WO2006066408A1 - Cancer specific antibody and cell surface proteins - Google Patents

Cancer specific antibody and cell surface proteins Download PDF

Info

Publication number
WO2006066408A1
WO2006066408A1 PCT/CA2005/001953 CA2005001953W WO2006066408A1 WO 2006066408 A1 WO2006066408 A1 WO 2006066408A1 CA 2005001953 W CA2005001953 W CA 2005001953W WO 2006066408 A1 WO2006066408 A1 WO 2006066408A1
Authority
WO
WIPO (PCT)
Prior art keywords
cancer
variant
binding protein
protein
isolated
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/CA2005/001953
Other languages
English (en)
French (fr)
Inventor
Nicholas R. Glover
Glen Macdonald
Joycelyn Entwistle
Jeannick Cizeau
Francina C. Chahal
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Viventia Bio Inc
Original Assignee
Viventia Biotech Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to JP2007547125A priority Critical patent/JP5143566B2/ja
Priority to NZ556055A priority patent/NZ556055A/en
Priority to US11/722,420 priority patent/US8084576B2/en
Priority to CA2591768A priority patent/CA2591768C/en
Priority to ES05823959T priority patent/ES2421558T3/es
Priority to EP05823959.1A priority patent/EP1833968B1/en
Application filed by Viventia Biotech Inc filed Critical Viventia Biotech Inc
Priority to AU2005318836A priority patent/AU2005318836B2/en
Priority to CN2005800485228A priority patent/CN101160402B/zh
Publication of WO2006066408A1 publication Critical patent/WO2006066408A1/en
Priority to IL183958A priority patent/IL183958A/en
Anticipated expiration legal-status Critical
Priority to US13/297,783 priority patent/US8697075B2/en
Ceased legal-status Critical Current

Links

Classifications

    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/575Immunoassay; Biospecific binding assay; Materials therefor for cancer
    • G01N33/5758Immunoassay; Biospecific binding assay; Materials therefor for cancer involving compounds serving as markers for tumours, cancers or neoplasias, e.g. cellular determinants, receptors, heat shock/stress proteins, A-protein, oligosaccharides or metabolites
    • G01N33/57585Immunoassay; Biospecific binding assay; Materials therefor for cancer involving compounds serving as markers for tumours, cancers or neoplasias, e.g. cellular determinants, receptors, heat shock/stress proteins, A-protein, oligosaccharides or metabolites involving compounds identifiable in body fluids
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/0005Vertebrate antigens
    • A61K39/0011Cancer antigens
    • A61K39/001102Receptors, cell surface antigens or cell surface determinants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • A61P35/02Antineoplastic agents specific for leukemia
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • A61P35/04Antineoplastic agents specific for metastasis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • A61P37/04Immunostimulants
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • C07K16/303Liver or Pancreas
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • C07K16/3046Stomach, Intestines
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • C07K16/3053Skin, nerves, brain
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • C07K16/3069Reproductive system, e.g. ovaria, uterus, testes, prostate
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/21Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/40Immunoglobulins specific features characterized by post-translational modification
    • C07K2317/41Glycosylation, sialylation, or fucosylation
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/51Complete heavy chain or Fd fragment, i.e. VH + CH1
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/55Fab or Fab'
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565Complementarity determining region [CDR]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2500/00Screening for compounds of potential therapeutic value
    • G01N2500/10Screening for compounds of potential therapeutic value involving cells

