WO2005115439A2 - Cerberus/coco derivatives and uses thereof - Google Patents

Cerberus/coco derivatives and uses thereof Download PDF

Info

Publication number
WO2005115439A2
WO2005115439A2 PCT/US2005/018928 US2005018928W WO2005115439A2 WO 2005115439 A2 WO2005115439 A2 WO 2005115439A2 US 2005018928 W US2005018928 W US 2005018928W WO 2005115439 A2 WO2005115439 A2 WO 2005115439A2
Authority
WO
WIPO (PCT)
Prior art keywords
myostatin
cerberus
preparation
protein
disease
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2005/018928
Other languages
English (en)
French (fr)
Other versions
WO2005115439A9 (en
WO2005115439A3 (en
Inventor
John Knopf
Jasbir Seehra
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Acceleron Pharma Inc
Original Assignee
Acceleron Pharma Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to AU2005247508A priority Critical patent/AU2005247508A1/en
Priority to CA002567810A priority patent/CA2567810A1/en
Priority to EP05780089A priority patent/EP1755648A2/en
Priority to US11/597,182 priority patent/US20100183695A1/en
Priority to JP2007515450A priority patent/JP2008500373A/ja
Application filed by Acceleron Pharma Inc filed Critical Acceleron Pharma Inc
Publication of WO2005115439A2 publication Critical patent/WO2005115439A2/en
Publication of WO2005115439A9 publication Critical patent/WO2005115439A9/en
Priority to IL179602A priority patent/IL179602A0/en
Anticipated expiration legal-status Critical
Publication of WO2005115439A3 publication Critical patent/WO2005115439A3/en
Priority to US13/533,733 priority patent/US20130029908A1/en
Priority to US13/774,585 priority patent/US9045553B2/en
Priority to US14/727,819 priority patent/US20160115209A1/en
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/18Growth factors; Growth regulators
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/14Prodigestives, e.g. acids, enzymes, appetite stimulants, antidyspeptics, tonics, antiflatulents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00Drugs for skeletal disorders
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00Drugs for skeletal disorders
    • A61P19/02Drugs for skeletal disorders for joint disorders, e.g. arthritis, arthrosis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00Drugs for skeletal disorders
    • A61P19/08Drugs for skeletal disorders for bone diseases, e.g. rachitism, Paget's disease
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P21/00Drugs for disorders of the muscular or neuromuscular system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P21/00Drugs for disorders of the muscular or neuromuscular system
    • A61P21/02Muscle relaxants, e.g. for tetanus or cramps
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P21/00Drugs for disorders of the muscular or neuromuscular system
    • A61P21/04Drugs for disorders of the muscular or neuromuscular system for myasthenia gravis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/02Drugs for disorders of the nervous system for peripheral neuropathies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/04Centrally acting analgesics, e.g. opioids
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/14Drugs for disorders of the nervous system for treating abnormal movements, e.g. chorea, dyskinesia
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/14Drugs for disorders of the nervous system for treating abnormal movements, e.g. chorea, dyskinesia
    • A61P25/16Anti-Parkinson drugs
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/28Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/04Anorexiants; Antiobesity agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/08Drugs for disorders of the metabolism for glucose homeostasis
    • A61P3/10Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P5/00Drugs for disorders of the endocrine system
    • A61P5/14Drugs for disorders of the endocrine system of the thyroid hormones, e.g. T3, T4
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • A61P9/04Inotropic agents, i.e. stimulants of cardiac contraction; Drugs for heart failure
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • A61P9/10Drugs for disorders of the cardiovascular system for treating ischaemic or atherosclerotic diseases, e.g. antianginal drugs, coronary vasodilators, drugs for myocardial infarction, retinopathy, cerebrovascula insufficiency, renal arteriosclerosis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K48/00Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide

Definitions

  • Transforming growth factor-/3 superfamily proteins represent a large family of cytokines that includes the TGF- ⁇ s, activins, inhibins, bone morphogenetic proteins (BMPs) and Mullerian-inhibiting substance (MIS) (for review, see Massague et al., Trends Cell Biol. 7:187-192, 1997). These proteins contain a conserved C-terminal cystine-knot motif, and serve as ligands for diverse families of plasma membrane receptors.
  • BMPs bone morphogenetic proteins
  • MIS Mullerian-inhibiting substance
  • BMP Bone Morphogenetic Protein
  • the BMP repressors can be further divided into three groups of proteins based on structural analysis, especially the number of structurally conserved Cys residues in their C- terminal characteristic "Cys-knot" structures: the 8-, 9-, or 10-member ring Cys-knot BMP repressors.
  • the 8-member ring (CAN subfamily) repressors can be divided further into four subgroups based on a conserved arrangement of additional cysteine residues - gremlin and PRDC, Cerberus and coco, and DAN, together with USAG-1 and sclerostin.
  • Myostatin, or growth/differentiation factor 8 also belongs to the transforming growth factor- ⁇ (TGF- ⁇ ) superfamily (McPherron et al., Nature 387:83-90 (1997)).
  • TGF- ⁇ transforming growth factor- ⁇
  • the human myostatin gene has been cloned (Nestor et al. Proc. Natl. Acad. Sci.
