase

Ref document number: 185496

Country of ref document: IL

WWE Wipo information: entry into national phase

Ref document number: 2006223374

Country of ref document: AU

Ref document number: 560976

Country of ref document: NZ

WWE Wipo information: entry into national phase

Ref document number: MX/A/2007/011024

Country of ref document: MX

ENP Entry into the national phase

Ref document number: 2602088

Country of ref document: CA

Ref document number: 2008500963

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 2006737729

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 2006223374

Country of ref document: AU

Date of ref document: 20060310

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: RU

WWE Wipo information: entry into national phase

Ref document number: 1020077023307

Country of ref document: KR