Definitions

  • the invention relates to human cancer-specific binding proteins and all uses thereof.
  • the invention relates to antibodies or antibody fragments specific for antigens or molecules on cancer cells and to immunoconjugates comprising the binding proteins of the invention, and methods of use thereof.
  • the invention also relates to a novel cancer associated-antigen and uses thereof.
  • Surgical resection always involves the removal of apparently normal tissue as a "safety margin" which can increase morbidity and risk of complications. It also always removes some of the healthy tissue that may be interspersed with tumor cells and that could potentially maintain or restore the function of the affected organ or tissue. Radiation and chemotherapy will kill or damage many normal cells due to their non-specific mode of action. This can result in serious side- effects such as severe nausea, weight loss and reduced stamina, loss of hair etc., as well as increasing the risk of developing secondary cancer later in life. Treatment with greater selectivity for cancer cells would leave normal cells unharmed thus improving outcome, side-effect profile and quality of life.
  • the selectivity of cancer treatment can be improved by using antibodies that are specific for molecules present only or mostly on cancer cells.
  • Such antibodies can be used to modulate the immune system and enhance the recognition and destruction of the cancer by the patient's own immune system. They can also block or alter the function of the target molecule and, thus, of the cancer cells. They can also be used to target drugs, genes, toxins or other medically relevant molecules to the cancer cells.
  • Such antibody-drug complexes are usually referred to as immunotoxins or immunoconjugates and a number of such compounds have been tested in recent year [Kreitman RJ (1999) Immunotoxins in cancer therapy. Curr Opin Immunol 11 :570-578; Kreitman RJ (2000) Immunotoxins.
  • these antibodies are basically mouse proteins that are being seen by the human patient's immune system as foreign proteins. The ensuing immune reaction and antibody response can result in a loss of efficacy or in side-effects.
  • the inventors have used a different approach in their development of antibodies for cancer treatment. Instead of immunizing experimental animals with cancer cells or isolated cancer cell markers, they have sought out only those markers that are recognized by the patient's own immune system or, in other words, that are seen by the immune system as a foreign molecule. This implies that the markers or antigens are usually substantially absent on normal cells and, thus, the risk of non-specific toxicity is further reduced.
  • Hybridoma libraries are generated from cancer patient-derived lymphocytes and the antibodies they secrete are tested for binding to normal and tumor cells. Only antibodies showing high selectivity for cancer cells are retained for further evaluation and development as a cancer therapeutic or diagnostic agent.
  • One such highly selective antibody is the subject of this patent application.
  • this antibody is fully compatible with the patient's immune system by virtue of being a fully-human protein.
  • the antibody of the invention can be used for diagnostic or therapeutic uses or as a basis for engineering other binding molecules for the target antigen.
  • the antibody of the invention can also be used to identify the target antigen.
  • the antigen can then be used to design new cancer treatment or diagnostics.
  • the basic structure of an antibody molecule consists of four protein chains, two heavy chains and two light chains. These chains are interconnected by disulfide bonds. Each light chain is comprised of a light chain variable region and a light chain constant region. Each heavy chain is comprised of a heavy chain variable region and a heavy chain constant region.
  • the light chain and heavy chain variable regions can be further subdivided into framework regions and regions of hypervariability, termed complementarity determining regions (CDR). Each light chain and heavy chain variable region is composed of three CDRs and four framework regions.
  • Glucose transporter 8 (GLUT8) is a member of the GLUT family of proteins and is known to have sugar transporting activity. GLUT8 is encoded by gene slc2a8, which is found on human chromosome 9. GLUT8 is 477 - A - amino acids in length. It is a ⁇ 50 kDa type Il transmembrane protein. It has 12 transmembrane regions.
  • GLUT8 is located intracellular ⁇ likely because of a N-terminal di-leucine motif (Ibberson et al. JBC 275: 4607-4612, 2000; Moadel et al., Cancer Res 65 :698-702, 2005). Translocation to the membrane has been observed in mouse cells upon insulin treatment (Carayannopoulos et al., PNAS 97:7313-18, 2000) or in rat cells upon hypoxic shock or insulin treatment (US 09/886,954 [2002/0038464]). In human, membrane localization has not been reported and no stimuli has been identified to induce translocation (Widmer et al., Endocrinology 146:4727-36, 2005).
  • GLUT/SLC2A family nomenclature has been published in: Amer.J. Physiol. Endocrinol. Metab. 282:E974-76, 2002.
  • the name GLUT8 was used in the past to describe what it now known as GLUT12 - as indicated in that paper.
  • the N-terminal di-leucine motif has been found in all mammalian GLUT8 sequences (see Zhao et al., Biochimica et Biophysica Acta 1680:103-113, 2004 - showing bovine, human, rat, mouse).
  • the present inventors have prepared human cancer-specific antibodies that bind to several types of cancer cells, including breast cancer, ovarian cancer, prostate cancer, melanoma, liver cancer, colon cancer, cervical cancer, head & neck cancer, bladder cancer, stomach cancer, pancreatic cancer and endometrial cancer. Importantly, the antibodies do not significantly bind to normal tissue making them suitable candidates for cancer therapy and diagnosis.
  • the invention provides isolated light chain complementarity determining regions 1 , 2 and/or 3, comprising the amino acid sequences RASQDISNYLA (SEQ ID NO:1), AASSLHS (SEQ ID NO:2) and LQYSTYPIT (SEQ ID NO:3), respectively; and isolated heavy chain complementarity determining regions 1 , 2 and 3, comprising the amino acid sequences NYAMS (SEQ ID NO:4), AITPSGGSTNYADSVKG (SEQ ID NO:5) and VPYRSTWYPLY (SEQ ID NO:6), respectively.
  • the invention also provides isolated nucleic acid sequences encoding light chain complementarity determining regions 1 , 2 and/or 3, comprising the amino acid sequences RASQDISNYLA (SEQ ID NO:1), AASSLHS (SEQ ID NO:2) and LQYSTYPIT (SEQ ID NO:3), respectively; and isolated nucleic acid sequences encoding heavy chain complementarity determining regions 1 , 2 and/or 3, comprising the amino acid sequences NYAMS (SEQ ID NO:4), AITPSGGSTNYADSVKG (SEQ ID NO:5) and VPYRSTWYPLY (SEQ ID NO:6), respectively.
  • isolated light chain variable regions comprising light chain complementarity determining regions 1 , 2 and/or 3 of the invention (SEQ ID NOS: 1-3), and isolated heavy chain variable regions comprising heavy chain complementarity determining regions 1 , 2 and/or 3 of the invention (SEQ ID NOS:4-6).
  • the light chain variable region comprises the amino acid sequence shown in Figure 1 (SEQ ID NO:7).
  • the heavy chain variable region comprises the amino acid sequence shown in Figure 2 (SEQ ID NO:9).
  • the invention also provides an isolated nucleic acid sequence encoding the light chain variable region of the invention, and an isolated nucleic acid sequence encoding the heavy chain variable region of the invention.
  • the light chain variable region comprises the nucleic acid sequence shown in Figure 1 (SEQ ID NO: 8).
  • the heavy chain variable region comprises the nucleic acid sequence shown in Figure 2 (SEQ ID NO: 10).
  • Another aspect of the invention is a binding protein, preferably an antibody or antibody fragment, that comprises at least one light chain complementarity determining region of the invention (i.e. one or more of the SEQ ID NOS: 1-3) and/or at least one heavy chain complementarity determining region of the invention (i.e. one or more of SEQ ID NO:4-6).
  • the invention also provides a binding protein, preferably an antibody or antibody fragment that comprises the light chain variable regions of the invention and/or the heavy chain variable regions of the invention.
  • the invention provides binding proteins that bind to: glucose transporter 8 (GLUT8) or variants thereof; a protein comprising any one of the amino acid sequences of SEQ ID NOS:11- 20, preferably SEQ ID NOS:11-13; or a cancer-associated variant of GLUT8 that is expressed on the surface of cancer cells.
  • the cancer-associated variant of GLUT8 comprises the amino acid sequence defined by any one of SEQ ID NOS: 11 , 12 or 13, or variants thereof.
  • the cancer-associated variant of GLUT8 comprises GLUT8 that has a modification in the N-terminal di-leucine motif.
  • the N-terminal di- leucine motif has been modified to di-alanine.
  • compositions comprising the binding proteins of the invention, such as antibodies and antibody fragments, with a pharmaceutically acceptable excipient, carrier, buffer or stabilizer.
  • Another aspect of the invention is an immunoconjugate comprising (1) binding protein of the invention, preferably an antibody or antibody fragment that binds to an antigen or molecule on a cancer cell, attached to (2) an effector molecule.
  • a further aspect of the invention is an immunoconjugate comprising (1) binding protein of the invention, preferably an antibody or antibody fragment that binds to an antigen or molecule that is internalized by a cancer cell, attached to (2) an effector molecule.
  • the effector molecule is (i) a label, which can generate a detectable signal, directly or indirectly, or (ii) a cancer therapeutic agent, which is either cytotoxic, cytostatic or otherwise prevents or reduces the ability of the cancer cells to divide and/or metastasize.
  • the cancer therapeutic agent is a toxin or cytotoxin.
  • the invention also provides compositions comprising the immunoconjugate of the invention and uses of the immunoconjugate for the manufacture of a medicament for treating or preventing cancer, and diagnostic purposes.
  • the invention provides methods of treating or preventing cancer using the immunoconjugate of the invention and related kits.
  • a further aspect of the invention is a method of detecting or monitoring cancer in a subject comprising the steps of:
  • binding protein of the invention (1) contacting a test sample taken from said subject with a binding protein of the invention and that binds specifically to an antigen on the cancer cell to produce a binding protein-antigen complex; (2) measuring the amount of binding protein-antigen complex in the test sample; and (3) comparing the amount of binding protein-antigen complex in the test sample to a control.
  • Another aspect of the invention is a diagnostic agent comprising the immunoconjugate of the invention, wherein the effector molecule is a label, which can generate a detectable signal, directly or indirectly.
  • the invention also includes an isolated protein that can specifically bind with one of the binding proteins of the invention, nucleic acid sequences and uses thereof.
  • the inventors have identified the antigen to which the binding proteins of the invention bind.
  • the invention includes the novel-cancer associated antigen, which is a variant of GLUT8 that is expressed on the surface of cancer cells.
  • the invention also includes the use of the novel cancer- associated antigen of the invention in the treatment and diagnosis of cancer.
  • GLUT8 comprises the amino acid sequence defined by any one of SEQ ID NOS: 11 , 12 or 13, or variants thereof.
  • the cancer-associated variant of GLUT8 comprises GLUT8 that has a modification in the N-terminal di-leucine motif.
  • the N-terminal di-leucine motif has been modified to di- alanine.
  • the invention also includes methods of detecting or monitoring cancer in a subject having or suspected of having cancer, comprising detecting a cancer-associated variant of GLUT8 on a cell in the sample, wherein cancer is indicated, if the cancer-associated variant of GLUT8 is detected on the cell.
  • the invention includes methods of detecting or monitoring cancer in a subject having or suspected of having cancer, comprising detecting the expression of a cancer-associated variant of GLUT8 in the cell in the sample, wherein cancer is indicated, if the expression of the cancer- associated variant of GLUT8 is detected in the cell.
  • a further aspect of the invention is a method of treating or preventing cancer in a subject by modulating the function or expression of GLUT8 in the cancer cell.
  • the invention also includes methods of treating or preventing cancer in a subject using the cancer-associated variant of GLUT8 or fragments thereof.
  • the invention includes pharmaceutical compositions comprising an effective amount a cancer-associated variant of GLUT8 or fragments thereof, nucleic acid sequences encoding the cancer-associated variant of GLUT8 or fragments thereof, and/or recombinant expression vectors comprising nucleic acid sequences encoding the cancer-associated variant of GLUT8 or fragments thereof.
  • Figure 1 is the nucleic acid (SEQ ID NO:8) and amino acid (SEQ ID NO:7) sequence of the light chain variable region of VB1-050.
  • Figure 2 is the nucleic acid (SEQ ID NO: 10) and amino acid (SEQ ID NO:9) sequence of the heavy chain variable region of VB1-050.
  • Figure 3 demonstrates antibody cell surface binding after incubation of
  • Figure 4 shows confocal microscopy assessment of VB1-050 internalization.
  • A-375 cells were incubated with antibody at 4°C, washed and warmed to 37 0 C for 60 min. Cells were fixed, permeabilized and labeled with fluorescent-labeled second antibody. Fluorescence labeling of A-375 cells after incubation of VB1-050 at 4°C for 60 min, displaying circumferential surface distribution of labeling, (6OX x 4) magnification (A). Following incubation of antibody-bound cells at 37°C for 60 min the cells show strong intracellular staining by internalized antibody, (6OX x 4) magnification (B).
  • Figure 5 shows an agarose gel of the PCR reaction.
  • the DNA was detected using ethidium bromide under a UV lamp.
  • the * symbol indicates the EcoRI-PelB-Pvull insert with the peptide leader sequence which was ligated to the PelB(-S)-V H05 o-C H -F-de-bouganin/pSV73 pre-digested (indicated with the arrow) to create the PelB-V ⁇ oso-C-H-F-de- bouganin/pSV73.
  • a representative supernatant of VB6-845 (lane 1) and VB6-050 (lane 2) was loaded under non- reducing conditions on a SDS-PAGE gel and immunoblotted with an anti- human Kappa light chain-HRP antibody (1/1000). Lanes 3 and 4 correspond to the supernatant of a non-induced culture and the ladder, respectively. Lane 5 is VB6-845 supernatant previously tested positive on Western blot.
  • Figure 7 shows a Western blot of a representative purification of VB6- 050 from E104 supernatant.
  • Lane 1 Culture supernatant; lane 2: Permeate of the concentrated supernatant; lane 3: Concentrated supernatant 1/10 diluted; lane 4: Permeate of the diafiltered concentrated supernatant; lane 5: Diafiltered concentrated supernatant 1/10; lane 6: Flow-through of the CM-sepharose column; lane 7: Wash of the CM- sepharose column; lane 8: Eluate of the CM-sepaharose column or Ni- sepharose starting material; lane 9: Flow-through of the Ni-chelating column; lanes 10, 11 and 12: Different step washes of the Ni-chelating column; lane 13: Eluate of the Ni-chelating-Sepharose or SEC-200 starting material; lane 14: Pool of the SEC-200 fractions 26-28; lane 15: Ladder and VB6-845 as a control.
  • Figure 8 shows the titration curve of VB6-050.
  • SKBR-3, A-375 and SK- OV-3 cells were incubated with various concentrations of VB6-050 and the medium fluorescence was obtained by flow cytometry.
  • Figure 9 shows the in vitro cytotoxicity of VB6-050.
  • Figure 10 shows the fractionation profiles of HepG2, MCF-7, Panc-1 and C-33A on a PF-2D system. A comparative profile of the differences in antigen expression between two positive and two negative cell lines. This figure represents a chromatographic file from 10 to 25 minutes. A clear view of the separated antigen differences is visualized in both positive cell lines. MCF-7 and HepG2 showed two peaks eluting at 15 and 18 minutes, indicating moderate levels of hydrophobicity. Panc-1 and C-33A showed no corresponding peaks. A peak at 12 minutes was observed in all cell lines.
  • Figure 11 shows the TOF-MS scans of peptides obtained from HepG2 cell line, to detect the presence of all peptide ions in the sample. Fifty-three scans at 1200-1400V in the range of 100-1200 amu on a static nanospray resulted in the recovery of a significant number of peptides, which when analyzed yielded a protein ID as Glucose Transporter 8.
  • Figure 12 shows the TOF-MS scans of peptides obtained from Panc-1 cell line, to detect the presence of all peptide ions in the sample. Thirty scans at 1200-1400V in the range of 100-1200 amu on a static nanospray resulted in the recovery of a significant number of peptides, which when analyzed yielded a protein ID as IgG.
  • Figure 13 shows the TOF-MS scans of peptides obtained from MCF-7 cell line, to detect the presence of all peptide ions in the sample. Twenty- seven scans at 1200-1400V in the range of 100-1200 amu on a static nanospray resulted in the recovery of a significant number of peptides, which when analyzed yielded a protein ID as Glucose Transporter 8.
  • Figure 14 shows the TOF-MS scans of peptides obtained from C-33A cell line, to detect the presence of all peptide ions in the sample. Thirty scans at 1200-1400V in the range of 100-1200 amu on a static nanospray resulted in the recovery of a significant number of peptides, which when analyzed yielded a protein ID as IgG.
  • Figure 15 shows the sequence coverage of peptides recovered from mass spectrometry analysis as listed in Table 8. A total of 8 peptides were recovered from in-solution tryptic digestion and 34% coverage of the protein was obtained. Sequences underlined represent the peptide sequences recovered and bolded sequences show the variant amino acid sequences.
  • Figure 16 shows the peptide mass fingerprinting results for the peptides recovered from VB1-050Ag. Protein scores greater than 64 were considered significant. The only significant protein IDs observed pointed to the one antigen, known as Glucose Transporter 8.
  • Figure 17 shows that the identified antigen, glucose transporter 8, has a significant score of 83. Due to the nature of the database server and the similarity/homology linked proteins, all the isoforms of this protein were pulled down as hits. MS/MS fragmentation and identity of peptides confirms that the antigen is glucose transporter 8.
  • Figure 18 shows the MS/MS ion fragmentation of the neutral peptide
  • Figure 21 shows the MS/MS ion fragmentation of the neutral peptide
  • Mr. 1176.3547 appearing as a doubly charged molecule (589.100000, 2+).
  • the peptide sequence showed changes in amino acids at positions 7, 10, 12,
  • immunoconjugate and/or other cancer therapeutic may be administered systemically in a convenient manner such as by injection (subcutaneous, intravenous, intramuscular, etc.), oral administration, inhalation, transdermal administration or topical application (such as topical cream or ointment, etc.), suppository applications, or means of an implant.
  • An implant can be of a porous, non-porous, or gelatinous material, including membranes, such as sialastic membranes, or fibers. Suppositories generally contain active ingredients in the range of 0.5% to 10% by weight.
  • amino acid includes all of the naturally occurring amino acids as well as modified amino acids.
  • antibody as used herein is intended to include monoclonal antibodies, polyclonal antibodies, and chimeric antibodies. The antibody may be from recombinant sources and/or produced in transgenic animals.
  • antibody fragment as used herein is intended to include Fab, Fab', F(ab') 2 , scFv, dsFv, ds-scFv, dimers, minibodies, diabodies, and multimers thereof and bispecific antibody fragments.
  • Antibodies can be fragmented using conventional techniques. For example, F(ab')2 fragments can be generated by treating the antibody with pepsin.
  • the resulting F(ab')2 fragment can be treated to reduce disulfide bridges to produce Fab 1 fragments. Papain digestion can lead to the formation of Fab fragments. Fab, Fab 1 and F(ab')2, scFv, dsFv, ds-scFv, dimers, minibodies, diabodies, bispecific antibody fragments and other fragments can also be synthesized by recombinant techniques.
  • antibody or antibody fragment of the invention comprises at least one light chain complementarity determining region of the invention (i.e. one or more of SEQ ID NOS: 1-3) and/or at least one heavy chain complementarity determining region of the invention (i.e. one or more of SEQ ID NOS:4-6).
  • the antibody or antibody fragment comprises the light chain CDR sequences (SEQ ID NOS: 1-3) and/or the heavy chain CDR sequences (SEQ ID NOS:4-6) or functional variants of the sequences so that the antibody or antibody fragment can bind to the cancer cell without substantially binding to normal cells.
  • Antibodies or antibody fragments of the invention also include antibodies or antibody fragments that bind to glucose transporter 8 (GLUT8) or variants thereof, or a protein comprising any one of the amino acid sequences of SEQ ID NOS: 11-20, preferably SEQ ID NOS:11-13.
  • At least moderately stringent hybridization conditions conditions are selected which promote selective hybridization between two complementary nucleic acid molecules in solution. Hybridization may occur to all or a portion of a nucleic acid sequence molecule. The hybridizing portion is typically at least 15 (e.g. 20, 25, 30, 40 or 50) nucleotides in length.
  • the parameters in the wash conditions that determine hybrid stability are sodium ion concentration and temperature.
  • a 1% mismatch may be assumed to result in about a 1°C decrease in Tm, for example if nucleic acid molecules are sought that have a >95% identity, the final wash temperature will be reduced by about 5 0 C.
  • stringent hybridization conditions are selected.
  • Moderately stringent hybridization conditions include a washing step in 3x SSC at 42°C. It is understood, however, that equivalent stringencies may be achieved using alternative buffers, salts and temperatures. Additional guidance regarding hybridization conditions may be found in: Current Protocols in Molecular Biology, John Wiley & Sons, N.
  • binding protein refers to proteins that specifically bind to another substance.
  • binding proteins are antibodies or antibody fragments.
  • binding proteins of the invention includes antibodies or antibody fragments of the invention.
  • biologically compatible form suitable for administration in vivo is meant a form of the substance to be administered in which any toxic effects are outweighed by the therapeutic effects.
  • cancer as used herein includes any cancer that can be bound by a binding protein of the invention, preferably an antibody or antibody fragment of the invention.
  • cancer-associated variant of glucose transporter 8 refers to a novel variant of glucose transporter 8 that is expressed on the surface of cancer cells.
  • a cancer- associated variant of GLUT8 has the same function as GLUT8 as a transporter of sugar, but a different localization in the cell.
  • the cancer-associated variant of GLUT8 as the same function as GLUT8, as a transporter of sugar, but is localized to the surface of the cell.
  • the cancer-associated variant of glucose transporter 8 is a protein comprising the amino acid sequence defined by SEQ ID NO: 11.
  • the cancer-associated variant of glucose transporter 8 is a protein comprising the amino acid sequence defined by SEQ ID NO: 12.
  • the cancer-associated variant of glucose transporter 8 is a protein comprising the amino acid sequence defined by SEQ ID NO:13.
  • the cancer-associated variant of GLUT8 comprises GLUT8 that has a modification in the N-terminal di-leucine motif.
  • the N-terminal di-leucine motif has been modified to di-alanine.
  • a "conservative amino acid substitution”, as used herein, is one in which one amino acid residue is replaced with another amino acid residue without abolishing the protein's desired properties.
  • a control can be used in the method.
  • control refers to a sample from a subject or a group of subjects who are either known as having cancer or not having cancer.
  • controlled release system means the immunoconjugate and/or other cancer therapeutic of the invention can be administered in a controlled fashion.
  • a micropump may deliver controlled doses directly into the area of the tumor, thereby finely regulating the timing and concentration of the pharmaceutical composition (see, e.g., Goodson, 1984, in Medical Applications of Controlled Release, vol. 2, pp. 115-138).
  • derivative of a peptide refers to a peptide having one or more residues chemically derivatized by reaction of a functional side group.
  • derivatized molecules include for example, those molecules in which free amino groups have been derivatized to form amine hydrochlorides, p- toluene sulfonyl groups, carbobenzoxy groups, t-butyloxycarbonyl groups, chloroacetyl groups or formyl groups.
  • Free carboxyl groups may be derivatized to form salts, methyl and ethyl esters or other types of esters or hydrazides.
  • Free hydroxyl groups may be derivatized to form O-acyl or O- alkyl derivatives.
  • the imidazole nitrogen of histidine may be derivatized to form N-im-benzylhistidine.
  • derivatives those peptides which contain one or more naturally occurring amino acid derivatives of the twenty standard amino acids. For examples: 4-hydroxyproline may be substituted for proline; 5-hydroxylysine may be substituted for lysine; 3- methylhistidine may be substituted for histidine; homoserine may be substituted for serine; and ornithine may be substituted for lysine.
  • detecting or monitoring cancer refers to a method or process of determining if a subject has or does not have cancer or the extent of cancer.
  • the binding proteins of the invention can be used to detect or monitor the appearance and progression of the disease.
  • direct administration means the immunoconjugate and/or other cancer therapeutic may be administered, without limitation, intratumorally, intravascular ⁇ , and peritumoraliy.
  • the immunoconjugate may be administered by one or more direct injections into the tumor, by continuous or discontinuous perfusion into the tumor, by introduction of a reservoir of the immunoconjugate, by introduction of a slow-release apparatus into the tumor, by introduction of a slow-release formulation into the tumor, and/or by direct application onto the tumor.
  • the phrase "effective amount” means an amount effective, at dosages and for periods of time necessary to achieve the desired result. Effective amounts of an immunoconjugate may vary according to factors such as the disease state, age, sex, weight of the animal. Dosage regime may be adjusted to provide the optimum therapeutic response. For example, several divided doses may be administered daily or the dose may be proportionally reduced as indicated by the exigencies of the therapeutic situation.
  • Glucose transporter 8 is a protein encoded by gene slc2a8, which is found on human chromosome 9. It is a member of class III of the GLUT family of proteins and is known to have sugar transporting activity. GLUT8 is 477 amino acids in length. It is a ⁇ 50 kDa type Il transmembrane protein. It has 12 transmembrane regions. It has a short putative extracellular loop between TM1 and TM2 and a long extracellular loop between TM9 and TM 10. The term includes variants of GLUT8. (GLUT/SLC2A family nomenclature: Amer. J. Physiol. Endocrinol. Metab. 282 ⁇ 974-76, 2002.)
  • heavy chain complementarity determining region refers to regions of hypervariability within the heavy chain variable region of an antibody molecule.
  • the heavy chain variable region has three complementarity determining regions termed heavy chain complementarity determining region 1 , heavy chain complementarity determining region 2 and heavy chain complementarity determining region 3 from the amino terminus to carboxy terminus.
  • heavy chain variable region refers to the variable region of a heavy chain.
  • immunoconjugate of the invention comprises (1) a binding protein, preferably an antibody or antibody fragment, of the invention attached to (2) an effector molecule.
  • the effector molecule can be any molecule that one wishes to deliver to the cancer cell, including, but not limited to (i) a label, which can generate a detectable signal, directly or indirectly, or (ii) a cancer therapeutic agent, such as a toxin that is either cytotoxic, cytostatic or otherwise prevents or reduces the ability of the cancer cells to divide and/or metastasize.
  • isolated nucleic acid sequences refers to a nucleic acid substantially free of cellular material or culture medium when produced by recombinant DNA techniques, or chemical precursors, or other chemicals when chemically synthesized.
  • An isolated nucleic acid is also substantially free of sequences which naturally flank the nucleic acid (i.e. sequences located at the 5' and 3 1 ends of the nucleic acid) from which the nucleic acid is derived.
  • nucleic acid is intended to include DNA and RNA and can be either double stranded or single stranded.