  • myostatin may play a role in negatively regulating the growth and development of skeletal muscle (Nestor et al., supra).
  • a study with myostatin knock-out mice provided the first evidence that myostatin is a key negative regulator of muscle development (McPherron et al., Nature 387:83-90 (1997)).
  • the animals were significantly larger than wild-type mice and had a large and widespread increase in skeletal muscle mass.
  • myostatin is a negative regulator of skeletal muscle growth in adult men and contributes to muscle wasting in HrV-infected men (Nestor et al., supra).
  • the present invention provides methods and compositions which may be utilized to help individuals with such muscle wasting conditions and provides further insight into the regulation of myostatin gene expression.
  • One aspect of the invention provides a pharmaceutical preparation of Cerberus, Coco or other polypeptide from the Cerberus/Dan/Gremlin superfamily (collectively herein "CDG proteins") for inhibiting the function / signaling of Nodal, myostatin and BMP.
  • CDG proteins Cerberus/Dan/Gremlin superfamily
  • Exemplary preparations of the subject CDG polypeptides may include variant Cerberus or Coco sequences that substantially retain the binding affinity of the parent protein to Nodal, myostatin and/or another BMP (such as BMP-4).
  • the present invention provides pharmaceutical preparations for inhibiting myostatin, comprising a myostatin antagonist protein that includes (at least) a myostatin binding domain of a Cerberus/Dan/Gremlin polypeptide or variant thereof.
  • the myostatin antagonist protein binds to and neutralizes one or more of nodal and/or myostatin.
  • the pharmaceutical preparation is substantially free of pyrogenic materials so as to be suitable for administration as a human or veterinarian therapeutic.
  • These pharmaceutical preparations can be used to reduce the severity of a pathologic condition, which is characterized, at least in part, by an abnormal amount, development or metabolic activity of muscle or adipose tissue in a subject.
  • the pharmaceutical preparations of the present invention can be administered in an amount effective to prevent, ameliorate or reduce the severity of a wasting disorder, such as cachexia, anorexia, DMD syndrome, BMD syndrome, AIDS wasting syndrome, muscular dystrophies, neuromuscular diseases, motor neuron diseases, diseases of the neuromuscular junction, and inflammatory myopathies.
  • a wasting disorder such as cachexia, anorexia, DMD syndrome, BMD syndrome, AIDS wasting syndrome, muscular dystrophies, neuromuscular diseases, motor neuron diseases, diseases of the neuromuscular junction, and inflammatory myopathies.
  • These pharmaceutical preparations can also be used to reduce the severity of a pathologic condition, which is characterized, at least in part, by an abnormal amount, development or metabolic activity of heterotopic ossification in tissues such as of muscles, tendons, and ligaments; Osteoarthritis (OA), including the development of osteophytes and synovial thickening; ovarian cancer; Fibrodysplasia ossificans progressiva (FOP); Atherosclerosis, especially inflammatory response in early steps of atherogenesis in lesion- prone areas; and craniosynostoses.
  • OA Osteoarthritis
  • FOP Fibrodysplasia ossificans progressiva
  • Atherosclerosis especially inflammatory response in early steps of atherogenesis in lesion- prone areas
  • craniosynostoses especially inflammatory response in early steps of atherogenesis in lesion- prone areas.
  • Another aspect of the invention provides a pharmaceutical preparation of CDG protein derivative for specifically inhibiting Nodal and/or myostatin function without substantially compromising BMP (such as BMP-4) signaling (e.g., does not substantially bind BMP-4 or other BMPs).
  • BMP such as BMP-4
  • Exemplary preparations of this aspect of the invention include polypeptides including the N-terminal truncated versions of Cerberus or Coco, or other fragments that include the cysteine-core.
  • N-terminally truncated CDG derivatives can be used to reduce the severity of a pathologic condition, which is characterized, at least in part, by an abnormal amount, development or metabolic activity of muscle or adipose tissue in a subject.
  • the pharmaceutical preparations of the present invention can be administered in an amount effective to prevent, ameliorate or reduce the severity of a wasting disorder, such as cachexia, anorexia, DMD syndrome, BMD syndrome, AIDS wasting syndrome, muscular dystrophies, neuromuscular diseases, motor neuron diseases, diseases of the neuromuscular junction, and inflammatory myopathies.
  • a wasting disorder such as cachexia, anorexia, DMD syndrome, BMD syndrome, AIDS wasting syndrome, muscular dystrophies, neuromuscular diseases, motor neuron diseases, diseases of the neuromuscular junction, and inflammatory myopathies.
  • the mysotatin inhibitor is a polypeptide that includes a myostatin binding domain of a CDG protein.
  • the Cerberus protein variant can be derived from a human, mouse, or other species of Cerberus, including a human or mouse Cerberus variant sequence sharing at least about 50%, 60%, 70%, 80%, 90%, 95%, or 99% or more sequence similarity or identity with the human or mouse Cerberus protein, and substantially retain the binding affinity of wild-type Cerberus for myostatin.