  • isolated proteins refers to a protein substantially free of cellular material or culture medium when produced by recombinant DNA techniques, or chemical precursors or other chemicals when chemically synthesized. It includes the light chain complementarity regions 1 , 2 and 3 of the invention, heavy chain complementarity regions 1 , 2 and 3 of the invention, light chain variable regions of the invention, heavy chain variable regions of the invention, binding proteins of the invention and antigen to which the binding proteins of the invention bind.
  • light chain complementarity determining region refers to regions of hypervariability within the light chain variable region of an antibody molecule.
  • Light chain variable regions have three complementarity determining regions termed light chain complementarity determining region 1 , light chain complementarity determining region 2 and light chain complementarity determining region 3 from the amino terminus to the carboxy terminus.
  • modified bouganin refers to a modified bouganin that has a reduced propensity to activate an immune response as described in PCT/CA2005/000410 and United States Patent Application No. 11.084,080.
  • the modified bouganin has the amino acid sequence (SEQ ID NO: 29): YNTVSFNLGEAYEYPTFIQDLRNELAKGTPVCQLPVTLQTIADDKRFV
  • nucleic acid sequence refers to a sequence of nucleoside or nucleotide monomers consisting of naturally occurring bases, sugars and intersugar (backbone) linkages. The term also includes modified or substituted sequences comprising non-naturally occurring monomers or portions thereof.
  • the nucleic acid sequences of the present invention may be deoxyribonucleic acid sequences (DNA) or ribonucleic acid sequences (RNA) and may include naturally occurring bases including adenine, guanine, cytosine, thymidine and uracil.
  • the sequences may also contain modified bases. Examples of such modified bases include aza and deaza adenine, guanine, cytosine, thymidine and uracil; and xanthine and hypoxanthine.
  • sample refers to any fluid, cell or tissue sample from a subject which can be assayed for cancer.
  • sequence identity refers to the percentage of sequence identity between two polypeptide sequences. In order to determine the percentage of identity between two polypeptide sequences, the amino acid sequences of such two sequences are aligned, preferably using the Clustal W algorithm (Thompson, JD 1 Higgins DG, Gibson TJ, 1994, Nucleic Acids Res. 22 (22): 4673-4680), together with BLOSUM 62 scoring matrix (Henikoff S. and Henikoff J.G., 1992, Proc. Natl. Acad. Sci.
  • N-terminal di-leucine motif refers to the N-terminal di- leucine motif in GLUT8 that is involved in localization of the protein to the intracellular compartment of the cell. In one embodiment of the invention, the di-leucine motif is at positions 12 to 13 of GLUT8.
  • subject refers to any member of the animal kingdom, preferably a mammal, more preferably a human being. In a preferred embodiment, the subject is suspected of having or has cancer.
  • treating cancer refers to inhibiting cancer ceil replication, inhibiting cancer spread (metastasis), inhibiting tumor growth, reducing cancer cell number or tumor growth, decreasing the malignant grade of a cancer (e.g., increased differentiation), or improving cancer-related symptoms.
  • variants of proteins of the invention include modifications or chemical equivalents of the amino acid and nucleotide sequences of the present invention that perform substantially the same function as the proteins or nucleic acid molecules of the invention in substantially the same way.
  • variants of proteins of the invention include, without limitation, conservative amino acid substitutions.
  • variants of proteins of the invention also include additions and deletions to the proteins of the invention.
  • variant peptides and variant nucleotide sequences include analogs and derivatives thereof.
  • the invention provides isolated light chain complementarity determining region 1 comprising the amino acid sequence RASQDISNYLA (SEQ ID NO:1).
  • the invention also provides isolated light chain complementarity determining region 2 comprising the amino acid sequence AASSLHS (SEQ ID NO:2).
  • the invention provides isolated light chain complementarity determining region 3 comprising the amino acid sequence LQYSTYPIT (SEQ ID NO:3).
  • the invention provides isolated heavy chain complementarity determining region 1 comprising the amino acid sequence NYAMS (SEQ ID NO:4).
  • the invention also provides isolated heavy chain complementarity determining region 2 comprising the amino acid sequence AITPSGGSTNYADSVKG (SEQ ID NO:5).
  • the invention provides isolated heavy chain complementarity determining region 3 comprising the amino acid sequence VPYRSTWYPLY (SEQ ID NO:6).
  • the invention provides isolated light chain complementarity determining regions 1, 2 and 3, comprising the amino acid sequences RASQDISNYLA (SEQ ID NO: 1), AASSLHS (SEQ ID NO:2) and LQYSTYPIT (SEQ ID NO:3), respectively; and isolated heavy chain complementarity determining regions 1 , 2 and 3, comprising the amino acid sequences NYAMS (SEQ ID NO:4), AITPSGGSTNYADSVKG (SEQ ID NO:5) and VPYRSTWYPLY (SEQ ID NO:6), respectively.
  • the invention also includes variants of the CDR sequences that can bind to the same epitope or antigen recognized by the CDR sequences disclosed above.
  • Additional aspects of the invention are isolated light chain variable regions comprising light chain complementarity determining regions 1 , 2 and/or 3 of the invention (SEQ ID NOS: 1-3); and heavy chain variable regions comprising the heavy chain complementarity determining regions 1, 2 and/or 3 of the invention (SEQ ID NOS:4-6).
  • the light chain variable region comprises the amino acid sequence shown in Figure 1 (SEQ ID NO:7)
  • the heavy chain variable region comprises the amino acid sequence shown in Figure 2 (SEQ ID NO:9).
  • the invention also includes variants of the isolated light chain variable regions and heavy chain variable regions that can bind to the same epitope or antigen recognized by the isolated light chain variable regions and isolated heavy chain variable regions disclosed above.
  • equivalents include proteins that perform substantially the same function as the specific proteins disclosed herein in substantially the same way.
  • a functional variant of a CDR sequence will be able to bind to the antigen or epitope recognized by the native CDR sequence.
  • equivalents include, without limitation, conservative amino acid substitutions.
  • the variant amino acid sequences of the light chain complementarity determining regions 1 , 2 and 3, and the heavy chain complementarity determining regions 1 , 2 and 3 have at least 50%, preferably at least 60%, more preferably at least 70%, most preferably at least 80%, and even more preferably at least 90% sequence identity to SEQ ID NOS: 1-6, respectively.
  • the variant amino acid sequences of the light chain variable region and the heavy chain variable region have at least 50%, preferably at least 60%, more preferably at least 70%, most preferably at least 80%, and even more preferably at least 90% sequence identity to SEQ ID NOS:7 and 9, respectively.
  • the invention also provides an isolated nucleic acid sequence encoding the light chain variable region of the invention, and an isolated nucleic acid sequence encoding the heavy chain variable region of the invention.
  • the light chain variable region comprises the nucleic acid sequence shown in Figure 1 (SEQ ID NO: 8).
  • the heavy chain variable region comprises the nucleic acid sequence shown in Figure 2 (SEQ ID NO:10).
  • the invention also includes variants to the nucleic acid sequences that encode for the light chain variable region and heavy chain variable region of the invention.
  • the variants include nucleotide sequences that hybridize to the nucleic acid sequences encoding the light chain variable region and heavy chain variable region of the invention under at least moderately stringent hybridization conditions.
  • the invention also provides isolated nucleic acid sequences encoding light chain complementarity determining regions 1 , 2 and/or 3, comprising the amino acid sequences RASQDISNYLA (SEQ ID NO:1), AASSLHS (SEQ ID NO:2) and LQYSTYPIT (SEQ ID NO:3), respectively; and isolated nucleic acid sequences encoding heavy chain complementarity determining regions 1 , 2 and/or 3, comprising the amino acid sequences NYAMS (SEQ ID NO:4), AITPSGGSTNYADSVKG (SEQ ID NO:5) and VPYRSTWYPLY (SEQ ID NO:6), respectively.
  • the invention also provides an isolated nucleic acid sequence encoding the light chain variable region shown in Figure 1 (SEQ ID NO:7), and an isolated nucleic acid sequence encoding the heavy chain variable region shown in Figure 2 (SEQ ID NO:9).
  • the invention also includes isolated nucleic acid sequences encoding variants of the. CDR sequences and variable region sequences discussed above.
  • Variant nucleic acid sequences include nucleic acid sequences that hybridize to the nucleic acid sequences encoding the amino acid sequences shown in SEQ ID NOS: 1-6, 7 and 9 and variants thereof under at least moderately stringent hybridization conditions.
  • binding protein preferably an antibody or antibody fragment, that comprises at least one light chain complementarity determining region of the invention (i.e. one or more of SEQ ID NOS: 1-3) and/or at least one heavy chain complementarity determining region of the invention (i.e. one or more of SEQ ID NOS:4-6).
  • a binding protein can be generally referred to herein as "a binding protein of the invention", or preferably “an antibody or antibody fragment of the invention”.
  • the binding protein preferably an antibody or antibody fragment, comprises the light chain complementarity determining regions 1 , 2 and 3, comprising the amino acid sequences RASQDISNYLA (SEQ ID NO:1), AASSLHS (SEQ ID NO:2) and LQYSTYPIT (SQ ID NO:3), respectively; and heavy chain complementarity determining regions 1 , 2 and 3, comprising the amino acid sequences NYAMS (SEQ ID NO:4), AITPSGGSTNYADSVKG (SEQ ID NO:5) and VPYRSTWYPLY (SEQ ID NO:6), respectively.
  • the invention also provides a binding protein, preferably an antibody or antibody fragment, that comprises the light chain variable region shown in Figure 1 (SEQ ID NO:7) and/or the heavy chain variable region shown in Figure 2 (SEQ ID NO:9).
  • the invention includes variants to the specific binding proteins disclosed above, including chemical equivalents to the sequences disclosed above that perform substantially the same function as the binding proteins disclosed above in substantially the same way.
  • a functional variant of a binding protein will be able to bind to the same antigen as the binding proteins disclosed above.
  • the binding protein binds to glucose transporter 8 or variants thereof, a protein comprising any one of the amino acid sequences of SEQ ID NOS:11-20, preferably SEQ ID NOS: 11-13, or a cancer-associated variant of GLUT8 that is expressed on the surface of cancer cells.
  • the invention includes a binding protein that is specific for a cancer-associated variant of glucose transporter 8.
  • the cancer-associated variant of glucose transporter 8 comprises any one of the amino acid sequences defined by SEQ ID NOS: 11- 13, or a variant thereof.
  • the cancer- associated variant of GLUT8 comprises GLUT8 that has a modification in the N-terminal di-leucine motif.
  • the N- terminal di-leucine motif has been modified to di-alanine.
  • the antibody or antibody fragment comprises all or a portion of a heavy chain constant region, such as an IgGI , lgG2, lgG3, lgG4, IgAI , lgA2, IgE, IgM or IgD constant region.
  • the heavy chain constant region is an IgGI heavy chain constant region.
  • the antibody or antibody fragment can comprise all or a portion of a kappa light chain constant region or a lambda light chain constant region.
  • the light chain constant region is a kappa light chain constant region.
  • antibody producing cells can be harvested from a human having cancer and fused with myeloma cells by standard somatic cell fusion procedures thus immortalizing these cells and yielding hybridoma cells.
  • Such techniques are well known in the art, (e.g. the hybridoma technique originally developed by Kohler and Milstein (Nature 256:495-497 (1975)) as well as other techniques such as the human B-cell hybridoma technique (Kozbor et al., Immunol.
  • Hybridoma cells can be screened immunochemically for production of antibodies specifically reactive with cancer cells and the monoclonal antibodies can be isolated.
  • Specific antibodies, or antibody fragments, reactive against particular antigens or molecules, such as antigens or molecules on a cancer cell may also be generated by screening expression libraries encoding immunoglobulin genes, or portions thereof, expressed in bacteria with cell surface components.
  • Fab fragments, VH regions and FV regions can be expressed in bacteria using phage expression libraries (See for example Ward et al., Nature 341:544-546 (1989); Huse et al., Science 246:1275-1281 (1989); and McCafferty et al., Nature 348:552-554 (1990)).
  • the present invention includes all antibodies and antibody fragments that bind to the same antigen as the antibodies or antibody fragments of the invention.
  • binding assays can be used to find other antibodies and antibody fragments with the same binding specificities as the antibodies and antibody fragments of the invention.
  • a competition binding assay can be used to find such other antibodies.
  • the minimal concentration of antibody of the invention (Ab1) that gives maximal binding against a fixed number of cancer cells (for example, A-375 cells for VB1-050) is determined. A total of 10 6 cells are harvested from exponentially growing cultures and incubated with various antibody concentrations for 1 hr at 4 0 C.
  • the cells are washed and incubated with a suitable detection antibody for an additional hour at 4 0 C. After washing, the cells are analyzed by flow cytometry. For each test antibody, a saturation curve is generated from the data by plotting median fluorescence against the antibody concentration.
  • cancer cells are prepared as above and treated in duplicate with a fixed concentration of antibody (Ab1). The fixed concentration is the minimal concentration of antibody that generates maximal binding against a fixed number of cancer cells as determined above.
  • varying concentrations of the potential inhibitory antibody (Ab2) is added to each tube and the mixture incubated for 1 hr at 4 0 C.
  • MF(Abi+Ab2) median fluorescence measured for Ab1+Ab2 mixture
  • MF ⁇ gd background median fluorescence with PBS-5% FCS.
  • the invention provides a binding protein capable of binding an antigen on a cancer cell wherein the binding protein can be identified by a method comprising:
  • Pl [(MF(AbI + Ab 2 ) - MF B gd)/(MF Ab1 - MF Bgd )] x 100; and (5) comparing the Pl to a control Pl value; wherein, a Pl that has a statistically significant difference from the control Pl indicates that the test binding protein is capable of binding the antigen on the cancer cell.
  • affinity maturation techniques could be used modify the binding proteins or immunoconjugates of the invention by increasing its affinity for its antigen, glucose transporter 8 or variants thereof.
  • Two strategies are routinely used to enhance the binding affinity of an antibody.
  • One approach utilizes the resolution of the crystal structure of the Ab-Ag complex to identify the key residues involved in the antigen binding (Davies D. R., Cohen G. H. 1996. Interactions of protein antigens with antibodies. Proc Natl. Acad. Sci. U. S A. 93, 7-12). Subsequently, those residues can be mutated to enhance the interaction.
  • the other approach mimics an in vivo antigen stimulation that drives the affinity maturation of immunoglobulin produced by B cells. During the maturation of the immune response, the variable regions of the immunoglobulins are subjected to somatic mutations (Mc Heyzer-Williams M. 2003.
  • the targeted mutations of the CDRs have been shown to be an effective technique for increasing antibody affinity.
  • Blocks of 3 to 4 amino acids of the CDR3 or specific regions called "hot-spots" are targeted for mutagenesis.
  • Yang et al reported an increase of 420 fold of an anti-HIV gp120 Fab fragment by mutating four CDR residues (Yang W.P., Green K., Pinz-Sweeney S., Briones AT., Burton D. R. and Barbas CF. III. 1995.
  • CDR walking mutagenesis for the affinity maturation of a potent human anti-HIV-1 antibody into picomolar range. J.Mol.Biol., 254, 392-403).
  • Hot spots are the sequences where somatic hypermutation takes place in vivo (Neuberger M. S and Milstein C. 1995. Somatic hypermutation. Curr. Opin. Immunol. 7, 248-254).
  • the hotspot sequences can be defined as consensus nucleotide sequences in certain codons.
  • the consensus sequence is the tetranucleotide, RGYW, in which R can be either A or G, Y can be C or T and W can be either A or T (Neuberger M. S and Milstein C. 1995. Somatic hypermutation. Curr. Opin. Immunol. 7, 248-254).
  • the serine residues encoded by the nucleotides AGY are predominantly present in the CDRs regions of the variable domain over those encoded by TCN corresponding to a potential hot-spot sequences (Wagner S.D., Milstein C. and Neuberger M.S. 1995. Codon bias targets mutation. Nature, 376, 732).
  • the structural analysis has shown that the CDR loops contribute the most to the antigen binding, especially the CDR3 loops (Giudicelli V., Chaume D. and Lefranc MP. 2004. IMGT/V-QUEST, an integrated software program for immunoglobulin and T cell receptor V-J and V-D-J rearrangement analysis. Nucleic Acids Res. 32, 435-440).
  • the nucleotide sequence of the CDRs of the heavy and light chains of each antibody of the invention is scanned for the presence of the hot-spot sequences and AGY codons.
  • the identified hot-spots of the CDR regions of the light and heavy chain are compared to the germinal sequences of the heavy and light chains using the International ImMunoGen Tics database (IMGT, http://imgt.cines.fr/textes/vquest/) (Davies D. R., Padlan E.A. and Sheriff S. 1990. Antibody-antigen complexes. Annu. Rev. Biochem. 59, 439-473).
  • IMGT International ImMunoGen Tics database
  • a different sequence shows that some somatic mutations have already occurred. It will remain to be determined if the in vivo somatic mutation was optimal.
  • the hot-spots that code for buried or conserved amino acids within the CDRs are not mutagenized. These residues are usually critical for the overall structure and are unlikely to interact with the antigen since they are buried.
  • the sequences can be compared to the predicted locations in the germ line sequences where somatic mutations occurred predominantly (Tomlinson I. M., Cox J.P.L., Gherardi E., Lesk A.M.
  • the antibodies are expressed and assessed for function. For instance, functional screening can be based on binding. Once function is assessed, then DNA sequencing of the chosen antibodies can be carried out using known methods.
  • the invention includes binding proteins of the invention that have been affinity maturized to increase the affinity of the binding protein to glucose transporter 8 or variants thereof; a protein comprising amino acid sequences of SEQ ID NOS:11-20, preferably SEQ ID NOS:11-13; or a cancer-associated variant of glucose transporter 8.
  • the invention also provides compositions comprising the binding proteins of the invention, preferably antibodies and antibody fragments, with a pharmaceutically acceptable excipient, carrier, buffer or stabilizer.
  • the invention includes an isolated protein that can specifically bind with one of the binding proteins of the invention, and nucleic acid sequences and uses thereof.
  • the invention provides an isolated protein comprising glucose transporter 8 or variants thereof.
  • the invention provides an isolated protein comprising any one of the amino acid sequences of SEQ ID NOS: 11-20 or variants thereof.
  • the invention provides an isolated protein comprising the amino acid sequence of SEQ ID NO:11 or a variant thereof.
  • the invention also provides an isolated protein comprising the amino acid sequence of SEQ ID NO: 12 or a variant thereof. Further, the invention provides an isolated protein comprising the amino acid sequence of SEQ ID NO: 13 or a variant thereof. In addition, the invention provides a cancer-associated variant of glucose transporter 8 that is expressed on the surface of cancer cells.
  • the cancer-associated variant of GLUT8 comprises the amino acid sequence defined by any one of SEQ ID NOS: 11 , 12 or 13, or variants thereof. In another embodiment of the invention, the cancer-associated variant of GLUT8, comprises GLUT8 that has a modification in the N-terminal di-leucine motif.
  • the N-terminal di-leucine motif has been modified to di-alanine.
  • the invention includes variants to the amino acid sequences of SEQ ID NOS: 11 -13, including chemical equivalents to the sequences disclosed by the present invention.
  • Such equivalents include proteins that perform substantially the same function as the specific proteins disclosed herein in substantially the same way.
  • equivalents include, without limitation, conservative amino acid substitutions.
  • the variant amino acid sequences of the isolated proteins of the invention have at least 50%, preferably at least 60%, more preferably at least 70%, most preferably at least 80%, and even more preferably at least 90% sequence identity to SEQ ID NOS: 11-13.
  • the invention includes the use of the isolated protein.
  • the invention includes the use of the isolated proteins of the invention in the manufacture of a medicament to treat or prevent cancer.
  • C Immunoconiuqates
  • the invention also includes an immunoconjugate comprising (1) a binding protein of the invention, preferably an antibody or antibody fragment, that has been attached to (2) an effector molecule.
  • the binding protein of the invention binds to an antigen or molecule on a cancer cell.
  • the antigen can be glucose transporter 8 or variants thereof; a protein comprising any one of the amino acid sequences defined by SEQ ID NOS: 11-20, preferably SEQ ID NOS:11 , 12 or 13; or a cancer-associated variant of glucose transporter 8.
  • the cancer- associated variant of GLUT8 comprises the amino acid sequence defined by any one of SEQ ID NOS: 11 , 12 or 13, or variants thereof.
  • the cancer-associated variant of GLUT8 comprises GLUT8 that has a modification in the N-terminal di-leucine motif.
  • the N-terminal di-leucine motif has been modified to di-alanine.
  • the effector molecule is (i) a label, which can generate a detectable signal, directly or indirect, or (ii) a cancer therapeutic agent, which is either cytotoxic, cytostatic or otherwise prevents or reduces the ability of the cancer cells to divide and/or metastasize.
  • a label which can generate a detectable signal, directly or indirect
  • a cancer therapeutic agent which is either cytotoxic, cytostatic or otherwise prevents or reduces the ability of the cancer cells to divide and/or metastasize.
  • the effector molecule is a cancer therapeutic agent.
  • the cancer therapeutic agent is preferably a toxin that is either cytotoxic, cytostatic or otherwise prevents or reduces the ability of the cancer cells to divide and/or metastasize.
  • one aspect of the invention is an immunoconjugate comprising (1) a binding protein of the invention, preferably an antibody or antibody fragment, attached to (2) a cancer therapeutic agent, such as a cytotoxin.
  • the immunoconjugate is internalized and the cancer therapeutic agent is a cytotoxin that blocks the protein synthesis of the cell, therein leading to cell death.
  • the cancer therapeutic agent is a cytotoxin that blocks the protein synthesis of the cell, therein leading to cell death.
  • effector molecules may be used in the immunoconjugates of the invention and a number of such effector molecules are intracellular ⁇ active molecules. Accordingly, in an embodiment of the invention, the immunoconjugate is internalized by the cancer cell.
  • the effector molecule is a cancer therapeutic agent, more preferably a cytotoxin that comprises a polypeptide having ribosome-inactivating activity including, without limitation, gelonin, bouganin, saporin, ricin, ricin A chain, bryodin, diphtheria toxin, restrictocin, Pseudomonas exotoxin A and variants thereof.
  • the protein is a ribosome-inactivating protein
  • the immunoconjugate must be internalized upon binding to the cancer cell in order for the protein to be cytotoxic to the cells.
  • the effector molecule is a cytotoxin and the immunoconjugate is internalized by the cancer cell.
  • the toxin is bouganin or Pseudomonas exotoxin A, and variants thereof.
  • the toxin is modified bouganin or a truncated form of Pseudomonas exotoxin A that lacks the cell binding domain.
  • the toxin is a bouganin substantially devoid of T-cell epitopes or a truncated form of Pseudomonas exotoxin A that consists of amino acids 252-608.
  • the cancer therapeutic agent comprises an agent that acts to disrupt DNA.
  • the cancer therapeutic agents may be selected, without limitation, from enediynes (e.g., calicheamicin and esperamicin) and non-enediyne small molecule agents (e.g., bleomycin, methidiumpropyl-EDTA-Fe(ll)).
  • Other cancer therapeutic agents useful in accordance with the invention include, without limitation, daunorubicin, doxorubicin, distamycin A, cisplatin, mitomycin C, ecteinascidins, duocarmycin/CC-1065, and bleomycin/pepleomycin.
  • the cancer therapeutic agent comprises an agent that acts to disrupt tubulin.
  • agents may comprise, without limitation, rhizoxin/maytansine, paclitaxel, vincristine and vinblastine, colchicine, auristatin dolastatin 10 MMAE, and peloruside A.
  • the cancer therapeutic portion of an immunoconjugate of the invention may comprise an alkylating agent including, without limitation, Asaley NSC 167780, AZQ NSC 182986, BCNU NSC 409962, Busulfan NSC 750, carboxyphthalatoplatinum NSC 271674, CBDCA NSC 241240, CCNU NSC 79037, CHIP NSC 256927, chlorambucil NSC 3088, chlorozotocin NSC 178248, cis-platinum NSC 119875, clomesone NSC 338947, cyanomorpholinodoxorubicin NSC 357704, cyclodisone NSC 348948, dianhydrogalactitol NSC 132313, fluorodopan NSC 73754, hepsulfam NSC 329680, hycanthone NSC 142982, melphalan NSC 8806, methyl CCNU NSC 95441 , mitomycin C NSC
  • the cancer therapeutic agent portion of the immunoconjugate of the invention may comprise an antimitotic agent including, without limitation, allocolchicine NSC 406042, Halichondrin B NSC 609395, colchicine NSC 757, colchicine derivative NSC 33410, dolastatin 10 NSC 376128 (NG - auristatin derived), maytansine NSC 153858, rhizoxin NSC 332598, taxol NSC 125973, taxol derivative NSC 608832, thiocolchicine NSC 361792, trityl cysteine NSC 83265, vinblastine sulfate NSC 49842, and vincristine sulfate NSC 67574.
  • an antimitotic agent including, without limitation, allocolchicine NSC 406042, Halichondrin B NSC 609395, colchicine NSC 757, colchicine derivative NSC 33410, dolastatin 10 NSC 376128 (NG - auristatin derived
  • the cancer therapeutic agent portion of the immunoconjugate of the invention may comprise an topoisomerase I inhibitor including, without limitation, camptothecin NSC 94600, camptothecin, Na salt NSC 100880, aminocamptothecin NSC 603071 , camptothecin derivative NSC 95382, camptothecin derivative NSC 107124, camptothecin derivative NSC 643833, camptothecin derivative NSC 629971 , camptothecin derivative NSC 295500, camptothecin derivative NSC 249910, camptothecin derivative NSC 606985, camptothecin derivative NSC 374028, camptothecin derivative NSC 176323, camptothecin derivative NSC 295501 , camptothecin derivative NSC 606172, camptothecin derivative NSC 606173, camptothecin derivative NSC 610458, camptothecin derivative NSC 618939, camptothecin derivative NSC 610457
  • cancer therapeutic agent portion of the immunoconjugate of the invention may comprise an topoisomerase Il inhibitor including, without limitation, doxorubicin NSC 123127, amonafide NSC 308847, m-AMSA NSC 249992, anthrapyrazole derivative NSC 355644, pyrazoloacridine NSC 366140, bisantrene HCL NSC 337766, daunorubicin NSC 82151 , deoxydoxorubicin NSC 267469, mitoxantrone NSC 301739, menogaril NSC 269148, N,N-dibenzyl daunomycin NSC 268242, oxanthrazole NSC 349174, rubidazone NSC 164011, VM-26 NSC 122819, and VP-16 NSC 141540.
  • an topoisomerase Il inhibitor including, without limitation, doxorubicin NSC 123127, amonafide NSC 308847, m-
  • the cancer therapeutic agent portion of the immunoconjugate of the invention may comprise an RNA or DNA antimetabolite including, without limitation, L-alanosine NSC 153353, 5- azacytidine NSC 102816, 5-fluorouracil NSC 19893, acivicin NSC 163501 , aminopterin derivative NSC 132483, aminopterin derivative NSC 184692, aminopterin derivative NSC 134033, an antifol NSC 633713, an antifol NSC 623017, Baker's soluble antifol NSC 139105, dichlorallyl lawsone NSC 126771 , brequinar NSC 368390, ftorafur (pro-drug) NSC 148958, 5,6-dihydro- 5-azacytidine NSC 264880, methotrexate NSC 740, methotrexate derivative NSC 174121 , N-(phosphonoacetyl)-L-as
  • the therapeutic portion of the immunoconjugates may be a nucleic acid.
  • Nucleic acids that may be used include, but are not limited to, anti-sense RNA, genes or other polynucleotides, nucleic acid analogs such as thioguanine and thiopurine.
  • the present invention further provides immunoconjugates comprising (i) a binding protein of the invention, preferably an antibody or antibody fragment, attached to (2) an effector molecule, wherein the effector molecule is a label, which can generate a detectable signal, indirectly or directly.
  • immunoconjugates can be used for research or diagnostic applications, such as for the in vivo detection of cancer.
  • the label is preferably capable of producing, either directly or indirectly, a detectable signal.
  • the label may be radio-opaque or a radioisotope, such as 3 H, 14 C, 32 P, 35 S, 123 I, 125 I, 131 I; a fluorescent (fluorophore) or chemiluminescent (chromophore) compound, such as fluorescein isothiocyanate, rhodamine or luciferin; an enzyme, such as alkaline phosphatase, beta-galactosidase or horseradish peroxidase; an imaging agent; or a metal ion.
  • a radioisotope such as 3 H, 14 C, 32 P, 35 S, 123 I, 125 I, 131 I
  • a fluorescent (fluorophore) or chemiluminescent (chromophore) compound such as fluorescein isothiocyanate, rhodamine or luciferin
  • an enzyme such as alkaline phosphatase, beta-galactosidase or horseradish
  • the immunoconjugate is detectable indirectly.
  • a secondary antibody that is specific for the immunoconjugate and contains a detectable label can be used to detect the immunoconjugate.
  • the binding protein of the invention may be "attached to" the effector molecule by any means by which the binding protein can be associated with, or linked to, the effector molecule.
  • the binding protein may be attached to the effector molecule by chemical or recombinant means. Chemical means for preparing fusions or conjugates are known in the art and can be used to prepare the immunoconjugate.
  • the method used to conjugate the binding protein and effector molecule must be capable of joining the binding protein with the effector molecule without interfering with the ability of the binding protein to bind to the antigen on the cancer cell.
  • the binding protein of the invention may be linked indirectly to the effector molecule.
  • the binding protein may be directly linked to a liposome containing the effector molecule of one of several types.
  • the effector molecule(s) and/or binding protein may also be bound to a solid surface.
  • the binding protein preferably an antibody or antibody fragment, and effector molecule are both proteins and can be conjugated using techniques well known in the art.
  • crosslinkers There are several hundred crosslinkers available that can conjugate two proteins. (See for example "Chemistry of Protein Conjugation and Crosslinking". 1991 , Shans Wong, CRC Press, Ann Arbor).
  • the crosslinker is generally chosen based on the reactive functional groups available or inserted on the binding protein, preferably an antibody or antibody fragment, and/or effector molecule.
  • a photoactivatible crosslinker can be used.
  • Crosslinking agents known to the art include the homobifunctional agents: glutaraldehyde, dimethyladipimidate and Bis(diazobenzidine) and the heterobifunctional agents: m Maleimidobenzoyl-N-Hydroxysuccinimide and Sulfo-m Maleimidobenzoyl-N-Hydroxysuccinimide.
  • a binding protein-effector molecule protein fusion may also be prepared using recombinant DNA techniques.
  • a DNA sequence encoding the binding protein is fused to a DNA sequence encoding the effector molecule, resulting in a chimeric DNA molecule.
  • the chimeric DNA sequence is transfected into a host cell that expresses the fusion protein.
  • the fusion protein can be recovered from the cell culture and purified using techniques known in the art.
  • Examples of attaching an effector molecule, which is a label, to the binding protein include the methods described in Hunter, et al., Nature 144:945 (1962); David, et al., Biochemistry 13:1014 (1974); Pain, et al., J. Immunol. Meth. 40:219 (1981); Nygren, J. Histochem. and Cytochem. 30:407 (1982); Wensel and Meares, Radioimmunoimaging And Radioimmunotherapy, Elsevier, N.Y.
  • proteins of the invention such as the light and heavy complementarity determining regions, the light and heavy chain variable regions, antibodies and antibody fragments, immunoconjugates and novel cancer-associated antigens of the invention, may be prepared in any of several ways, but is most preferably prepared using recombinant methods.
  • the nucleic acid molecules of the present invention may be incorporated in a known manner into an appropriate expression vector which ensures good expression of the proteins of the invention.
  • Possible expression vectors include but are not limited to cosmids, plasmids, or modified viruses (e.g. replication defective retroviruses, adenoviruses and adeno-associated viruses), so long as the vector is compatible with the host cell used.
  • the expression vectors are "suitable for transformation of a host cell", which means that the expression vectors contain a nucleic acid molecule of the invention and regulatory sequences selected on the basis of the host cells to be used for expression, which is operatively linked to the nucleic acid molecule.
  • Operatively linked is intended to mean that the nucleic acid is linked to regulatory sequences in a manner which allows expression of the nucleic acid.
  • the invention therefore contemplates a recombinant expression vector of the invention containing a nucleic acid molecule of the invention, or a fragment thereof, and the necessary regulatory sequences for the transcription and translation of the inserted protein-sequence.
  • Suitable regulatory sequences may be derived from a variety of sources, including bacterial, fungal, viral, mammalian, or insect genes (For example, see the regulatory sequences described in Goeddel, Gene Expression Technology: Methods in Enzymology 185, Academic Press, San Diego, CA (1990)). Selection of appropriate regulatory sequences is dependent on the host cell chosen as discussed below, and may be readily accomplished by one of ordinary skill in the art. Examples of such regulatory sequences include: a transcriptional promoter and enhancer or RNA polymerase binding sequence, a ribosomal binding sequence, including a translation initiation signal.
  • recombinant expression vectors of the invention may also contain a selectable marker gene which facilitates the selection of host cells transformed or transfected with a recombinant molecule of the invention.
  • selectable marker genes are genes encoding a protein such as G418 and hygromycin which confer resistance to certain drugs, ⁇ - galactosidase, chloramphenicol acetyltransferase, firefly luciferase, or an immunoglobulin or portion thereof such as the Fc portion of an immunoglobulin preferably IgG. Transcription of the selectable marker gene is monitored by changes in the concentration of the selectable marker protein such as ⁇ -galactosidase, chloramphenicol acetyltransferase, or firefly luciferase. If the selectable marker gene encodes a protein conferring antibiotic resistance such as neomycin resistance transformant cells can be selected with G418.
  • selectable marker gene will survive, while the other cells die. This makes it possible to visualize and assay for expression of recombinant expression vectors of the invention and in particular to determine the effect of a mutation on expression and phenotype. It will be appreciated that selectable markers can be introduced on a separate vector from the nucleic acid of interest.
  • the recombinant expression vectors may also contain genes which encode a fusion moiety which provides increased expression of the recombinant protein; increased solubility of the recombinant protein; and aid in the purification of the target recombinant protein by acting as a ligand in affinity purification.
  • a proteolytic cleavage site may be added to the target recombinant protein to allow separation of the recombinant protein from the fusion moiety subsequent to purification of the fusion protein.
  • Typical fusion expression vectors include pGEX (Amrad Corp., Melbourne, Australia), pMal (New England Biolabs, Beverly, MA) and pRIT5 (Pharmacia, Piscataway, NJ) which fuse glutathione S-transferase (GST), maltose E binding protein, or protein A, respectively, to the recombinant protein.
  • GST glutathione S-transferase
  • Recombinant expression vectors can be introduced into host cells to produce a transformed host cell.
  • the terms “transformed with”, “transfected with”, “transformation” and “transfection” are intended to encompass introduction of nucleic acid (e.g. a vector) into a cell by one of many possible techniques known in the art.
  • the term “transformed host cell” as used herein is intended to also include cells capable of glycosylation that have been transformed with a recombinant expression vector of the invention.
  • Prokaryotic cells can be transformed with nucleic acid by, for example, electroporation or calcium-chloride mediated transformation.
  • nucleic acid can be introduced into mammalian cells via conventional techniques such as calcium phosphate or calcium chloride co-precipitation, DEAE-dextran mediated transfection, lipofectin, electroporation or microinjection.
  • conventional techniques such as calcium phosphate or calcium chloride co-precipitation, DEAE-dextran mediated transfection, lipofectin, electroporation or microinjection.
  • Suitable methods for transforming and transfecting host cells can be found in Sambrook et al. (Molecular Cloning: A Laboratory Manual, 3rd Edition, Cold Spring Harbor Laboratory Press, 2001), and other laboratory textbooks.
  • Suitable host cells include a wide variety of eukaryotic host cells and prokaryotic cells.
  • the proteins of the invention may be expressed in yeast cells or mammalian cells. Other suitable host cells can be found in Goeddel, Gene Expression Technology: Methods in Enzymology 185, Academic Press, San Diego, CA (1991).
  • the proteins of the invention may be expressed in prokaryotic cells, such as Escherichia coli (Zhang et al., Science 303(5656): 371-3 (2004)).
  • a Pseudomonas based expression system such as Pseudomonas fluorescens can be used (US Patent Application Publication No. US 2005/0186666, Schneider, Jane C et al.).
  • Yeast and fungi host cells suitable for carrying out the present invention include, but are not limited to Saccharomyces cerevisiae, the genera Pichia or Kluyveromyces and various species of the genus Aspergillus.
  • yeast S. cerevisiae examples include pYepSed (Baldari. et al., Embo J. 6:229-234 (1987)), pMFa (Kurjan and Herskowitz, Cell 30:933-943 (1982)), pJRY88 (Schultz et al., Gene 54:113-123 (1987)), and pYES2 (Invitrogen Corporation, San Diego, CA).
  • Mammalian cells suitable for carrying out the present invention include, among others: COS (e.g., ATCC No. CRL 1650 or 1651), BHK (e.g. ATCC No. CRL 6281), CHO (ATCC No. CCL 61), HeLa (e.g., ATCC No. CCL 2), 293 (ATCC No. 1573) and NS-1 cells.
  • Suitable expression vectors for directing expression in mammalian cells generally include a promoter (e.g., derived from viral material such as polyoma, Adenovirus 2, cytomegalovirus and Simian Virus 40), as well as other transcriptional and translational control sequences. Examples of mammalian expression vectors include pCDM8 (Seed, B., Nature 329:840 (1987)) and pMT2PC (Kaufman et al., EMBO J. 6:187-195 (1987)).
  • promoters, terminators, and methods for introducing expression vectors of an appropriate type into plant, avian, and insect cells may also be readily accomplished.
  • the proteins of the invention may be expressed from plant cells (see Sinkar et al., J. Biosci (Bangalore) 11 :47-58 (1987), which reviews the use of Agrobacterium rhizogenes vectors; see also Zambryski et al., Genetic Engineering, Principles and Methods, Hollaender and Setlow (eds.), Vol. Vl, pp.
  • lnsect cells suitable for carrying out the present invention include cells and cell lines from Bombyx, Trichoplusia or Spodotera species.
  • Baculovirus vectors available for expression of proteins in cultured insect cells include the pAc series (Smith et al., MoI. Cell Biol. 3:2156-2165 (1983)) and the pVL series (Lucklow, VA 1 and Summers, M. D., Virology 170:31-39 (1989)).
  • Some baculovirus-insect cell expression systems suitable for expression of the recombinant proteins of the invention are described in PCT/US/02442.
  • proteins of the invention may also be expressed in non-human transgenic animals such as rats, rabbits, sheep and pigs
  • the proteins of the invention may also be prepared by chemical synthesis using techniques well known in the chemistry of proteins such as solid phase synthesis (Merrifield, J. Am. Chem. Assoc. 85:2149-2154 (1964); Frische et al., J. Pept. Sci. 2(4): 212-22 (1996)) or synthesis in homogenous solution (Houbenweyl, Methods of Organic Chemistry, ed. E. Wansch, Vol. 15 I and II, Thieme, Stuttgart (1987)).
  • N-terminal or C-terminal fusion proteins comprising the proteins of the invention conjugated with other molecules, such as proteins may be prepared by fusing, through recombinant techniques.
  • the resultant fusion proteins contain a protein of the invention fused to the selected protein or marker protein as described herein.
  • the recombinant protein of the invention may also be conjugated to other proteins by known techniques.
  • the proteins may be coupled using heterobifunctional thiol-containing linkers as described in WO 90/10457, N-succinimidyl-3-(2-pyridyldithio-proprionate) or N-succinimidyl-5 thioacetate.
  • proteins which may be used to prepare fusion proteins or conjugates include cell binding proteins such as immunoglobulins, hormones, growth factors, lectins, insulin, low density lipoprotein, glucagon, endorphins, transferrin, bombesin, asialoglycoprotein glutathione-S-transferase (GST), hemagglutinin (HA), and truncated myc.
  • the invention provides a recombinant expression vector comprising the nucleic acid sequences that encode the proteins of the invention, such as the light and heavy chain complementarity determining regions, the light and heavy chain variable regions, the binding proteins, such as antibodies and antibody fragments, immunoconjugates of the invention and novel isolated proteins of the invention.
  • the invention provides a host cell comprising the recombinant expression vector of the invention.
  • E Therapeutic Methods and Pharmaceutical Compositions of the Binding Proteins and Immunotoxins of the Invention
  • the inventors have shown that the binding proteins of the invention bind to glucose transporter 8 or variants thereof; a protein comprising any one of the amino acid sequences defined by SEQ ID NOS: 11- 20, preferably 11 , 12 or 13; or a cancer-associated variant of glucose transporter 8.
  • the cancer-associated variant of GLUT8 comprises the amino acid sequence defined by any one of SEQ ID NOS: 11 , 12 or 13, or variants thereof.
  • the cancer-associated variant of GLUT8 comprises GLUT8 that has a modification in the N-terminal di-leucine motif.
  • the N-terminal di-leucine motif has been modified to di- alanine.
  • the binding proteins of the invention show specificity for cancer cells and that they are internalized by the cell.
  • the binding proteins of the invention can be used for the targeted delivery of bioactive or medically relevant agents, such as imaging, radioactive or cytotoxic agents.
  • the invention provides a method of treating or preventing cancer, comprising administering to a subject having or suspected of having cancer an effective amount of the immunoconjugate of the invention.
  • the invention provides the use of an effective amount of the immunoconjugate of the invention for the manufacture of a medicament for treating or preventing cancer.
  • the invention provides the use of an effective amount of the immunoconjugate of the invention, further comprising the use of an additional cancer therapeutic agent for the manufacture of a medicament for simultaneous, separate or sequential treatment or prevention of cancer.
  • the invention also provides the use of an effective amount of the immunoconjugate of the invention for treating or preventing cancer.
  • the invention provides the use of an effective amount of the immunoconjugate of the invention, further comprising the use of an additional cancer therapeutic agent for simultaneous, separate or sequential treatment or prevention of cancer.
  • cancer includes, without limitation, stomach cancer, colon cancer, prostate cancer as well as cervical cancer, uterine cancer, ovarian cancer, pancreatic cancer, kidney cancer, liver cancer, head and neck cancer, squamous cell carcinoma, gastrointestinal cancer, breast cancer (such as carcinoma, ductal, lobular, and nipple),
  • Jung cancer non-Hodgkin's lymphoma, multiple myeloma, leukemia (such as acute lymphocytic leukemia, chronic lymphocytic leukemia, acute myelogenous leukemia, and chronic myelogenous leukemia), brain cancer, neuroblastoma, sarcomas, rectum cancer, bladder cancer, pancreatic cancer, endometrial cancer, plasmacytoma, lymphoma, and melanoma.
  • the cancer includes, without limitation, breast cancer, prostate cancer, colon cancer, bladder cancer, cervical cancer, kidney cancer, melanoma, liver cancer, ovarian cancer,
  • the ability of the immunoconjugate of the invention to selectively inhibit or destroy cells having cancer may be readily tested in vitro using cancer cell lines.
  • the selective inhibitory effect of the immunoconjugates of the invention may be determined, for example by demonstrating the selective inhibition of cellular proliferation of the cancer cells.
  • Toxicity may also be measured based on cell viability, for example, the viability of cancer and normal cell cultures exposed to the immunoconjugate may be compared. Cell viability may be assessed by known techniques, such as trypan blue exclusion assays.
  • a number of models may be used to test the effectiveness of the immunoconjugates of the invention. Thompson, E. W. et al. (Breast Cancer Res. Treatment 31:357-370 (1994)) has described a model for the determination of invasiveness of human breast cancer cells in vitro by measuring tumor cell-mediated proteolysis of extracellular matrix and tumor cell invasion of reconstituted basement membrane (collagen, laminin, fibronectin, Matrigel or gelatin).
  • cancer cell models include cultured ovarian adenocarcinoma cells (Young, T.N. et al. Gynecol. Oncol. 62:89-99 (1996); Moore, D. H. et al. Gynecol. Oncol. 65:78-82 (1997)), human follicular thyroid cancer cells (Demeure, MJ. et al., World J. Surg. 16:770-776 (1992)), human melanoma (A-2058) and fibrosarcoma (HT-1080) cell lines (Mackay, A.R. et al. Lab. Invest.
  • the immunoconjugates of the invention may be formulated into pharmaceutical compositions for administration to subjects in a biologically compatible form suitable for administration in vivo.
  • the substances may be administered to living organisms including humans, and animals.
  • Administration of a therapeutically active amount of the pharmaceutical compositions of the present invention is defined as an amount effective, at dosages and for periods of time necessary to achieve the desired result.
  • a therapeutically active amount of a substance may vary according to factors such as the disease state, age, sex, and weight of the individual, and the ability of the recombinant protein of the invention to elicit a desired response in the individual. Dosage regime may be adjusted to provide the optimum therapeutic response.
  • the present invention provides a pharmaceutical composition for treating or preventing cancer comprising the immunoconjugates of the invention, and a pharmaceutically acceptable carrier, diluent or excipient.
  • the effector molecule of the immunoconjugate in the pharmaceutical composition is a cancer therapeutic agent, more preferably a toxin.
  • the pharmaceutical preparation comprising the immunoconjugate of the invention may be administered systemically.
  • the pharmaceutical preparation may be administered directly to the cancer site.
  • the immunoconjugate may be coated in a material to protect the compound from the action of enzymes, acids and other natural conditions that may inactivate the compound.
  • the immunoconjugate is delivered to the patient by direct administration.
  • the invention contemplates the pharmaceutical composition being administered in at least an amount sufficient to achieve the endpoint, and if necessary, comprises a pharmaceutically acceptable carrier.
  • the invention also provides methods for reducing the risk of postsurgical complications comprising administering an effective amount of the immunoconjugate of the invention before, during, or after surgery to treat cancer.
  • compositions described herein can be prepared by per se known methods for the preparation of pharmaceutically acceptable compositions that can be administered to subjects, such that an effective quantity of the active substance is combined in a mixture with a pharmaceutically acceptable vehicle.
  • Suitable vehicles are described, for example, in Remington's Pharmaceutical Sciences (Remington's Pharmaceutical Sciences, 20 th ed., Mack Publishing Company, Easton, Pa., USA, 2000).
  • the compositions include, albeit not exclusively, solutions of the substances in association with one or more pharmaceutically acceptable vehicles or diluents, and contained in buffered solutions with a suitable pH and iso- osmotic with the physiological fluids.
  • compositions include, without limitation, lyophilized powders or aqueous or non-aqueous sterile injectable solutions or suspensions, which may further contain antioxidants, buffers, bacteriostats and solutes that render the compositions substantially compatible with the tissues or the blood of an intended recipient.
  • Other components that may be present in such compositions include water, surfactants (such as Tween), alcohols, polyols, glycerin and vegetable oils, for example.
  • Extemporaneous injection solutions and suspensions may be prepared from sterile powders, granules, tablets, or concentrated solutions or suspensions.
  • Immunoconjugate may be supplied, for example but not by way of limitation, as a lyophilized powder which is reconstituted with sterile water or saline prior to administration to the patient.
  • compositions of the invention may comprise a pharmaceutically acceptable carrier.
  • suitable pharmaceutically acceptable carriers include essentially chemically inert and nontoxic compositions that do not interfere with the effectiveness of the biological activity of the pharmaceutical composition.
  • suitable pharmaceutical carriers include, but are not limited to, water, saline solutions, glycerol solutions, ethanol, N-(1 (2,3-dioleyloxy)propyl)N,N,N-trimethylammonium chloride (DOTMA), diolesylphosphotidyl-ethanolamine (DOPE), and liposomes.
  • DOTMA N-(1 (2,3-dioleyloxy)propyl)N,N,N-trimethylammonium chloride
  • DOPE diolesylphosphotidyl-ethanolamine
  • liposomes Such compositions should contain a therapeutically effective amount of the compound, together with a suitable amount of carrier so as to provide the form for direct administration to the patient.
  • the composition may be in the form of a pharmaceutically acceptable salt which includes, without limitation, those formed with free amino groups such as those derived from hydrochloric, phosphoric, acetic, oxalic, tartaric acids, etc., and those formed with free carboxyl groups such as those derived from sodium, potassium, ammonium, calcium, ferric hydroxides, isopropylamine, triethylamine, 2-ethylarnino ethanol, histidine, procaine, etc.
  • the pharmaceutical composition is directly administered systemically or directly to the area of the tumor(s).
  • the pharmaceutical compositions may be used in methods for treating animals, including mammals, preferably humans, with cancer.
  • the dosage and type of immunoconjugate to be administered will depend on a variety of factors which may be readily monitored in human subjects. Such factors include the etiology and severity (grade and stage) of the cancer.
  • Clinical outcomes of cancer treatments using the immunoconjugates of the invention are readily discemable by one of skill in the relevant art, such as a physician.
  • standard medical tests to measure clinical markers of cancer may be strong indicators of the treatment's efficacy. Such tests may include, without limitation, physical examination, performance scales, disease markers, 12-lead ECG, tumor measurements, tissue biopsy, cytoscopy, cytology, longest diameter of tumor calculations, radiography, digital imaging of the tumor, vital signs, weight, recordation of adverse events, assessment of infectious episodes, assessment of concomitant medications, pain assessment, blood or serum chemistry, urinalysis, CT scan, and pharmacokinetic analysis.
  • synergistic effects of a combination therapy comprising the immunoconjugate and another cancer therapeutic may be determined by comparative studies with patients undergoing monotherapy.
  • Another embodiment of the invention is a kit for treating or preventing cancer comprising an effective amount of the immunoconjugate of the invention, and directions for the use thereof to treat the cancer.
  • the anticancer therapy is used in combination with other anticancer therapies.
  • the invention provides a method of preventing or treating cancer using the immunoconjugate of the invention in combination with at least one additional anticancer therapy.
  • the other cancer therapy may be administered prior to, overlapping with, concurrently, and/or after administration of the immunoconjugate.
  • the immunoconjugate and the other cancer therapeutic may be administered in a single formulation or in separate formulations, and if separately, then optionally, by different modes of administration.
  • the combination of one or more immunoconjugates and one or more other cancer therapies may synergistically act to combat the tumor or cancer.
  • the other cancer therapies include, without limitation, radiation and other anticancer therapeutic agents.
  • cancer therapeutics may include, without limitation, 2,2',2"trichlorotriethylamine, 6- azauridine, 6-diazo-5-oxo-L-norleucine, 6-mercaptopurine, aceglarone, aclacinomycins actinomycin, altretamine, aminoglutethimide, aminoglutethimide, amsacrine, anastrozole, ancitabine, angiogenin antisense oligonucleotide, anthramycin, azacitidine, azaserine, aziridine, batimastar, bcl- 2 antisense oligonucleotide, benzodepa, bicalutamide, bisantrene, bleomycin, buserelin, busulfan, cactinomycin, calusterone, carboplatin, carboquone, carminomycin, carmofur, carmustine, carubicin, carzinophilin, chlorambucil, chloram
  • compositions comprising one or more cancer therapeutics (e.g., FLAG, CHOP) are also contemplated by the present invention.
  • FLAG comprises fludarabine, cytosine arabinoside (Ara-C) and G-CSF.
  • CHOP comprises cyclophosphamide, vincristine, doxorubicin, and prednisone.
  • compositions for combination therapy may also include, without limitation, antibiotics (e.g., dactinomycin, bleomycin, mithramycin, anthramycin), asparaginase, Bacillus and Guerin, diphtheria toxin, procaine, tetracaine, lidocaine, propranolol, anti-mitotic agents, abrin, ricinA, Pseudomonas exotoxin, nerve growth factor, platelet derived growth factor, tissue plasminogen activator, antihistaminic agents, anti-nausea agents, etc.
  • antibiotics e.g., dactinomycin, bleomycin, mithramycin, anthramycin
  • asparaginase Bacillus and Guerin
  • diphtheria toxin procaine
  • tetracaine tetracaine
  • lidocaine lidocaine
  • propranolol anti-mitotic agents
  • abrin ricinA
  • the present invention provides methods for treating a tumor or cancer comprising administering a reduced dose of one or more other cancer therapeutics.
  • combination therapy comprising an immunoconjugate to a patient in need of such treatment may permit relatively short treatment times when compared to the duration or number of cycles of standard treatment regimens.
  • the present invention provides methods for treating a tumor or cancer comprising administering one or more other cancer therapeutics for relatively short duration and/or in fewer treatment cycles.
  • combination therapies comprising an immunoconjugate and another cancer therapeutic may reduce toxicity (i.e., side effects) of the overall cancer treatment.
  • reduced toxicity when compared to a monotherapy or another combination therapy, may be observed when delivering a reduced dose of immunoconjugate and/or other cancer therapeutic, and/or when reducing the duration of a cycle (i.e., the period of a single administration or the period of a series of such administrations), and/or when reducing the number of cycles.
  • the invention provides a pharmaceutical composition comprising an immunoconjugate and one or more additional anticancer therapeutic, optionally in a pharmaceutically acceptable carrier.
  • the present invention also provides a kit comprising an effective amount of an immunoconjugate, optionally, in combination with one or more other cancer therapeutic, together with instructions for the use thereof to treat cancer.
  • combination therapy with an immunoconjugate may sensitize the cancer or tumor to administration of an additional cancer therapeutic.
  • the present invention contemplates combination therapies for preventing, treating, and/or preventing recurrence of cancer comprising administering an effective amount of an immunoconjugate prior to, subsequently, or concurrently with a reduced dose of a cancer therapeutic.
  • initial treatment with an immunoconjugate may increase the sensitivity of a cancer or tumor to subsequent challenge with a dose of cancer therapeutic. This dose is near, or below, the low range of standard dosages when the cancer therapeutic is administered alone, or in the absence of an immunoconjugate.
  • the immunoconjugate may be administered separately from the cancer therapeutic, and optionally, via a different mode of administration.
  • administration of the additional cancer therapeutic may sensitize the cancer or tumor to the immunoconjugate or binding protein.