  • the Coco protein variant can be derived from a human, mouse, or other species of Coco, including a human or mouse Coco variant sequence sharing at least about 50%, 60%, 70%, 80%), 90%, 95%, or 99% or more sequence similarity or identity with the human or mouse Coco protein, and substantially retain the binding affinity of wild-type Coco for myostatin.
  • the mysotatin inhibitor is a polypeptide that includes a myostatin binding domain of a CDG protein, which polypeptide does not substantially bind BMP-4 (and other BMPs).
  • the myostatin binding domain can be derived from a human, mouse, or other species of N-terminally truncated Cerberus, including a human or mouse Cerberus derivative, with amino acid residues starting from any one of residues 106- 119 of SEQ ID No. 2 or 8 of US 2002/0164682 Al (see below), and ending at any residue after residue 241 of SEQ ID No. 2 or 8 of US 2002/0164682 Al, preferably ending at any residue between residues 241 and 267 of SEQ ID No.
  • residues 106-119 of human Cerberus is: PPGTQSLIQPIDGM Residues 241-267 of human Cerberus is: CKVKTEHEDGHILHAGSQDSFIPGVSA Also included are Cerberus derived variant sequence, e.g., N-terminally truncated myostatin binding domain of Cerberus that retains myostatin binding activity but loses other BMP binding activity.
  • Variant sequences may be desirable as a way to alter selectivity of the inhibitor (e.g., relative to GDF-8, GDF-11 or nodal binding), alter other binding characteristics with respect to myostatin (such as K d , and/or K on or Ko ff rates), or improve biodistribution or half life in vivo or on the shelf.
  • the Cerberus polypeptide full-length or N- terminally truncated comprising the myostatin binding domain binds myostatin with a K ⁇ ⁇ of 1 ⁇ M or less, and more preferably a K ⁇ j of 100 nM, 10 nM or even 1 nM or less.
  • the mysotatin inhibitor is a polypeptide that includes a myostatin binding domain of a Coco protein, such as the human Coco protein shown in Figure 3 or in GenBank Accession number 22749329.
  • a Coco protein such as the human Coco protein shown in Figure 3 or in GenBank Accession number 22749329.
  • An exemplary human Coco protein sequence is
  • the Coco polypeptide (full-length or N-terminally truncated) comprising the myostatin binding domain binds myostatin with a K d of 1 ⁇ M or less, and more preferably a K ⁇ j of 100 nM, 10 nM or even 1 nM or less.
  • the myostatin binding domain is part of a fusion protein including, in addition to the myostatin binding domain, one or more polypeptide portions that enhance one or more of in vivo stability, in vivo half life, uptake/administration, tissue localization or distribution, formation of protein complexes, and/or purification.
  • the fusion protein can include an immunoglobulin Fc domain.
  • the fusion protein may include a purification subsequence, such as an epitope tag, a FLAG tag, a polyhistidine sequence, or as a GST fusion.
  • the myostatin binding domain is part of a protein that includes one or more modified amino acid residues, such as a glycosylated amino acid, a PEGylated amino acid, a famesylated amino acid, an acetylated amino acid, a biotinylated amino acid, an amino acid conjugated to a lipid moiety, or an amino acid conjugated to an organic derivatizing agent.
  • the subject variant CDG polypeptide is selective for binding and inhibition of myostatin, e.g., relative to GDF-11 and/or nodal.
  • the variant CDG polypeptide can be one which has a dissociation constant (IGj) for myostatin binding that is at least 2 times less than its ICj for binding GDF-11 and/or nodal, and even more preferably at least 5, 10, 100 or even 1000 times less.
  • IGj dissociation constant
  • the subject variant CDG polypeptide can also be selected based on relative in vivo potency, such as an inhibitor that has an EC 50 for inhibiting myostatin activity, or a particular physiological consequence (such as promoting muscle growth, promoting bone density or inducing adipocytes differentiation) that is at least 2 times less than its EC 50 for inhibiting GDF-11 and/or nodal activities, and even more preferably at least 5, 10, 100 or even 1000 times less.
  • the subject variant CDG polypeptide is selective for binding and inhibition of myostatin, e.g., relative to other BMP proteins such as BMP-4.
  • the variant CDG polypeptide can be one which has a dissociation constant (KL ) for myostatin binding that is at least 2 times less than its ICj for binding BMP-4, and even more preferably at least 5, 10, 100 or even 1000 times less.
  • KL dissociation constant
  • the subject variant CDG polypeptide can also be selected based on relative in vivo potency, such as an inhibitor that has an EC 50 for inhibiting myostatin activity, or a particular physiological consequence (such as promoting muscle growth, promoting bone density or inducing adipocytes differentiation) that is at least 2 times less than its EC50 for inhibiting BMP-4 activities, and even more preferably at least 5, 10, 100 or even 1000 times less.
  • the variant CDG polypeptide binding domain binds myostatin with a K ⁇ ⁇ of 1 ⁇ M or less, and more preferably a ICj of 100 nM, 10 nM or even 1 nM or less.
  • the subject myostatin inhibtor preparations are suitable for use in a human patients.