  • the additional cancer therapeutic may be given prior to administration of the immunoconjugate or binding protein.
  • the additional cancer therapeutic comprises cisplatin, e.g., PLATINOL or PLATINOL-AQ (Bristol Myers), at a dose ranging from approximately 5 to 10, 11 to 20, 21 to 40, or 41 to 75 mg/m 2 /cyc!e.
  • the additional cancer therapeutic comprises carboplatin, e.g., PARAPLATIN (Bristol Myers), at a dose ranging from approximately 2 to 3, 4 to 8, 9 to 16, 17 to 35, or 36 to 75 mg/m 2 /cycle.
  • the additional cancer therapeutic comprises cyclophosphamide, e.g., CYTOXAN (Bristol Myers Squibb), at a dose ranging from approximately 0.25 to 0.5, 0.6 to 0.9, 1 to 2, 3 to 5, 6 to 10, 11 to 20, or 21 to 40 mg/kg/cycle.
  • cyclophosphamide e.g., CYTOXAN (Bristol Myers Squibb)
  • the additional cancer therapeutic comprises cytarabine, e.g., CYTOSAR-U (Pharmacia & Upjohn), at a dose ranging from approximately 0.5 to 1 , 2 to 4, 5 to 10, 11 to 25, 26 to 50, or 51 to 100 mg/m 2 /cycle.
  • the additional cancer therapeutic comprises cytarabine liposome, e.g., DEPOCYT (Chiron Corp.), at a dose ranging from approximately 5 to 50 mg/m 2 /cycle.
  • the additional cancer therapeutic comprises dacarbazine, e.g., DTIC or DTICDOME (Bayer Corp.), at a dose ranging from approximately 15 to 250 mg/m 2 /cycle or ranging from approximately 0.2 to 2 mg/kg/cycle.
  • the additional cancer therapeutic comprises topotecan, e.g., HYCAMTIN (SmithKline Beecham), at a dose ranging from approximately 0.1 to 0.2, 0.3 to 0.4, 0.5 to 0.8, or 0.9 to 1.5 mg/m 2 /Cycle.
  • the additional cancer therapeutic comprises irinotecan, e.g., CAMPTOSAR (Pharmacia & Upjohn), at a dose ranging from approximately 5 to 9, 10 to 25, or 26 to 50 mg/m 2 /cycle.
  • the additional cancer therapeutic comprises fludarabine, e.g., FLUDARA (Berlex Laboratories), at a dose ranging from approximately 2.5 to 5, 6 to 10, 11 to 15, or 16 to 25 mg/m 2 /cycie.
  • fludarabine e.g., FLUDARA (Berlex Laboratories)
  • the additional cancer therapeutic comprises cytosine arabinoside (Ara-C) at a dose ranging from approximately 200 to 2000 mg/m 2 /cycle, 300 to 1000 mg/m 2 /cycle, 400 to 800 mg/m 2 /cycle, or 500 to 700 mg/m 2 /cycle.
  • cytosine arabinoside Ara-C
  • the additional cancer therapeutic comprises docetaxel, e.g., TAXOTERE (Rhone Poulenc Rorer) at a dose ranging from approximately 6 to 10, 11 to 30, or 31 to 60 mg/m 2 /cycle.
  • docetaxel e.g., TAXOTERE (Rhone Poulenc Rorer) at a dose ranging from approximately 6 to 10, 11 to 30, or 31 to 60 mg/m 2 /cycle.
  • the additional cancer therapeutic comprises paclitaxel, e.g., TAXOL (Bristol Myers Squibb), at a dose ranging from approximately 10 to 20, 21 to 40, 41 to 70, or 71 to 135 mg/kg/cycle.
  • TAXOL Stel Myers Squibb
  • the additional cancer therapeutic comprises 5- fluorouracil at a dose ranging from approximately 0.5 to 5 mg/kg/cycle, 1 to 4 mg/kg/cycle, or 2-3 mg/kg/cycle.
  • the additional cancer therapeutic comprises doxorubicin, e.g., ADRIAMYCIN (Pharmacia & Upjohn), DOXIL (Alza), RUBEX (Bristol Myers Squibb), at a dose ranging from approximately 2 to 4, 5 to 8, 9 to 15, 16 to 30, or 31 to 60 mg/kg/cycle.
  • the additional cancer therapeutic comprises etoposide, e.g., VEPESID (Pharmacia & Upjohn), at a dose ranging from approximately 3.5 to 7, 8 to 15, 16 to 25, or 26 to 50 mg/m 2 /cycle.
  • the additional cancer therapeutic comprises vinblastine, e.g., VELBAN (EIi Lilly), at a dose ranging from approximately 0.3 to 0.5, 0.6 to 0.9, 1 to 2, or 3 to 3.6 mg/m 2 /cycle.
  • vinblastine e.g., VELBAN (EIi Lilly)
  • VELBAN EIi Lilly
  • the additional cancer therapeutic comprises vincristine, e.g., ONCOVIN (EIi Lilly), at a dose ranging from approximately 0.1 , 0.2, 0.3, 0.4, 0.5, 0.6 or 0.7 mg/m 2 /cycle.
  • the additional cancer therapeutic comprises methotrexate at a dose ranging from approximately 0.2 to 0.9, 1 to 5, 6 to 10, or 11 to 20 mg/m 2 /cycle.
  • an immunoconjugate is administered in combination with at least one other immunotherapeutic which includes, without limitation, rituxan, rituximab, campath-1 , gemtuzumab, and trastuzutmab.
  • an immunoconjugate is administered in combination with one or more anti-angiogenic agents which include, without limitation, angiostatin, thalidomide, kringle 5, endostatin, Serpin (Serine Protease Inhibitor), anti-thrombin, 29 kDa N-terminal and a 40 kDa C-terminal proteolytic fragments of fibronectin, 16 kDa proteolytic fragment of prolactin, 7.8 kDa proteolytic fragment of platelet factor-4, a 13 amino acid peptide corresponding to a fragment of platelet factor-4 (Maione et al., 1990, Cancer Res.
  • anti-angiogenic agents include, without limitation, angiostatin, thalidomide, kringle 5, endostatin, Serpin (Serine Protease Inhibitor), anti-thrombin, 29 kDa N-terminal and a 40 kDa C-terminal proteolytic fragments of fibronectin, 16 kDa prote
  • an immunoconjugate is administered in combination with a regimen of radiation therapy.
  • the therapy may also comprise surgery and/or chemotherapy.
  • the immunoconjugate may be administered in combination with radiation therapy and cisplatin (Platinol), fluorouracil (5-FU, Adrucil), carboplatin (Paraplatin), and/or paclitaxel (Taxol).
  • Treatment with the immunoconjugate may allow use of lower doses of radiation and/or less frequent radiation treatments, which may for example, reduce the incidence of severe sore throat that impedes swallowing function potentially resulting in undesired weight loss or dehydration.
  • an immunoconjugate is administered in combination with one or more cytokines which include, without limitation, a lymphokine, tumor necrosis factors, tumor necrosis factor-like cytokine, lymphotoxin, interferon, macrophage inflammatory protein, granulocyte monocyte colony stimulating factor, interleukin (including, without limitation, interleukin-1 , interleukin-2, interleukin-6, interleukin-12, interleukin-15, interleukin-18), and a variant thereof, including a pharmaceutically acceptable salt thereof.
  • cytokines include, without limitation, a lymphokine, tumor necrosis factors, tumor necrosis factor-like cytokine, lymphotoxin, interferon, macrophage inflammatory protein, granulocyte monocyte colony stimulating factor, interleukin (including, without limitation, interleukin-1 , interleukin-2, interleukin-6, interleukin-12, interleukin-15, interleukin-18), and a variant thereof, including
  • an immunoconjugate is administered in combination with a cancer vaccine or biological agents including, without limitation, autologous cells or tissues, non-autologous cells or tissues, carcinoembryonic antigen, alpha-fetoprotein, human chorionic gonadotropin, BCG live vaccine, Mycobacterial cell wall-DNA complexes, melanocyte lineage proteins, and mutated, tumor-specific antigens.
  • a cancer vaccine or biological agents including, without limitation, autologous cells or tissues, non-autologous cells or tissues, carcinoembryonic antigen, alpha-fetoprotein, human chorionic gonadotropin, BCG live vaccine, Mycobacterial cell wall-DNA complexes, melanocyte lineage proteins, and mutated, tumor-specific antigens.
  • an immunoconjugate is administered in association with hormonal therapy.
  • Hormonal therapeutics include, without limitation, a hormonal agonist, hormonal antagonist (e.g., flutamide, tamoxifen, leuprolide acetate (LUPRON)), and steroid (e.g., dexamethasone, retinoid, betamethasone, Cortisol, cortisone, prednisone, dehydrotestosterone, glucocorticoid, mineralocorticoid, estrogen, testosterone, progestin).
  • a hormonal agonist e.g., flutamide, tamoxifen, leuprolide acetate (LUPRON)
  • steroid e.g., dexamethasone, retinoid, betamethasone, Cortisol, cortisone, prednisone, dehydrotestosterone, glucocorticoid, mineralocorticoid, estrogen, testosterone, progestin.
  • an immunoconjugate is administered in association with a gene therapy program to treat or prevent cancer.
  • Combination therapy may thus increase the sensitivity of the cancer or tumor to the administered immunoconjugate and/or additional cancer therapeutic. In this manner, shorter treatment cycles may be possible thereby reducing toxic events.
  • the cycle duration may vary according to the specific cancer therapeutic in use.
  • the invention also contemplates continuous or discontinuous administration, or daily doses divided into several partial administrations. An appropriate cycle duration for a specific cancer therapeutic will be appreciated by the skilled artisan, and the invention contemplates the continued assessment of optimal treatment schedules for each cancer therapeutic. Specific guidelines for the skilled artisan are known in the art. See, e.g., Therasse et al., 2000, "New guidelines to evaluate the response to treatment in solid tumors. European Organization for Research and Treatment of Cancer, National Cancer Institute of the United States, National Cancer Institute of Canada," J Natl Cancer Inst. Feb 2;92(3):205-16.
  • the immunoconjugate may be administered by any suitable method such as injection, oral administration, inhalation, transdermal or intratumorally, whereas any other cancer therapeutic may be delivered to the patient by the same or another mode of administration. Additionally, where multiple cancer therapeutics are intended to be delivered to a patient, the immunoconjugate and one or more of the other cancer therapeutics may be delivered by one method, whereas other cancer therapeutics may be delivered by another mode of administration.
  • F Diagnostic Methods and Agents Using the Binding Proteins and Immunotoxins of the Invention
  • the binding proteins of the invention bind selectively to cancer cells or molecules internalized by cancer cells, and not significantly to normal cells. Therefore the binding proteins can be used in the diagnosis of cancer.
  • the inventors have shown that the binding proteins of the invention bind to glucose transporter 8 or variants thereof; proteins comprising any one of the amino acid sequence defined by SEQ ID NOS:11-20; or a cancer-associated variant of glucose transporter 8.
  • the cancer-associated variant of GLUT8 comprises the amino acid sequence defined by any one of SEQ ID NOS: 11 , 12 or 13, or variants thereof.
  • the cancer-associated variant of GLUT8 comprises GLUT8 that has a modification in the N-terminal di-leucine motif.
  • the N-terminal di- leucine motif has been modified to di-aianine.
  • the binding proteins are antibodies or antibody fragments of the invention.
  • cancer cells may be evaluated to determine their susceptibility to the treatment methods of the invention by, for example, obtaining a sample of the cancer cells and determining the ability of the sample to bind to the binding proteins of the invention, preferably antibodies or antibody fragments.
  • the present invention includes diagnostic methods, agents, and kits that can be used by themselves or prior to, during or subsequent to the therapeutic method of the invention in order to determine whether or not cancer cells are present that express the antigen and can bind to the binding proteins of the invention, preferably antibodies and antibody fragments.
  • the invention provides a method of detecting or monitoring cancer in a subject comprising the steps of
  • the antigen is glucose transporter 8 or a variant thereof; a protein comprising any one of the amino acid sequences defined by SEQ ID NOS: 11-20, preferably SEQ ID NOS:11 , 12 or 13; or a cancer- associated variant of glucose-transporter 8.
  • the cancer- associated variant of glucose transporter 8 comprises a mutation in the N- terminal di-leucine motif such that the variant glucose transporter 8 is localized in the cell membrane.
  • the invention further includes a kit for diagnosing cancer comprising any one of the binding proteins of the invention that binds to an antigen on the cancer cell and instructions for the use thereof to diagnose the cancer.
  • the binding proteins of the invention may be labeled with a detectable marker such as a radio-opaque or radioisotope, such as 3 H, 14 C, 32 P, 35 S, 123 I, 125 I, 131 I; a fluorescent (fluorophore) or chemiluminescent (chromophore) compound, such as fluorescein isothiocyanate, rhodamine or luciferin; an enzyme, such as alkaline phosphatase, beta-galactosidase or horseradish peroxidase; an imaging agent; or a metal ion.
  • a detectable marker such as a radio-opaque or radioisotope, such as 3 H, 14 C, 32 P, 35 S, 123 I, 125 I, 131 I
  • a fluorescent (fluorophore) or chemiluminescent (chromophore) compound such as fluorescein isothiocyanate, rhodamine or luci
  • Another aspect of the invention is a method of detecting or monitoring cancer in a subject comprising the steps of
  • the amount of antibodies of the invention is measured by measuring the amount of antibodies of the invention in the test sample, for example by ELISA. In another embodiment, the amount of antibodies of the invention is measured by measuring the expression levels of nucleic acids encoding the antibodies of the invention in the test sample, for example by RT-PCR.
  • compositions, Methods and Uses of the Novel Cancer-Associated Antigen provides a novel cancer-associated antigen that is expressed on the surface of cancer cells and not significantly expressed on the surface of normal cells.
  • the novel cancer-associated antigen can be used in therapies to treat and prevent cancer, including using the novel cancer-associated antigen or fragments thereof to elicit an immune response in vivo.
  • the invention includes using the novel cancer-associated variant of GLUT8 to detect or monitor cancer.
  • Pharmaceutical Compositions One embodiment of the invention is a pharmaceutical composition comprising an effective amount of the novel-cancer associated variant of GLUT8 or fragment thereof in admixture with a suitable diluent or carrier.
  • Another embodiment of the invention is a pharmaceutical composition comprising an effective amount of an isolated nucleic acid encoding the novel cancer-associated variant of GLUT8 or a fragment thereof in admixture with a suitable diluent or carrier.
  • a further aspect of the invention is a pharmaceutical composition comprising an effective amount of a recombinant expression comprising an nucleic acid sequence encoding the novel cancer-associated variant of GLUT8 or a fragment thereof in admixture with a suitable diluent or carrier.
  • the pharmaceutical compositions of the invention can be used to treat or prevent cancer.
  • the pharmaceutical compositions can be used to elicit an immune response in a subject against the novel cancer-associated variant of GLUT8.
  • the pharmaceutical composition can be prepared and administered as discussed above.
  • the pharmaceutical composition can be used in combination with other anti-cancer therapeutic agents as discussed above.
  • lmmunogencicity can be significantly improved if the immunizing agents (i.e. the novel cancer-associated variant of GLUT8 or fragment thereof, and/or nucleic acid sequences coding thereof, and/or recombinant expression vectors) and/or composition is, regardless of administration format, co-immunized with an adjuvant.
  • adjuvants are used as a 0.05 to 1.0 percent solution in phosphate buffered saline. Adjuvants enhance the immunogencity of an immunogen but are not necessarily immunogenic in of themselves.
  • Adjuvants may act by retaining the immunogen locally near the site of administration to produce a depot effect facilitating a slow, sustained release of immunogen to cells of the immune system. Adjuvants can also attract cells of the immune system to an immunogen depot and stimulate such cells to elicit immune response. As such, embodiments of this invention encompass pharmaceutical compositions further comprising adjuvants. Adjuvants have been used for many years to improve the host immune responses to, for example, vaccines. Intrinsic adjuvants (such as lipopolysaccharides) normally are the components of killed or attenuated bacteria used as vaccines. Extrinsic adjuvants are immunomodulators which are typically non-covalently linked to antigens and are formulated to enhance the host immune responses.
  • adjuvants have been identified that enhance the immune response to antigens delivered parenterally. Some of these adjuvants are toxic, however, and can cause undesirable side-effects making them unsuitable for use in humans and many animals. Indeed, only aluminum hydroxide and aluminum phosphate (collectively commonly referred to as alum) are routinely used as adjuvants in human and veterinary vaccines.
  • alum aluminum hydroxide and aluminum phosphate
  • the efficacy of alum in increasing antibody responses to diphtheria and tetanus toxoids is well established. Notwithstanding, it does have limitations. For example, alum is ineffective for influenza vaccination and inconsistently elicits a cell mediated immune response with other immunogens.
  • the antibodies elicited by alum-adjuvanted antigens are mainly of the IgGI isotype in the mouse, which may not be optimal for protection by some vaccinal agents.
  • adjuvants can provoke potent immune responses to immunogens. These include saponins complexed to membrane protein antigens (immune stimulating complexes), pluronic polymers with mineral oil, killed mycobacteria and mineral oil, Freund's complete adjuvant, bacterial products such as muramyl dipeptide (MDP) and lipopolysaccharide (LPS), as well as lipid A, and liposomes.
  • adjuvants useful in any of the embodiments of the invention described herein are as follows.
  • Adjuvants for parenteral immunization include aluminum compounds (such as aluminum hydroxide, aluminum phosphate, and aluminum hydroxy phosphate).
  • the antigen can be precipitated with, or adsorbed onto, the aluminum compound according to standard protocols.
  • adjuvants such as RIBI (immunoChem, Hamilton, MT) can also be used in parenteral administration.
  • Adjuvants for mucosal immunization include bacterial toxins (e.g., the cholera toxin (CT), the E. coli heat-labile toxin (LT), the Clostridium difficile toxin A and the pertussis toxin (PT), or combinations, subunits, toxoids, or mutants thereof).
  • CTB native cholera toxin subunit B
  • CTB native cholera toxin subunit B
  • Fragments, homologs, derivatives, and fusion to any of these toxins are also suitable, provided that they retain adjuvant activity.
  • a mutant having reduced toxicity is used. Suitable mutants have been described (e.g., in WO 95/17211 (Arg-7-Lys CT mutant), WO 96/6627 (Arg-192-Gly LT mutant), and WO 95/34323 (Arg-9-Lys and GIu- 129-GIy PT mutant)).
  • Additional LT mutants that can be used in the methods and compositions of the invention include, for example Ser-63-Lys, Ala-69- GIy, Glu-110-Asp, and Glu-112-Asp mutants.
  • adjuvants such as a bacterial monophosphoryl lipid A (MPLA) of various sources (e.g., E. coli, Salmonella minnesota, Salmonella typhimurium, or Shigella flexneri, saponins, or polylactide glycolide (PLGA) microspheres) can also be used in mucosal administration.
  • MPLA bacterial monophosphoryl lipid A
  • sources e.g., E. coli, Salmonella minnesota, Salmonella typhimurium, or Shigella flexneri, saponins, or polylactide glycolide (PLGA) microspheres
  • MPLA bacterial monophosphoryl lipid A
  • sources e.g., E. coli, Salmonella minnesota, Salmonella typhimurium, or Shigella flexneri, saponins, or polylactide glycolide (PLGA) microspheres
  • PLGA polylactide glycolide
  • Adjuvants useful for both mucosal and parenteral immunization include polyphosphazene (for example, WO 95/2415), DC-chol (3 b-(N-(N',N'-dimethyl aminomethane)-carbamoyl) cholesterol (for example, U.S. Patent No. 5,283,185 and WO 96/14831) and QS-21 (for example, WO 88/9336).
  • a subject may be immunized with a pharmaceutical composition comprising the cancer-associated variant of GLUT8 or fragments thereof, an isolated nucleic acid sequence encoding thereof and/or a recombinant expression vectors by any conventional route as is known to one skilled in the art.
  • This may include, for example, immunization via a mucosal (e.g., ocular, intranasal, oral, gastric, pulmonary, intestinal, rectal, vaginal, or urinary tract) surface, via the parenteral (e.g., subcutaneous, intradermal, intramuscular, intravenous, or intraperitoneal) route or intranodally.
  • a mucosal e.g., ocular, intranasal, oral, gastric, pulmonary, intestinal, rectal, vaginal, or urinary tract
  • parenteral e.g., subcutaneous, intradermal, intramuscular, intravenous, or intraperitoneal route or intranodally.
  • the administration can be achieved in a single dose or repeated at intervals.
  • the appropriate dosage depends on various parameters understood by skilled artisans such as the immunogen itself (i.e. peptide vs. nucleic acid (and more specifically type thereof)), the route of administration and the condition of the animal to be vaccinated (weight, age and the like).
  • kits comprising an effective amount of a pharmaceutical composition of the invention, optionally, in combination with one or more other cancer therapeutic, together with instructions for the use thereof.
  • the novel cancer-associated variant of GLUT8 is present on cancer cells, but not significantly on normal cells.
  • the novel cancer-associated antigen can be used in therapeutic methods to prevent or treat cancer.
  • the novel cancer-associated antigen can be used to elicit an immune response in a subject, for example in a vaccine.
  • One embodiment of the invention is the use of the cancer-associated variant of GLUT8 or fragment thereof in the manufacture of a medicament to treat or prevent cancer.
  • Another embodiment of the invention is the use of the cancer-associated variant of GLUT8 or fragment thereof in the manufacture of a medicament to elicit an immune response in a subject.
  • the invention also includes the use of an isolated nucleic acid sequence encoding the cancer-associated variant of GLUT8 or fragment thereof in the manufacture of a medicament to treat or prevent cancer.
  • the invention includes the use of an isolated nucleic acid sequence encoding the cancer-associated variant of GLUT8 or fragment thereof in the manufacture of a medicament to elicit an immune response in a subject.
  • a further embodiment of the invention is the use of the recombinant expression vector comprising an isolated nucleic acid sequence encoding the cancer-associated variant of GLUT8 or fragment thereof in the manufacture of a medicament to treat or prevent cancer. Also, the invention includes the use of the recombinant expression vector comprising an isolated nucleic acid sequence encoding the cancer-associated variant of GLUT8 or fragment thereof in the manufacture of a medicament to elicit an immune response in a subject.
  • An additional embodiment of the invention is a method of treating or preventing cancer in a subject having or suspected of having cancer comprising administering to said subject an effective amount of a cancer- associated variant of GLUT8 or fragment thereof.
  • the invention includes a method of treating or preventing cancer in a subject having or suspected of having cancer comprising administering to said subject an effective amount of the an isolated nucleic acid sequence encoding the cancer-associated variant of GLUT8 or fragment thereof.
  • the invention includes a method of treating or preventing cancer in a subject having or suspected of having cancer comprising administering to said subject an effective amount of a recombinant expression vector comprising an isolated nucleic acid sequence encoding the cancer-associated variant of GLUT8 or fragment thereof.
  • Another embodiment of the invention is a method of inducing an immune response in a subject against a cancer-associated variant of GLUT8, comprising administering to said subject an effective amount of a cancer- associated variant of GLUT8 or fragment thereof.
  • the invention includes a method of inducing an immune response in a subject against the cancer-associated variant of GLUT8, comprising administering to said subject an effective amount of an isolated nucleic acid sequence encoding the cancer-associated variant of GLUT8 or fragment thereof.
  • the invention includes a method of inducing an immune response in a subject against the cancer-associated variant of GLUT8 comprising administering to said subject an effective amount of an recombinant expression vector comprising an isolated nucleic acid sequence encoding the cancer-associated variant of GLUT8 or fragment thereof.
  • the novel cancer-associated variant of GLUT8 is expressed on cancer cells and is not significantly expressed on normal cells, thus the detection of the novel cancer-associated variant of GLUT8 can be used as a diagnostic method for cancer.
  • the cancer-associated variant of GLUT8 comprises the amino acid sequence defined by any one of SEQ ID NOS: 11 , 12 or 13, or variants thereof.
  • the cancer-associated variant of GLUT8 comprises GLUT8 that has a modification in the N-terminal di-leucine motif.
  • the N-terminal di-leucine motif has been modified to di-alanine.
  • One embodiment of the invention is a method of detecting or monitoring cancer in a subject having or suspected of having cancer, comprising detecting a cancer-associated variant of GLUT8 on a cell in the sample, wherein cancer is indicated, if the cancer-associated variant of
  • GLUT8 is detected on the cell.
  • a number of techniques can be used to detect the cancer-associated variant of GLUT8 on a cell.
  • the binding proteins of the invention can be used in immunoassays to detect cell surface expression of the cancer- associated variant of GLUT8.
  • a person skilled in the art will appreciate that a number of techniques can be used to detect and/or quantify cell surface expression of the cancer-associated variant of GLUT8, including Western blots, immunoprecipitation followed by SDS-PAGE, immunocytochemistry, FACS, protein arrays, and the like.
  • Another aspect of the invention is a method of detecting or monitoring cancer in a subject having or suspected of having cancer, comprising detecting the expression of a cancer-associated variant of GLUT8 in the cell in the sample, wherein cancer is indicated, if expression of the cancer- associated variant of GLUT8 is detected in the cell.
  • an RNA expression product encoding the cancer-associated variant of GLUT8 is used to detect the expression of the cancer-associated variant of GLUT8 in the cell.
  • RNA expression product can be detected or quantified by detecting mRNA encoding the cancer- associated variant of GLUT8 or a fragment thereof, or oligonucleotides, cDNA, DNA, RNA, PCR products, synthetic DNA, synthetic RNA, or other combinations of naturally occurring or modified nucleotides which specifically and/or selectively hybridize to the mRNA encoding the cancer-associated variant of GLUT8 or a fragment thereof.
  • RNA expression of the cancer-associated variant of GLUT8 in a cell including RT- PCR, nuclease protection assays, such as ribonuclease protection assays and S1 nuclease assays, and Northern blots and the like.
  • nuclease protection assays such as ribonuclease protection assays and S1 nuclease assays
  • Northern blots and the like can be used to detect and/or quantify RNA expression of the cancer-associated variant of GLUT8 in a cell.
  • Glucose transporter 8 has been shown to have sugar transporting activity.
  • the invention includes a method of treating or preventing cancer in a subject by modulating the activity of the cancer-associated variant of glucose transporter 8 on or in a cancer cell.
  • the method of treating or preventing cancer in a subject comprises preventing or decreasing the function of the cancer-associated variant of glucose transporter 8 as a transporter of sugar.
  • a binding protein of the invention is used to prevent or decrease the function of the cancer- associated variant of glucose transporter 8 as a transporter of sugar.
  • a non-antibody inhibitor of glucose transporters is used to treat or prevent cancer in a subject.
  • Oestradiol and the isoflavone phytoestrogen Genistein are also inhibitors of GLUT1 -mediated glucose transport and putative binding sites for these molecules have also been proposed (Afzal et al., Biochem J. 365: 707- 719, 2002).
  • the glucose transporter inhibitors forskolin, dipyridamole and isobutylmethylxanthine (IBMX) bind to both GLUT1 and GLUT4 (Hellwig & Joost, MoI. Pharmacol. 40:383-389, 1991).
  • Cytochalasin B also binds GLUT4 (Wandel et al., Biochim. Biophys. Acta 1284:56-62, 1996.
  • a person skilled in the art will appreciate that there are a number of assays known to identify inhibitors of glucose transporters.
  • the effect of inhibitors on a glucose transporter can be assessed by expressing the GLUT of interest, preferably glucose transporter 8, in cells such as Xenopus laevis oocytes or CHO, measuring glucose uptake in the presence or absence of the inhibitor, and determining whether the inhibitor is competitive or non-competitive.
  • the sequence of a given GLUT isoform is known, its sensitivity to a large number of molecules can be readily tested to identify drug candidates.
  • the invention includes a method of treating or preventing cancer in a subject by administering an effective amount of a glucose transporter inhibitor to a subject in need thereof.
  • the inhibitors include members of the Flavonoid family, such as quercetin or genistein, Flavonoid-like molecules, such as phloretin, Oestrogenic compounds, including oestradiol or genistein, Forskolin, Cytochalasin B, Dipyridamole and/or Isobutylmethylxanthine (IBMX).
  • the function of the cancer- associated variant of glucose transporter 8 is prevented or decreased by decreasing or preventing the expression of the cancer-associated variant of glucose transporter 8 in the cell.