  • the subject preparations of variant CDG polypeptides will be substantially free of pyrogenic materials so as to be suitable for administration to a human patient.
  • the subject variant CDG polypeptides can be administered to non-human animals, particularly other mammals.
  • the compounds of the present invention can be given to chickens, turkeys, livestock animals (such as sheep, pigs, horses, cattle, etc.), companion animals (e.g., cats and dogs) or may have utility in aquaculture to accelerate growth and improve the protein/fat ratio.
  • livestock animals such as sheep, pigs, horses, cattle, etc.
  • companion animals e.g., cats and dogs
  • the subject variant Cerberus polypeptides can be used to stimulate growth or enhance feed efficiency of animals raised for meat production to improve carcass quality, or to increase milk production in dairy cattle.
  • packaged pharmaceuticals comprising a pharmaceutical preparation of a variant CDG polypeptide, as described herein, and a label or instructions for use in promoting growth of muscle tissue in a human patient.
  • Still another aspect of the invention relates to packaged pharmaceuticals comprising a pharmaceutical preparation of a variant CDG polypeptide, as described herein, and a label or instructions for veternerian use in promoting growth of muscle tissue in a non-human mammal.
  • Another aspect of the invention relates to a method for inhibiting myostatin signal transduction in vivo by administering a pharmaceutical preparation of one or more of the subject variant CDG polypeptides.
  • the subject method can be used to promote muscle growth, promote adipogenic differentiation, and/or promote bone growth or mineralization in human patients or in non-human animals.
  • the treatment methods of the present invention can be used to reduce the severity of a pathologic condition, which is characterized, at least in part, by an abnormal amount, development or metabolic activity of muscle or adipose tissue in a subject.
  • a pathologic condition which is characterized, at least in part, by an abnormal amount, development or metabolic activity of muscle or adipose tissue in a subject.
  • the pharmaceutical preparations of the present invention can be administered in an amount effective to prevent, ameliorate or reduce the severity of a wasting disorder, such as cachexia, anorexia, DMD syndrome, BMD syndrome, AIDS wasting syndrome, muscular dystrophies, neuromuscular diseases, motor neuron diseases, diseases of the neuromuscular junction, and inflammatory myopathies.
  • Exemplary muscular dystrophies that can be treated with a regimen including the subject myostatin include: Duchenne Muscular Dystrophy (DMD), Becker Muscular Dystrophy (BMD), Emery-Dreifuss Muscular Dystrophy (EDMD), Limb-Girdle Muscular Dystrophy (LGMD), Facioscapulohumeral Muscular Dystrophy (FSH or FSHD) (Also known as Landouzy-Dejerine), Myotonic Dystrophy (MMD) (Also known as Steinert's Disease), Oculopharyngeal Muscular Dystrophy (OPMD), Distal Muscular Dystrophy (DD), and Congenital Muscular Dystrophy (CMD).
  • DMD Duchenne Muscular Dystrophy
  • BMD Becker Muscular Dystrophy
  • EDMD Emery-Dreifuss Muscular Dystrophy
  • LGMD Limb-Girdle Muscular Dystrophy
  • Exemplary motor neuron diseases that can be treated with a regimen including the subject myostatin include: Amyotrophic Lateral Sclerosis (ALS) (Also known as Lou Gehrig's Disease), Infantile Progressive Spinal Muscular Atrophy (SMA, SMA1 or WH) (Also known as SMA Type 1, Werdnig-Hoffman), Intermediate Spinal Muscular Atrophy (SMA or SMA2) (Also known as SMA Type 2), Juvenile Spinal Muscular Atrophy (SMA, SMA3 or KW) (Also known as SMA Type 3, Kugelberg-Welander), Spinal Bulbar Muscular Atrophy (SBMA) (Also known as Kennedy's Disease and X-Linked SBMA), and Adult Spinal Muscular Atrophy (SMA).
  • ALS Amyotrophic Lateral Sclerosis
  • SMA Infantile Progressive Spinal Muscular Atrophy
  • SMA Intermediate Spinal Muscular Atrophy
  • SMA Juvenile Spinal Muscular Atrophy
  • SMA SMA Type 3
  • Exemplary inflammatory myopathies that can be treated with a regimen including the subject myostatin include: Dermatomyositis (PM/DM), Polymyositis (PM/DM), and Inclusion Body Myositis (LBM).
  • Exemplary diseases of the neuromuscular junction include: Myasthenia Gravis (MG), Lambert-Eaton Syndrome (LES), and Congenital Myasthenic Syndrome (CMS).
  • Exemplary myopathies due to endocrine abnormalities that can be treated with a regimen including the subject myostatin include: Hyperthyroid Myopathy (HYPTM) and Hypothyroid Myopathy (HYPOTM).
  • Exemplary diseases of peripheral nerve that can be treated with a regimen including the subject myostatin include: Charcot-Marie-Tooth Disease (CMT), Dejerine-Sottas Disease (DS), and Friedreich's Ataxia (FA).