  • Standard techniques can be used to prevent or decrease the expression of the cancer-associated variant of glucose transporter 8 in a cell including using antisense, triple helix, or ribozyme molecules reactive to the transcripts of the cancer-associated variant of glucose transporter 8 gene.
  • antisense nucleic acid molecules i.e., molecules which are complementary to a sense nucleic acid encoding a polypeptide of interest, e.g., complementary to the coding strand of a double-stranded cDNA molecule or complementary to an mRNA sequence.
  • an antisense nucleic acid can hydrogen bond to a sense nucleic acid.
  • the antisense nucleic acid can be complementary to an entire coding strand, or to only a portion thereof, e.g., all or part of the protein coding region (or open reading frame).
  • An antisense nucleic acid molecule can be antisense to all or part of a non-coding region of the coding strand of a nucleotide sequence encoding a polypeptide of interest.
  • the non-coding regions (“5' and 3' untranslated regions") are the 5' and 3' sequences that flank the coding region and are not translated into amino acids.
  • An antisense oligonucleotide can be, for example, about 5, 10, 15, 20, 25, 30, 35, 40, 45 or 50 nucleotides or more in length.
  • An antisense nucleic acid of the invention can be constructed using chemical synthesis and enzymatic ligation reactions using procedures known in the art.
  • an antisense nucleic acid e.g., an antisense oligonucleotide
  • an antisense nucleic acid can be chemically synthesized using naturally occurring nucleotides or variously modified nucleotides designed to increase the biological stability of the molecules or to increase the physical stability of the duplex formed between the antisense and sense nucleic acids, e.g., phosphorothioate derivatives and acridine substituted nucleotides can be used.
  • modified nucleotides which can be used to generate the antisense nucleic acid include 5-fluorouracil, 5-bromouracil, 5-chlorouracil, 5-iodouracil, hypoxanthine, xanthine, 4-acetylcytosine, 5-(carboxyhydroxylmethyl) uracil,
  • the antisense nucleic acid can be produced biologically using an expression vector into which a nucleic acid has been subcloned in an antisense orientation (i.e., RNA transcribed from the inserted nucleic acid will be of an antisense orientation to a target nucleic acid of interest).
  • Antisense nucleic acid molecules administered to a subject or generated in situ such that they hybridize with or bind to cellular mRNA encoding the polypeptide of interest to thereby inhibit expression, e.g., by inhibiting transcription and/or translation.
  • the hybridization can be by conventional nucleotide complementarity to form a stable duplex, or, for example, in the case of an antisense nucleic acid molecule which binds to DNA duplexes, through specific interactions in the major groove of the double helix.
  • An example of a route of administration of antisense nucleic acid molecules of the invention includes direct injection at a tissue site.
  • antisense nucleic acid molecules can be modified to target selected cells and then administered systemically.
  • antisense molecules can be modified such that they specifically bind to receptors or antigens expressed on a selected cell, e.g., a T cell or brain cell, e.g., by linking the antisense nucleic acid molecules to peptides or antibodies which bind to cell surface receptors or antigens.
  • the antisense nucleic acid molecules can also be delivered to cells using vectors, e.g., gene therapy vectors, described below.
  • vector constructs in which the antisense nucleic acid molecule is placed under the control of a strong pol Il or pol III promoter are preferred.
  • An antisense nucleic acid molecule of interest can be an ⁇ -anomeric nucleic acid molecule.
  • An ⁇ -anomeric nucleic acid molecule forms specific double-stranded hybrids with complementary RNA in which, contrary to the usual ⁇ -units, the strands run parallel to each other (Gaultier et al., 1987, Nucleic Acids Res. 15:6625-6641).
  • the antisense nucleic acid molecule can also comprise a 2'-o-methylribonucleotide (Inoue et al., 1987, Nucleic Acids Res. 15:6131-6148) or a chimeric RNA-DNA analogue (Inoue et al., 1987, FEBS Lett. 215:327-330).
  • Ribozymes are catalytic RNA molecules with ribonuclease activity that are capable of cleaving a single-stranded nucleic acid, such as an mRNA, to which they have a complementary region, and can also be generated using standard techniques.
  • ribozymes e.g., hammerhead ribozymes (described in Haselhoff and Gerlach, 1988, Nature 334:585-591)) can be used to catalytically cleave mRNA transcripts to thereby inhibit translation of the protein encoded by the mRNA.
  • a ribozyme having specificity for a nucleic acid molecule encoding a polypeptide of interest can be designed based upon the nucleotide sequence of a cDNA encoding a cancer-associated variant of GLUT8.
  • a derivative of a Tetrahymena L-19 IVS RNA can be constructed in which the nucleotide sequence of the active site is complementary to the nucleotide sequence to be cleaved in a Cech et al. U.S. Patent No. 4,987,071 ; and Cech et al. U.S. Patent No. 5,116,742.
  • an mRNA encoding a polypeptide of interest can be used to select a catalytic RNA having a specific ribonuclease activity from a pool of RNA molecules. See, e.g., Bartel and Szostak, 1993, Science 261 :1411-1418.
  • Triple helical structures can also be generated using well known techniques. For example, expression of a polypeptide of interest can be inhibited by targeting nucleotide sequences complementary to the regulatory region of the gene encoding the polypeptide (e.g., the promoter and/or enhancer) to form triple helical structures that prevent transcription of the gene in target cells. See generally Helene, 1991 , Anticancer Drug Des. 6(6):569-84; Helene, 1992, Ann. N.Y. Acad. Sci. 660:27-36; and Maher, 1992, Bioassays 14(12):807-15.
  • nucleotide sequences complementary to the regulatory region of the gene encoding the polypeptide e.g., the promoter and/or enhancer
  • nucleic acid compositions can be modified at the base moiety, sugar moiety or phosphate backbone to improve, e.g., the stability, hybridization, or solubility of the molecule.
  • the deoxyribose phosphate backbone of the nucleic acids can be modified to generate peptide nucleic acids (see Hyrup et al., 1996, Bioorganic & Medicinal Chemistry 4(1): 5-23).
  • the terms "peptide nucleic acids” or "PNAs” refer to nucleic acid mimics, e.g., DNA mimics, in which the deoxyribose phosphate backbone is replaced by a pseudopeptide backbone and only the four natural nucleobases are retained.
  • PNAs The neutral backbone of PNAs has been shown to allow for specific hybridization to DNA and RNA under conditions of low ionic strength.
  • the synthesis of PNA oligomers can be performed using standard solid phase peptide synthesis protocols as described in Hyrup et al.,1996, supra; Perry-O'Keefe et al., 1996, Proc. Natl. Acad. Sci. USA 93: 14670-675.
  • PNAs can, for example, be modified, e.g., to enhance their stability or cellular uptake, by attaching lipophilic or other helper groups to PNA, by the formation of PNA-DNA chimeras, or by the use of liposomes or other techniques of drug delivery known in the art.
  • PNA-DNA chimeras can be generated which may combine the advantageous properties of PNA and DNA.
  • Such chimeras allow DNA recognition enzymes, e.g., RNAse H and DNA polymerases, to interact with the DNA portion while the PNA portion would provide high binding affinity and specificity.
  • PNA-DNA chimeras can be linked using linkers of appropriate lengths selected in terms of base stacking, number of bonds between the nucleobases, and orientation (Hyrup, 1996, supra).
  • the synthesis of PNA-DNA chimeras can be performed as described in Hyrup, 1996, supra, and Finn et al., 1996, Nucleic Acids Res. 24(17):3357-63.
  • a DNA chain can be synthesized on a support using standard phosphoramidite coupling chemistry and modified nucleoside analogs.
  • the oligonucleotide may include other appended groups such as peptides (e.g., for targeting host cell receptors in vivo ), or agents facilitating transport across the cell membrane (see, e.g., Letsinger et al., 1989, Proc. Natl. Acad. Sci. USA 86:6553-6556; Lemaitre et al., 1987, Proc. Natl. Acad. Sci. USA 84:648-652; International Publication No. WO 88/09810) or the blood-brain barrier (see, e.g., International Publication No. WO 89/10134).
  • peptides e.g., for targeting host cell receptors in vivo
  • agents facilitating transport across the cell membrane see, e.g., Letsinger et al., 1989, Proc. Natl. Acad. Sci. USA 86:6553-6556; Lemaitre et al., 1987, Proc. Natl. Ac
  • oligonucleotides can be modified with hybridization-triggered cleavage agents (see, e.g., Krol et al., 1988, Bio/Techniques 6:958-976) or intercalating agents (see, e.g., Zon, 1988, Pharm. Res. 5:539-549).
  • the oligonucleotide may be conjugated to another molecule, e.g., a peptide, hybridization triggered cross-linking agent, transport agent, hybridization-triggered cleavage agent, etc.
  • Another aspect of the invention is a method to identify compounds that are able to modulate the expression or activity of the cancer-associated variant of glucose transporter 8, which can be used to prevent or treat cancer.
  • the method for identifying a compound for ability to prevent or treat cancer comprises the steps:
  • the VB1-050 monoclonal antibody was generated from pooled lymphocytes of cancer patient samples. SHFP-1 was used as the fusion partner to generate the monoclonal antibody. VB1-050 is an IgGI , kappa monoclonal antibody.
  • Example 2 Sequencing
  • mRNA Messenger RNA
  • cDNA first strand complement DNA
  • the cDNA was then used to isolate antibody H and L chain genes by PCR.
  • PCR primers were designed (see note) according to the consensus framework regions of the H (Gamma) and L (Kappa) chain isotypes.
  • the PCR products were individually cloned into the TOPO-pCR 2.1 vector and transformed into E. coli cells. Individual clones containing the inserts in TOPO-pCR 2.1 were isolated and grown. Plasmid DNA was purified and sequenced.
  • Each PCR reaction comprised the following components in a 50 ⁇ L reaction volume. 1 Ox PCR buffer 5 ⁇ L 2 mM dNTPs 5 ⁇ L 50 mM MgCI2 2 ⁇ L 5' Primer 20 pmoL 3' Primer 20 pmoL
  • PCR cycling conditions were: 94°C for 1 min., 62 0 C for 1 min., 72°C for 1.5 min. for 30 cycles and a final extension for 10 min. at 72°C.
  • Amplified PCR products were electrophoretically separated on a 1% agarose gel, excised, purified using a Qiaquick gel extraction kit, cloned into the TOPO pCR 2.1 cloning vector and then DNA sequenced using the 373 DNA sequencer stretch (Griffin G. H. and Griffin M.A.: PCR technology, Current innovations. CRC Press, Boca. Raton. Florida3431.USA; Cloning vector pCR 2.1 , Catalogue #205184.
  • the CDR sequences for VB1-050 are shown in Table 1.
  • the light chain variable region and the heavy chain variable region are shown in Figure 1 and 2, respectively.
  • VB1-050 was tested by flow cytometry for tumor and normal cell reactivity. A single panel of tumor cell lines representing fifteen different types of epithelial cancers was screened. The VB1-050 results are summarized in Table 2. Although VB1-050 had a MF value > 2.0 for all indications, the strongest reactivity was observed, but not limited to, breast, melanoma, and ovarian cell lines. In comparison, reactivity with normal tissue cell lines was generally less than that seen with the cancer cell lines. In the case of the breast and prostate cell lines the expression of VB1-050 on average was >9- fold on the cancer cell lines. The two exceptions were the kidney and lung cell lines; however, they were still lower than the corresponding tumor cell type. MF value indicates the mean calculated from the sum of the mean fold increase in median fluorescence over the control antibody from all cell lines in each indication. A zero value indicates no measurable reactivity relative to the control antibody.
  • VB1-050 was first tested against the flow positive tumor cell line SKBR- 3 to assess the appropriate tissue format to demonstrate membrane staining and to define the optimal conditions for staining.
  • VB1-050 demonstrated strong nuclear and/or nuclear membrane staining in all experimental groups.
  • the cytospin slides showed punctate staining on the cellular membrane, in about 30% of the intact cells.
  • Similar cellular membrane staining was detected (10% of cells) in addition to nuclear/nuclear membrane staining (60% of cells) as well as staining in the cytoplasm (10% of cells).
  • this antibody stained the nucleus and nuclear membrane (70% of cells), and cytoplasm (10% of cells), but very rarely stained the cell membrane (3-5% of cells).
  • Example 6 Assessment of VB1-050 Binding and Internalization by Flow Cytometry and Confocal Microscopy VB1-050 and two control antibodies (5E9 and MA-103) that demonstrate strong reactivity against the tumor cell line A-375 were used to assess VB1-050 for internalization.
  • Table 6 A representative experiment is shown in Table 6.
  • VB1-050 binding results at different temperatures were not different from the internalizing antibody 5E9.
  • the membrane- bound VB1-050 disappeared from the cell surface, with a 61.8% reduction in median fluorescence.
  • Increasing the incubation time at 37°C was associated with a further decline in median fluorescence, but at a slower rate. By 120 min, the median fluorescence had decreased by 69.6%.
  • Flow histograms demonstrating cell-surface binding are illustrated in Figure 3. To confirm whether the cell-surface bound VB1-050 internalized into A-
  • a flow cytometric approach was used to determine antibody affinity [Benedict, CA. et al. (1997) "Determination of the binding affinity of an anti- CD34 single-chain antibody using a novel, flow cytometry based assay” J. Immunol. Methods 2001 , 223-31]. Briefly, A-375 cells were incubated with a range of concentrations of VB1-050 in a sufficient amount of time to achieve equilibrium. The cells were then washed and treated with biotin conjugated anti-human IgG secondary antibody. The tumor cells were then analyzed by flow cytometry to detect cell bound antibody.
  • the PelB ⁇ / H -Pvull insert obtained from the digestion of the PeIB- V H845 -C H -F-de-bouganin/pSV73 plasmid with EcoRI and PvuU, was ligated into the PelB(-S)-V H05 o-C H -F-de-bouganin/psV73 vector pre-digested with the same enzymes (previously engineered for inclusion expression containing the PeIB leader without the signal peptide sequence, PelB(-S)). 10F competent cells were transformed with the ligation reaction and selected on ampicillin plate. The screening of colonies by mapping restriction sites determined which clones contained the PelB-V H oso-C H -F-de-bouganin insert.
  • the PelB(-S)-VL O5 o-CL fragment was digested with EcoRV and Xho ⁇ and ligated into the Spel-de-bouganin-PelB-VL 845 -Ci_/psV73 vector pre- digested with the same enzymes. 1OF competent cells were then transformed with the ligation reaction and plated onto LB-agar plates supplemented with ampicillin. The screening of colonies by mapping restriction sites determined which clones contained the Spel-de-bouganin-PelB-V
  • _ insert was then cloned into the plNG3302 plasmid using the EcoRI and Xho ⁇ restrictions sites.
  • the PelB-V h oso-C H -F-de-bouganin fragment was digested with EcoRI and Spe ⁇ and ligated to the Spel-de- bouganin-PelB-V L05 o-C L. /3302 vector pre-digested with the same enzyme creating VB6-050 insert.
  • the plasmid containing the VB6-050 insert was then isolated and used to transform E104 cells. 2) Small-scale expression studies
  • Transformed E104 cells containing VB6-050 were propagated in 30 mL of TB media (1 % inoculum) in a 250 ml_ shake flask at 37 0 C and shaken at 225 rpm for approximately 5 hours until the optical density (O. D. 600 nm) reached 2.
  • the culture was induced with a final concentration of 0.1% L- (+) arabinose and incubated at 25 0 C for 16 hours.
  • the supernatant was collected by centrifugation at 14000 rpm for 5 minutes and analyzed by Western blot using either an anti-lambda or an anti-human kappa light chain under non-reducing conditions to confirm the presence and size of the immunotoxin.
  • a single colony from an LB-agar plate containing 25 ⁇ g/mL of tetracycline was used to inoculate 5 mL 2xYT plus 25 ⁇ g/mL of tetracycline and incubated at 37°C with constant shaking.
  • OD 6 oo reached ⁇ 2
  • 50 mL of 2xYT medium containing 25 ⁇ g/mL of tetracycline in a 25OmL shake-flask was inoculated with 1.25 mL of the seed culture and incubated at 37°C.
  • 25 mL of 30% glycerol was mixed into the culture. Aliquots of 1.5 mL were placed in cryotubes and stored at -8O 0 C. Three independent vials were tested for expression as described previously.
  • Fed batch fermentation of VB6-050 was performed in a 15L CHEMAP fermenter using TB medium.
  • the culture was induced with a mixture of feed (50% glycerol) and inducer (200 g L- arabinose).
  • the culture was harvested and centrifuged at 8000 rpm for 30 min, then purified using CM-sepharose and Chelating-sepharose columns followed by a size exclusion column. Briefly, the supernatant was concentrated and diafiltered against 20 mM sodium phosphate pH 6.9 ⁇ 0.1.
  • the diafiltered concentrated supernatant was then applied onto a CM-sepharose column equilibrated with 20 mM sodium phosphate, 25 mM NaCI pH 6.9 ⁇ 0.1.
  • the column was washed with 20 mM sodium phosphate, 25 mM NaCI pH 6.9 ⁇ 0.1.
  • Bound VB6 Fab-de-bouganin fusion protein was subsequently eluted with 20 mM sodium phosphate, 150 mM NaCI pH 7.5 ⁇ 0.1.
  • the CM-Sepharose eluate was adjusted to a final concentration of 0.25% triton-X100 and applied to a charged Chelating sepharose column.
  • the Chelating-sepharose column was then washed with 3 different wash buffers starting with 20 mM sodium phosphate, 150 mM NaCI, 0.25% triton-X100 pH 7.5 ⁇ 0.1 , followed by 20 mM sodium phosphate, 150 mM NaCI pH 7.5 ⁇ 0.1 and followed by 20 mM sodium phosphate, 150 mM NaCI, 10 mm imidazole pH 7.5 ⁇ 0.1.
  • the bound VB6 Fab-de-bouganin fusion protein was eluted with 20 mM sodium phosphate, 150 mM NaCI, 250 mM imidazole pH 7.5 ⁇ 0.1 and collected in 2 ml_ fractions.
  • the absorbance at A 2 8o nm was determined for each fraction and the fractions with material were pooled and applied onto a size exclusion column S200 in order to obtain a purity of - 80%.
  • Samples at each step of the process were analyzed by Western blot using the anti-kappa antibody. Purity after the size exclusion column was confirmed by colloidal blue staining. 5) Biological activity of the VB6-050
  • Human melanoma A-375, human T cell Daudi, human ovarian SK-OV- 3, human pancreatic Panc-1 , human breast SKBR-3 and MB-435S and human colon Colo-320 cell lines were grown in their respective media as per ATCC protocols. Cells were harvested at 30 to 40% confluency with viability greater than 90%.
  • a) Binding activity Flow cytometry was used to demonstrate that purified VB6-050 retain binding specificity using antigen-positive cell line SKBR-3, A-375 and SK-OV- 3 and an antigen-negative cell line Panc-1 , Colo-320 and Daudi, respectively. Binding was detected using an anti-de-bouganin antibody.
  • constructs to be tested were incubated with 0.45x10 6 tumor cells for 1.5 hours on ice. After washing, cell surface bound reactivity was detected with rabbit anti-de- bouganin (1/100) for an hour on ice. The cells were washed and incubated with FITC-conjugated anti-rabbit IgG for 30 minutes on ice. Subsequently, the cells were washed, resuspended in PBS 5% FCS containing propidium iodide for assessment of Fab binding by flow cytometry.
  • a saturation curve was generated by incubating antigen positive cell with an increased concentration of VB6-050 ranging from 10 to 750 ⁇ g/mL.
  • the bound Fab-de-bouganin was detected by flow cytometry as described previously.
  • the concentration of Fab-de-bouganin corresponding to the saturation point was then incubated with antigen-positive cells in presence of increased concentrations of parental IgG antibody.
  • the reduction of bound Fab-de-bouganin was measured by flow cytometry.
  • the 4B5 IgG was used as a negative control.
  • Cytotoxicity assay The cytotoxicity of VB6-050 was measured by an MTS assay.
  • antigen-positive and antigen-negative cells were seeded at 1000 cells per well and incubated at 37°C for 3 hours. Subsequently, varying concentrations of VB6-050 and de-bouganin were added to the cells and after 5 days, the cell viability determined. Results
  • PelB(-S)-V LO5 o-C L /pSV73 plasmid was digested with EcoRV and Xho ⁇ and the insert cloned into the Spel-de-bouganin-PelB-VL845-CL K vector pre-digested with EcoRV and Xho ⁇ .
  • the insert, PelB-VLoso-Cu was subsequently inserted into the 3302 plasmid using the EcoRI and Xho ⁇ restriction sites ( Figure 5B).
  • PelB-V H oso-C h i-F-de-bouganin fragment then ligated via the EcoRI-Spel restriction sites generating the VB6-050 insert into the 3302 DNA plasmid which was transformed into E104 cells ( Figures 5C and 5D).
  • VB6-050 was purified from a ,15 liter fermentor. Aliquots from each steps of the purification process were analyzed on Western blot in order to assess the recovery rate of each column (Figure 7A). The immunoblot was incubated with an anti-human Kappa light chain. No detectable product was observed in the permeate of the concentration and diafiltered step ( Figure 7A, lane 2 and 4, respectively). The diafiltered material, diluted 1/10, was loaded on the CM-sepharose column ( Figure 7A, lane 5). Western blot analysis showed that the CM eluate ( Figure 7A, lane 8) contains the full-length VB6- 050 and possible degraded VB6-050 fragments.
  • the flow-through of the nickel column, lane 9, shows that most of the VB6-050 and other products bound to the column.
  • antigen-positive and antigen-negative cell lines were selected based on the profiling data of each antibody.
  • the bound Fab-de- bouganin was detected by flow cytometry using anti-bouganin antibody. As expected, no binding was detected by flow cytometry after incubation with the antigen-negative cell. In contrast, bound Fab-de-bouganin was detected with the antigen-positive cell lines.
  • the antigen positive cell line was incubated with various concentrations of Fab-de-bouganin protein, ranging from 0 to 500 ⁇ g/mL, and the binding activity was determined by flow cytometry. A titration curve was generated (Figure 8).
  • the inverse of the determined median fluorescence was plotted as a function of the inverse of antibody concentration to determine the KD by Lineweaver-Burk method. A straight line was generated and the KD was calculated from the slope of the curve.
  • the saturation point for the Fab-de-bouganin was determined from the saturation curve and used for the competition assay with the parental antibody.
  • the VB6-050 saturation point 250 ⁇ g/mL, was incubated with antigen-positive cells in presence of increasing amount of its corresponding parental IgG ranging from 0 to 1000 ⁇ g/mL.
  • the bound VB6-050 was detected by flow cytometry using anti-bouganin antibody.
  • the parental IgG competed the binding of the Fab-de-bouganin proteins.
  • the concentration of IgG required to inhibit 50% of bound Fab-de-bouganin was determined to be 180 ⁇ g/mL (Table 7). 4) Cytotoxicity of VB6-050 proteins
  • the VB1-050 IgG selected from the Hybridomics and ImmunomineTM platform was engineered as soluble Fab-de-bouganin fusion protein which contains de-bouganin genetically linked to the V H -CH domain via the furin cleavable linker.
  • the data confirms that the Fab-de-bouganin format derived of IgG is suitable for soluble expression leading to an easy downstream process.
  • the flow cytometry data showed that the profiling data of the VB6 format matched the parental IgG suggesting the specificity and selectivity was preserved.
  • the IgG competed with the VB6 fusion proteins demonstrating that both fragments bound to the same antigen.
  • the calculated affinity of the VB6 format was in the micromolar range leading to IC 50 ⁇ to 280 nM.
  • VB1-050 showed a 58.62% (P-value 0.008) increase in binding upon deglycosylation. This increase in the binding of the antigen observed upon deglycosylation, suggests that the glycan moiety may partially mask the antigenic sites on the cell surface and that deglycosylation may be an essential step in the identification of the antigen. lmmunoprecipitation
  • Equal amounts of membrane preparations from each of the four positive cell lines, MCF-7, MDA-MB-435S, A-375, HepG2, and three negative cell lines, Panc-1 , Daudi and C-33A were deglycosylated with N-Glycanase and nutated with 40 ⁇ g VB1-050 and 4B5-lgG each in the presence of protease inhibitors with conditions mimicking in-vivo conditions.
  • Immune complexes were centrifuged, washed with RIP-A lysis buffer and eluted with 0.2M glycine pH 2.5.
  • HepG2 and MCF-7 membranes eluting off the HPRP column showed different separation profiles, entirely dependent on the presence of the VB1-050 reactive antigens. Two peaks were observed to be differentially regulated in the positive cell lines, that seemed to be negligible or totally absent in the negative cell lines, Panc-1 and C-33A membranes ( Figure 10A and B).
  • the chromatographic profiles obtained for the HPRP column were imported into ProteoVueTM files to be formatted into an acceptable format for the final analysis on DeltaVueTM.
  • the analyses were combined for the antigen fractionation from both positive (HepG2 and MCF-7) and negative (Panc-1 and C-33A) cell lines and formatted using ProteoVue ® software to generate a comprehensive membrane protein map from each of the cell lines.
  • a comparative profiling of differentially regulated proteins was thereafter generated on the DeltaVueTM software.
  • the chromatographic profiles of the fractionation from both cell lines were converted from peaks to banding patterns making areas of differential expression more readily visible. Particular differentially expressed peaks/bands in the positive cell line could be focused for better resolution and analysis.
  • Peptides that were abundant and well ionized were chosen for further MS/MS ion fragmentation, wherein, the 'y' and 'b' ions were used to deduce their primary structure. These sequences were then searched for homologies in the protein database for protein ID. Peptides ionize and are detected as doubly, triply or quadruply charged molecules, on a LC-M S/M S system as opposed to detection as singly charged on Matrix assisted ionization such as in MALDI. Differentially charged peptides were thereafter refined to their respective masses, in the mass reconstruction step. These peptide masses were then directly analyzed by a matrix science based mascot search engine for antigen ID.
  • Peptide masses extracted from the mass spectra were used directly to identify the antigen according to the MOWSE scores obtained on protein databases that are accessible through search engines such as MASCOT, SEQUEST, and Prospector. Since the QSTAR-pulsar-l purchase includes the purchase of license from Pepsea server for most recent protein database additions, and is compatible with MASCOT, this search engine was selected for all protein searches.
  • MS/MS fragmentation of four of the peptides (1401.54 - 466.600000, 3+; 1070.785448 - 536.400000, 2+; 1998.272862 - 667.098230, 3+; 1176.185448 - 589.100000, 2+) gave rise to the fragment ions shown in Figures 18-21 that mapped to peptides from Glucose Transporter 8. Since these 2 peptides were all detected in TOF-MS, these peptides were used for MS/MS ion fragmentation apart from the peptides derived from mass fingerprinting. A discrete nanospray head installed on a nanosource was used for the purpose.
  • the collision energy was 48V, curtain gas and CAD gas were maintained at 25 and 6, respectively, and the sample allowed to cycle for 1.667 minutes (100 cycles) to obtain stable mass ion fragmentation.
  • Peptides derived from the spectra clearly matched the sequence on Glucose Transporter 8, therefore were pulled down as major hits.
  • the ion fragmentation data further confirm the identity of Glucose Transporter 8 as the cognate antigen for VB1-050.
  • Peptide mass fingerprinting and MS/MS fragmentation of the antigen- positive fractions revealed the identity of Glucose transporter-8/GLUTX1/SLC 2A8 gene product as the cognate binding antigen for VB1-050.
  • Glucose transporter-8 is a ⁇ 50 kDa type-ll transmembrane protein, with N-terminus inside the cell. 34% sequence coverage was obtained from the peptides that were recovered in-house. Cell lines selected positive by flow show the presence of the antigen upon immunoprecipitation. MS/MS analysis of two peptides, 1070.785, appearing as a doubly charged molecule (536.40000, 2+); 1401.54, appearing as a triply charged molecule (466.60000, 3+), identified two peptide sequences, SLASVWGVIQ (292-303) and KTLEQITAHFEGR (466-477), respectively, clearly matched the protein sequence corresponding to Glucose transporter-8.
  • the changes incorporated correspond to the positional changes at 12, 13 from LL to AA as reported by Shin et al. (2004, J. Neuro. Res. 75: 835), that is responsible for the orientation of GLUT8 from cytosol to the plasma membrane.
  • 1 N indicates the number of cell lines tested per indication.
  • 2 MF Values indicate the mean calculated from the sum of the mean fold increase in median fluorescence over the control antibody from all cell lines in each indication. A zero value indicates no measurable reactivity
  • Table 4 HD Formalin-Fixed Normal TMA for VB1-050
  • Table 5 HD Formalin-Fixed Tumor TMA for VB 1-050