  • CMT Charcot-Marie-Tooth Disease
  • DS Dejerine-Sottas Disease
  • FA Friedreich's Ataxia
  • Other exemplary myopathies that can be treated with a regimen including the subject myostatin include: Myotonia Congenita (MC), Paramyotonia Congenita (PC), Central Core Disease (CCD), Nemaline Myopathy (NM), Myotubular Myopathy (MTM or MM), and Periodic Paralysis (PP).
  • MC Myotonia Congenita
  • PC Paramyotonia Congenita
  • CCD Central Core Disease
  • NM Nemaline Myopathy
  • MTM or MM Myotubular Myopathy
  • PP Periodic Paralysis
  • Exemplary metabolic diseases of muscle that can be treated with a regimen including the subject myostatin include: Phosphorylase Deficiency (MPD or PYGM), Acid Maltase Deficiency (AMD), Phosphofructokinase Deficiency (PFKM), Debrancher Enzyme Deficiency (DBD), Mitochondrial Myopathy (MITO), Carnitine Deficiency (CD), Carnitine Palmityl Transferase Deficiency (CPT), Phosphoglycerate Kinase Deficiency (PGK), Phosphoglycerate Mutase Deficiency (PGAM or PGAMM), Lactate Dehydrogenase Deficiency (LDHA), and Myoadenylate Deaminase Deficiency (MAD).
  • Phosphorylase Deficiency MPD
  • AMD Acid Maltase Deficiency
  • PFKM Phosphofructokinase Deficiency
  • DBD Debrancher En
  • the subject method can also be used to prevent, ameliorate or reduce the severity of a metabolic disorder, such as in the treatment of obesity or type II diabetes.
  • the subject variant CDG polypeptide preparations can be used to decrease body fat proportion in a subject.
  • the variant CDG polypeptide preparations can be used as part of such methods as: treating or preventing congestive heart failure; for reducing frailty associated with aging; increasing bone density (such as for treating osteoporosis) or accelerating bone fracture repair; treating growth retardation, treatment of physiological short stature, attenuating protein catabolic response such as after a major operation; reducing protein loss due to chronic illness; accelerating wound healing; accelerating the recovery of burn patients or patients having undergone major surgery; maintenance of skin thickness; metabolic homeostasis and renal homeostasis.
  • the subject variant CDG polypeptides include: treating growth hormone deficient adults and preventing catabolic side effects of glucocorticoids.
  • the subject pharmaceutical composition can also be used as myostatin antagonist to treat a number of neuronal system disease conditions, including CNS injuries / disease such as spinal cord injury and stroke, and PNS injuries / diseases.
  • the present invention also contemplates the use of the subject myostatin formulations conjointly with one or more other compounds useful in an effort to treat the diseases or therapeutic indications enumerated above.
  • the therapeutic agents and the variant CDG polypeptides of this invention may be independently and sequentially administered or co-administered.
  • Combined therapy to inhibit bone resorption, prevent osteoporosis, reduce skeletal fracture, enhance the healing of bone fractures, stimulate bone formation and increase bone mineral density can be effectuated by combinations of bisphosphonates and the variant CDG polypeptides of this invention.
  • Bisphosphonates with these utilities include but are not limited to alendronate, tiludronate, dimethyl-APD, risedronate, etidronate, YM-175, clodronate, pamidronate, and BM-210995 (ibandronate).
  • the subject mysostatin inhibitors may be combined with a mammalian estrogen agonist/antagonist.
  • the term estrogen agonist/antagonist refers to compounds which bind with the estrogen receptor, inhibit bone turnover and prevent bone loss.
  • estrogen agonists are herein defined as chemical compounds capable of binding to the estrogen receptor sites in mammalian tissue, and mimicking the actions of estrogen in one or more tissue.
  • Estrogen antagonists are herein defined as chemical compounds capable of binding to the estrogen receptor sites in mammalian tissue, and blocking the actions of estrogen in one or more tissues. A variety of these compounds are described and referenced below, however, other estrogen agonists/antagonists will be known to those skilled in the art.
  • Exemplary estrogen agonist/antagonists include droloxifene and associated compounds (see U.S. patent 5,047,431), tamoxifen and associated compounds (see U.S. patent 4,536,516), 4-hydroxy tamoxifen (see U.S.
  • the subject mysostatin inhibitors may also be combined with one or more of the following agents: glutamate antagonists (including partial antagonists) such as riluzole and topiramate; polypeptide growth factors, such as growth hormone (GH) and insulin-like growth factor 1 (IGF-1), or drugs that increases the body's own production of neurotrophic factors, such as xaliproden; anti-inflammatory agents, such as celecoxib (Celebrex) and other COX-2 inhibitors; antibiotics, such as minocycline (Minocin, Dynacin) or other agents that inhibit caspase enzymes; Protein kinase C inhibitors such as tamoxifen (Nolvadex); and various over-the-counter substances, including vitamin E, coenzyme Q10 and creatine.
  • glutamate antagonists including partial antagonists
  • polypeptide growth factors such as growth hormone (GH) and insulin-like growth factor 1 (IGF-1)
  • drugs that increases the body's own production of neurotrophic factors such as
  • Figure 1 is a schematic drawing of a full-length and an N-terminally truncated version of Cerberus, showing the intact C-terminal Cys-knot domain.