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Immunology (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Cell Biology (AREA)
  • Molecular Biology (AREA)
  • Biochemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Engineering & Computer Science (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Veterinary Medicine (AREA)
  • Biomedical Technology (AREA)
  • Public Health (AREA)
  • Hematology (AREA)
  • Microbiology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Urology & Nephrology (AREA)
  • Oncology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Pregnancy & Childbirth (AREA)
  • Neurology (AREA)
  • Epidemiology (AREA)
  • Biotechnology (AREA)
  • Reproductive Health (AREA)
  • Gynecology & Obstetrics (AREA)
  • Food Science & Technology (AREA)
  • Physics & Mathematics (AREA)
  • Analytical Chemistry (AREA)
  • General Physics & Mathematics (AREA)
  • Pathology (AREA)
  • Mycology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
PCT/CA2005/001953 2004-12-21 2005-12-21 Cancer specific antibody and cell surface proteins Ceased WO2006066408A1 (en)

Priority Applications (10)

Application Number Priority Date Filing Date Title
AU2005318836A AU2005318836B2 (en) 2004-12-21 2005-12-21 Cancer specific antibody and cell surface proteins
NZ556055A NZ556055A (en) 2004-12-21 2005-12-21 Cancer specific antibody and cell surface proteins
US11/722,420 US8084576B2 (en) 2004-12-21 2005-12-21 Cancer associated glucose transporter 8 variant
CA2591768A CA2591768C (en) 2004-12-21 2005-12-21 Cancer specific antibody and cell surface proteins
ES05823959T ES2421558T3 (es) 2004-12-21 2005-12-21 Anticuerpos específicos de cáncer y proteínas de superficie celular
JP2007547125A JP5143566B2 (ja) 2004-12-21 2005-12-21 癌特異的抗体および細胞表面タンパク質
CN2005800485228A CN101160402B (zh) 2004-12-21 2005-12-21 肿瘤特异性抗体和细胞表面蛋白质
EP05823959.1A EP1833968B1 (en) 2004-12-21 2005-12-21 Cancer specific antibody and cell surface proteins
IL183958A IL183958A (en) 2004-12-21 2007-06-14 Cancer associated variant of glucose transporter 8 and use thereof in treating and detecting cancer
US13/297,783 US8697075B2 (en) 2004-12-21 2011-11-16 Cancer specific antibody and cell surface proteins