  • the lower panel shows the predicted position of the N-terminal deletion of Cerberus, based on the crystal structure of Noggin bound to BMP-7.
  • Figure 2 shows a schematic drawing of where Wnt, Nodal and BMP bind to Cerberus.
  • BMP -2 and the highly related BMP-4 competitively bind Cerberus, likely in the same region.
  • Other more distantly related or unrelated proteins, such as TGF-betal, EGF, and PDGF do not compete with BMP-4.
  • the N-terminally truncated version of Cerberus still binds Xnr-1 (Xenopus homolog of mouse Nodal).
  • Figure 3 Coco a BMP inhibitor.
  • A Nucleotide sequence of Xenopus Coco, showing the nucleotide sequence, including the coding region, and the corresponding translated amino acid sequence.
  • B Alignment at the amino acid level of Xenopus, Fugu, human and mouse Coco and other family members, Cerberus and Caronte. See Bell et al. (2003) Development 130(7): 1381-1389 which is incorporated by reference herein.
  • FIG. 4 Binding of Caronte to GDF-11.
  • the tracing shows that Caronte binds to GDF- 11 on a BiaCore chip.
  • GDF-11 was immobilized on a BiaCore CM5 chip using standard amine coupling procedure.
  • Trace Caronte (200 ⁇ g/ml; R&D Systems) was injected on the GDF-11 coupled chip.
  • FIG. 5 A-204 Reporter Gene Assay.
  • the figure shows the Reporter vector: pGL3(CAGA)12 (described in Dennler et al, 1998, EMBO 17: 3091-3100.)
  • the CAGA12 motif is present in TGF-Beta responsive genes ( PAI-1 gene), so this vector is of general use for factors signaling through Smad2 and 3.
  • Figure 6 Caronte inhibits GDF-11 signaling in the A-204 Reporter Gene Assay.
  • An ActRIIA-Fc ("IIA muG2a") fusion also inhibits GDF-11 signaling.
  • Figure 7 Caronte does not inhibit Activin A in the A-204 Reporter Gene Assay.
  • An ActRIIA-Fc fusion (IIA muG2a), as expected, does inhibit Activin A signaling.
  • Cerberus functions as a multivalent growth factor antagonist in the extracellular space and inhibits signaling by BMP-4, nodal, and Wnt (Belo et al., Genesis 26: 265-70, 2000).
  • Mouse Cerberus binds to BMP proteins and nodal via independent sites (Piccolo, supra), whereas the Xenopus Cerberus also binds Wnt proteins and inhibits their actions (Belo, supra). Cerberus has the unique property of inducing ectopic heads in the absence of trunk structures (Piccolo, supra).
  • Cerberus during gastrulation is activated by nodal-related signals in endoderm and by Spemann-organizer factors (Yamamoto et al., Dev Biol 257: 190-204, 2003).
  • Orthologs for Cerberus can be found in Xenopus tropicalis and Fugu rubripes, but are missing in invertebrates. In Fugu rubripes, there is only one ortholog for Cerberus. All orthologous genes for Cerberus have two exons; the first eight amino acids of the cystine- knot domain are encoded by the 3' end of the first exon and the remainder of the motif by the second exon.
  • Coco is another member of the Cerberus/Dan family of proteins that inhibits Nodal signaling.
  • the present invention invention provides Coco or Cerberus derivatives for inhibiting Nodal, GDF-11 and/or myostatin function.
  • the Coco and Cerberus derivatives inhibit Nodal, GDF-11 and/or myostatin function without substantially compromising BMP (such as BMP-4) signaling (e.g., does not substantially bind BMP-4 or other BMPs).
  • BMP such as BMP-4
  • the subject Cerberus derivatives may also be used to inhibit BMP (such as BMP-4) signaling.
  • Exemplary preparations of the subject invention include Cerberus polypeptide derivatives, including the N-terminal truncated versions of Cerberus. These so-called “Cerberus derivatives” can be used to reduce the severity of a pathologic condition, which is characterized, at least in part, by an abnormal amount, development or metabolic activity of muscle or adipose tissue in a subject.
  • the pharmaceutical preparations of the present invention can be administered in an amount effective to prevent, ameliorate or reduce the severity of a wasting disorder, such as cachexia, anorexia, DMD syndrome, BMD syndrome, AIDS wasting syndrome, muscular dystrophies, neuromuscular diseases, motor neuron diseases, diseases of the neuromuscular junction, and inflammatory myopathies.
  • a wasting disorder such as cachexia, anorexia, DMD syndrome, BMD syndrome, AIDS wasting syndrome, muscular dystrophies, neuromuscular diseases, motor neuron diseases, diseases of the neuromuscular junction, and inflammatory myopathies.
  • “approximately” may mean values that are within an order of magnitude, preferably within 5- fold and more preferably within 2-fold of a given value. Numerical quantities given herein are approximate unless stated otherwise, meaning that the term “about” or “approximately” can be inferred when not expressly stated.
  • the methods of the invention may include steps of comparing sequences to each other, including wild-type sequence to one or more mutants / sequence variants Such comparisons typically comprise alignments of polymer sequences, e.g., using sequence alignment programs and/or algorithms that are well known in the art (for example, BLAST, FASTA and MEGALIGN, to name a few).