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US63744804P 2004-12-21 2004-12-21
US60/637,448 2004-12-21

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US11/722,420 A-371-Of-International US8084576B2 (en) 2004-12-21 2005-12-21 Cancer associated glucose transporter 8 variant
US13/297,783 Division US8697075B2 (en) 2004-12-21 2011-11-16 Cancer specific antibody and cell surface proteins

Publications (1)

Publication Number Publication Date
WO2006066408A1 true WO2006066408A1 (en) 2006-06-29

Family

ID=36601325

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/CA2005/001953 Ceased WO2006066408A1 (en) 2004-12-21 2005-12-21 Cancer specific antibody and cell surface proteins

Country Status (12)

Country Link
US (2) US8084576B2 (https=)
EP (1) EP1833968B1 (https=)
JP (2) JP5143566B2 (https=)
CN (1) CN101160402B (https=)
AU (1) AU2005318836B2 (https=)
CA (1) CA2591768C (https=)
ES (1) ES2421558T3 (https=)
IL (1) IL183958A (https=)
NZ (1) NZ556055A (https=)
RU (1) RU2007127889A (https=)
WO (1) WO2006066408A1 (https=)
ZA (1) ZA200705837B (https=)

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP1737961A4 (en) * 2004-03-19 2008-12-17 Merck Patent Gmbh Modified bougainin proteins, cytotoxins and methods and uses thereof
US10161930B2 (en) 2011-11-03 2018-12-25 Pierre Fabre Medicament Antigen binding protein and its use as addressing product for the treatment of cancer

Families Citing this family (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US9636329B2 (en) * 2012-11-06 2017-05-02 Northwestern University Methods of treating cancer with glut inhibitors and oxidative phosphorylation inhibitors
WO2015048901A1 (en) * 2013-10-02 2015-04-09 Viventia Bio Inc. Anti-epcam antibodies and methods of use
KR101985215B1 (ko) * 2015-05-29 2019-06-03 후지필름 가부시키가이샤 폴리이미드 전구체 조성물, 감광성 수지 조성물, 경화막, 경화막의 제조 방법, 반도체 디바이스 및 폴리이미드 전구체 조성물의 제조 방법
CA3032952A1 (en) * 2016-08-08 2018-02-15 Sorrento Therapeutics, Inc. Anti-ox40 binding proteins
CN108101988B (zh) * 2016-11-24 2021-09-07 复旦大学 针对cd16的全人源单域抗体、其抗原结合片段及应用
US11142579B2 (en) 2017-12-06 2021-10-12 Sorrento Therapeutics, Inc. Variant antibodies that bind OX40
EP3870104A4 (en) * 2018-10-26 2022-11-23 Mayo Foundation for Medical Education and Research METHODS AND MATERIALS FOR THE TREATMENT OF CANCER
CN114807054B (zh) * 2022-06-24 2022-09-13 北京索莱宝科技有限公司 小鼠抗人IgG单抗杂交瘤细胞株、抗体、抗体组合物及试剂盒

Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JPH06141884A (ja) * 1992-11-06 1994-05-24 Hagiwara Yoshihide 抗癌ヒトモノクローナル抗体のアミノ酸配列及びそれをコードするdna塩基配列
WO1998055623A1 (en) 1997-06-06 1998-12-10 Tanox Pharma B.V. Type-1 ribosome-inactivating protein
WO2001004145A2 (en) 1999-07-14 2001-01-18 University Of Lausanne Glutx polypeptide family and nucleic acids encoding same
US20040228592A1 (en) * 2003-04-01 2004-11-18 Gaeta Alexander L. Photonic band gap optical fiber

Family Cites Families (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CA1247538A (en) * 1982-05-21 1988-12-28 Mark C. Glassy Human-human hybridomas for solid tumors
JPH04346792A (ja) * 1991-05-22 1992-12-02 Hagiwara Yoshihide 抗癌ヒトモノクローナル抗体のアミノ酸配列及びそれをコードするdna塩基配列
AU6162794A (en) 1993-01-22 1994-08-15 Hygeia Pharmaceuticals, Inc. Carcinoma associated antigen (ng1) monoclonal antibodies against ng1, methods of producing these antibodies and use therefor
US20030228592A1 (en) * 1997-10-01 2003-12-11 St. Vincent's Institute Of Medical Research Human facilitative glucose transport protein GLUT8
US7001735B2 (en) * 2000-03-01 2006-02-21 Albert Einstein College Of Medicine Of Yeshiva University Glucose transporter/sensor protein and uses thereof
US20030012783A1 (en) * 2001-02-20 2003-01-16 Wayne Kindsvogel Antibodies that bind both BCMA and TACI
WO2002099044A2 (en) * 2001-06-05 2002-12-12 Exelixis, Inc. B3galts as modifiers of the p53 pathway and methods of use
EP1556088A2 (en) * 2002-10-29 2005-07-27 Engene, Inc. Compositions for cancer treatment

Patent Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JPH06141884A (ja) * 1992-11-06 1994-05-24 Hagiwara Yoshihide 抗癌ヒトモノクローナル抗体のアミノ酸配列及びそれをコードするdna塩基配列
WO1998055623A1 (en) 1997-06-06 1998-12-10 Tanox Pharma B.V. Type-1 ribosome-inactivating protein
WO2001004145A2 (en) 1999-07-14 2001-01-18 University Of Lausanne Glutx polypeptide family and nucleic acids encoding same
US20040228592A1 (en) * 2003-04-01 2004-11-18 Gaeta Alexander L. Photonic band gap optical fiber

Non-Patent Citations (8)

* Cited by examiner, † Cited by third party
Title
AOTSUKA Y. ET AL.: "Identification of a malignant cell associated antigen recognized by a human monoclonal antibody", EUROPEAN JOURNAL OF CANCER & CLINICAL ONCOLOGY, vol. 24, no. 5, May 1988 (1988-05-01), pages 829 - 838, XP002974984 *
FENSTERMAKER R. ET AL.: "Immunotherapeutic strategies for malignant glioma", CANCER CONTROL, vol. 11, no. 3, May 2004 (2004-05-01), pages 181 - 191, XP008119219 *
HAGIWARA H. ET AL.: "Determination of the antigen/epitope that is recognized by human monoclonal antibody CLN-IgG", HUMAN ANTIBODIES, vol. 10, no. 2, 2001, pages 77 - 82, XP002974980 *
KREITMAN R.J.: "Immunotoxins in cancer therapy", CURRENT OPINION IN IMMUNOLOGY, vol. 11, no. 5, 1999, pages 570 - 578, XP001012909 *
MOADEL R.M. ET AL.: "Positherapy: targeted nuclear therapy of breast cancer with 18F-2-deoxy-2-fluoro-d-glucose", CANCER RESEARCH, vol. 65, no. 3, 1 February 2005 (2005-02-01), pages 698 - 702, XP008119221 *
OSUMI K. ET AL.: "Antibody dependent cell mediated cytotoxicity on human cervical carcinoma cell line, ME-180, with human monoclonal antibody", CANCER LETTERS, vol. 62, no. 2, 1992, pages 179 - 183, XP002974982 *
See also references of EP1833968A4
SHIKHMAN A.R. ET AL.: "Distinct pathways regulate facilitated glucose transport in human articular chondrocytes during anabolic and catabolic responses", AMERICAN JOURNAL OF PHYSIOLOGY - ENDOCRINOLOGY AND METABOLISM, vol. 286, 28 January 2004 (2004-01-28), pages E980 - E985, XP008119220 *

Cited By (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP1737961A4 (en) * 2004-03-19 2008-12-17 Merck Patent Gmbh Modified bougainin proteins, cytotoxins and methods and uses thereof
US7750136B2 (en) 2004-03-19 2010-07-06 Merck Patent Gmbh Modified bouganin proteins, cytotoxins and methods and uses thereof
US8716234B2 (en) 2004-03-19 2014-05-06 Merck Patent Gmbh Cytotoxins comprising modified bouganin toxin for the treatment of cancer
US10161930B2 (en) 2011-11-03 2018-12-25 Pierre Fabre Medicament Antigen binding protein and its use as addressing product for the treatment of cancer

Also Published As

Publication number Publication date
EP1833968A4 (en) 2009-09-16
IL183958A0 (en) 2007-10-31
US8084576B2 (en) 2011-12-27
US8697075B2 (en) 2014-04-15
EP1833968A1 (en) 2007-09-19
RU2007127889A (ru) 2009-01-27
IL183958A (en) 2012-02-29
EP1833968B1 (en) 2013-04-17
CA2591768A1 (en) 2006-06-29
US20100254982A1 (en) 2010-10-07
ZA200705837B (en) 2008-05-28
JP2013063066A (ja) 2013-04-11
US20120128723A1 (en) 2012-05-24
CA2591768C (en) 2016-06-14
NZ556055A (en) 2009-12-24
ES2421558T3 (es) 2013-09-03
CN101160402A (zh) 2008-04-09
JP2008523825A (ja) 2008-07-10
CN101160402B (zh) 2013-06-05
JP5143566B2 (ja) 2013-02-13
AU2005318836B2 (en) 2012-03-22
AU2005318836A1 (en) 2006-06-29

Similar Documents

Publication Publication Date Title
US8426561B2 (en) Antibodies against a cancer-associated epitope of variant NFKBIB and uses thereof
US8697075B2 (en) Cancer specific antibody and cell surface proteins
US8969540B2 (en) Tumor specific antibody
US8273550B2 (en) Antibodies against a cancer-associated epitope of variant HnRNPG and uses thereof
HK1114124A (en) Cancer specific antibody and cell surface proteins
HK1151973A (en) Antibodies against a cancer-associated epitope of variant nfkbib and uses thereof

Legal Events

Date Code Title Description
AK Designated states

Kind code of ref document: A1

Designated state(s): AE AG AL AM AT AU AZ BA BB BG BR BW BY BZ CA CH CN CO CR CU CZ DE DK DM DZ EC EE EG ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KM KN KP KR KZ LC LK LR LS LT LU LV LY MA MD MG MK MN MW MX MZ NA NG NI NO NZ OM PG PH PL PT RO RU SC SD SE SG SK SL SM SY TJ TM TN TR TT TZ UA UG US UZ VC VN YU ZA ZM ZW

AL Designated countries for regional patents

Kind code of ref document: A1

Designated state(s): BW GH GM KE LS MW MZ NA SD SL SZ TZ UG ZM ZW AM AZ BY KG KZ MD RU TJ TM AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HU IE IS IT LT LU LV MC NL PL PT RO SE SI SK TR BF BJ CF CG CI CM GA GN GQ GW ML MR NE SN TD TG

121 Ep: the epo has been informed by wipo that ep was designated in this application
WWE Wipo information: entry into national phase

Ref document number: 183958

Country of ref document: IL

WWE Wipo information: entry into national phase

Ref document number: 2005318836

Country of ref document: AU

WWE Wipo information: entry into national phase

Ref document number: 2007547125

Country of ref document: JP

Ref document number: 2591768

Country of ref document: CA

Ref document number: 11722420

Country of ref document: US

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 556055

Country of ref document: NZ

WWE Wipo information: entry into national phase

Ref document number: 5064/DELNP/2007

Country of ref document: IN

WWE Wipo information: entry into national phase

Ref document number: 2007/05837

Country of ref document: ZA

ENP Entry into the national phase

Ref document number: 2005318836

Country of ref document: AU

Date of ref document: 20051221

Kind code of ref document: A

WWP Wipo information: published in national office

Ref document number: 2005318836

Country of ref document: AU

WWE Wipo information: entry into national phase

Ref document number: 2005823959

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 2007127889

Country of ref document: RU

WWE Wipo information: entry into national phase

Ref document number: 200580048522.8

Country of ref document: CN

WWP Wipo information: published in national office

Ref document number: 2005823959

Country of ref document: EP

WWP Wipo information: published in national office

Ref document number: 183958

Country of ref document: IL