  • sequence alignment will introduce a "gap” (typically represented by a dash, or "A") in the polymer sequence not containing the inserted or deleted residue.
  • Gap typically represented by a dash, or "A”
  • homologous in all its grammatical forms and spelling variations, refers to the relationship between two proteins that possess a “common evolutionary origin,” including proteins from superfamilies in the same species of organism, as well as homologous proteins from different species of organism. Such proteins (and their encoding nucleic acids) have sequence homology, as reflected by their sequence similarity, whether in terms of percent identity or by the presence of specific residues or motifs and conserved positions.
  • sequence similarity in all its grammatical forms, refers to the degree of identity or correspondence between nucleic acid or amino acid sequences that may or may not share a common evolutionary origin.
  • sequence similarity when modified with an adverb such as “highly,” may refer to sequence similarity and may or may not relate to a common evolutionary origin.
  • a nucleic acid molecule is "hybridizable" to another nucleic acid molecule, such as a cDNA, genomic DNA, or RNA, when a single stranded form of the nucleic acid molecule can anneal to the other micleic acid molecule under the appropriate conditions of temperature and solution ionic strength (see Sambrook et al. Molecular Cloning: A Laboratory Manual, Second Edition (1989) Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y.). The conditions of temperature and ionic strength determine the "stringency" of the hybridization.
  • low stringency hybridization conditions corresponding to a T m (melting temperature) of 55°C
  • T m melting temperature
  • Moderate stringency hybridization conditions correspond to a higher T m , e.g., 40% formamide, with 5 x or 6 x SSC.
  • High stringency hybridization conditions correspond to the highest T m , e.g., 50% formamide, 5 x or 6 x SSC.
  • SSC is 0.15 M NaCl, 0.015 M Na-citrate.
  • High stringent condition is well understood in the art to encompass conditions of hybridization which allow hybridization of structurally related, but not structurally dissimilar, nucleic acids.
  • stringent is a term of art which is understood by the skilled artisan to describe any of a number of alternative hybridization and wash conditions which allow annealing of only highly complementary nucleic acids.
  • Exemplary high stringent hybridization conditions is equivalent to about 20-27°C below the melting temperature (T m ) of the DNA duplex formed in about 1 M salt.
  • T m melting temperature
  • Hybridization requires that the two nucleic acids contain complementary sequences, although depending on the stringency of the hybridization, mismatches between bases are possible.
  • the appropriate stringency for hybridizing nucleic acids depends on the length of the nucleic acids and the degree of complementation, variables well known in the art. The greater the degree of similarity or homology between two nucleotide sequences, the greater the value of T m , for hybrids of nucleic acids having those sequences.
  • RNA:RNA, DNA:RNA, DNA:DNA The relative stability (corresponding to higher T m ) of micleic acid hybridizations decreases in the following order: RNA:RNA, DNA:RNA, DNA:DNA.
  • equations for calculating T m have been derived (see Sambrook et al, supra, 9.51).
  • the position of mismatches becomes more important, and the length of the oligonucleotide determines its specificity (see Sambrook et al, supra, 11.8).
  • a minimum length for a hybridizable nucleic acid is at least about 10 nucleotides; preferably at least about 15 nucleotides; and more preferably the length is at least about 20 nucleotides.
  • standard hybridization conditions refers to a T m of about 55°C, and utilizes conditions as set forth above. In a preferred embodiment, the T m is 60°C; in a more preferred embodiment, the T m is 65°C.
  • “high stringency” refers to hybridization and/or washing conditions at 68°C in 0.2 x SSC, at 42°C in 50% formamide, 4 x SSC, or under conditions that afford levels of hybridization equivalent to those observed under either of these two conditions.
  • Suitable hybridization conditions for oligonucleotides are typically somewhat different than for full-length nucleic acids (e.g., full-length cDNA), because of the oligonucleotides' lower melting temperature. Because the melting temperature of oligonucleotides will depend on the length of the oligonucleotide sequences involved, suitable hybridization temperatures will vary depending upon the oligonucleotide molecules used.
  • Exemplary temperatures may be 37°C (for 14-base oligonucleotides), 48°C (for 17-base oligonucleotides), 55°C (for 20-base oligonucleotides) and 60°C (for 23-base oligonucleotides).
  • Exemplary suitable hybridization conditions for oligonucleotides include washing in 6 x SSC, 0.05% sodium pyrophosphate, or other conditions that afford equivalent levels of hybridization.
  • Polypeptide “peptide” or “protein” are used interchangeably to describe a chain of amino acids that are linked together by chemical bonds called “peptide bonds.”
  • a protein or polypeptide, including an enzyme may be a "native” or “wild-type,” meaning that it occurs in nature; or it may be a “mutant,” “variant,” or “modified,” meaning that it has been made, altered, derived, or is in some way different or changed from a native protein or from another mutant.
  • the terms “Cerberus/Dan/Gremlin superfamily protein” and “CDG protein” are both used to signify the protein family which comprises Cerberus, Coco and other related proteins.
  • Cerberus or Cerberus-like protein refers to mammalian Cerberus and Cerberus-like proteins, such as the murine (NCBI RefSeq ID NP_034017) or human (NCBI RefSeq ID NP_005445) Cerberus proteins (also see SEQ ID Nos. 2 and 8, respectively, of US 2002/0164682 Al, the entire contents of which is incorporated herein by reference), and other proteins which share sequence homology to the highly conserved cysteine pattern of the C-terminal portion of the mammalian Cerberus proteins.
  • Exemplary amino acid sequences for Cerberus proteins include Murine Cerberus protein (NCBI RefSeq ID NP_034017): ' 1 m lllvqllv llplg adlc vdgcqsqgsl sfpllergrr dlhvanheea edkpdlfvav 61 phlmgtslag egqrqrgkml srlgrf kkp etefypprdv esdhvssgmq avtqpadgrk 121 versplqeea krfwhrfmfr kgpafqgvil pikshevhwe tcrtvpfnqt iahedcqkw 181 vqnnlcfgkc ssirfpgega dahsfcshcs ptkfttvhlm ln
  • NCBI RefSeq ID NM_005454.1 human Cerberus mRNA.
  • NM_009887.1 (mouse Cerberus mRNA). 1 gggggggggggg ggggtcagag ggagctttct tttaggcccg tccatctgtg aatctaacct 61 cagtttctgg gaatcaggaa gcatgcatct cctcttagtt cagctgcttg ttctcttgccc 121 tctggggaag gcagacctat gtgtggatgg ctgccagagt cagggctctttttcc 181 tctctagaa aggggtcgca gagatctcca c cacgaggagg cagaagacaa 241 gccggatctg ttggccg tgccacacct catgggcacc agc
  • Cerberus related proteins also exist in other species, including family members in Xenopus, and Drosophila, C. elegans, zebrafish, as well as in all manmnals, for example, rats, mice and humans.
  • Cerberus or Cerberus-like proteins also includes variants of the Cerberus proteins, such as allelic variants or variants induced by mutagenesis or deletions, and fragments of Cerberus proteins which variants and fragments retain myostatin binding activity.
  • Cerberus-like proteins is also used to signify the family of proteins sharing structural and/or functional similarity, including those proteins which are described further herein.
  • Such proteins may have amino acid sequences sharing significant sequence identity (e.g., at least about 50%, 60%, 70%, 80%, 90%, 95%, 99% or more) with the human or mouse Cerberus proteins, over the full-length, or at least within the myostatin binding domain of the human or mouse Cerberus.
  • Cerberus-like proteins also include proteins that have amino acid sequences that are encoded by nucleic acid sequences that hybridize under stringent conditions with the coding sequences for human or mouse Cerberus, particularly that portion of the coding sequence for the myostatin binding domain.
  • a Cerberus derivative or variant sequence may or may not lack the N-terminal BMP binding domain.
  • Coco or Coco-like protein refers to mammalian Coco proteins and related homologs, such as the human Coco protein of GenBank Accession 22749329, and other proteins which share sequence homology to the highly conserved cysteine pattern of the C- terminal portion of the mammalian Coco proteins.
  • An exemplary amino acid sequences for human Coco protein is
  • Coco-related proteins also exist in other species, including family members in Xenopus, and Drosophila, C. elegans, zebrafish, as well as in all manmnals, for example, rats, mice and non-human primates.
  • Coco or Coco-like proteins also includes variants of the naturally occurring Coco proteins, such as allelic variants or variants induced by mutagenesis or deletions, and fragments of Coco proteins which variants and fragments retain myostatin binding activity.
  • Coco-like proteins is also used to signify the family of proteins sharing structural and/or functional similarity, including those proteins which are described further herein.
  • Such proteins may have amino acid sequences sharing significant sequence identity (e.g., at least about 50%, 60%, 70%, 80%, 90%, 95%, 99% or more) with the human Coco protein, over the full-length, or at least within the myostatin binding domain of the human Coco.
  • Coco-like proteins also include proteins that have amino acid sequences that are encoded by nucleic acid sequences that hybridize under stringent conditions with the coding sequences for human Coco, particularly that portion of the coding sequence for the myostatin binding domain.
  • a Coco derivative or variant sequence may or may not lack the N- terminal BMP binding domain.
  • Cerberus (derivative) therapeutics or its grammatical variations include the full-length or the N-terminally truncated versions of Cerberus therapeutics.
  • Cerberus or Cerberus-like activity refers to one or more of the activities which are exhibited by the mammalian Cerberus-like proteins of the present invention.
  • Cerberus or Cerberus-like activity includes the ability to induce, enhance and/or inhibit the formation, growth, proliferation, differentiation, maintenance of neurons and/or related neural cells and tissues such as brain cells, Schwann cells, glial cells and astrocytes.
  • Cerberus or Cerberus-like activity also includes the ability to induce molecular markers of neuroendocrine or ectoderm tissue, such as OTX2, N-CAM, MASH, chromagranin, and AP2, as well as the ability to induce the formation of neurons and/or related neural cells and tissues such as brain cells, Schwann cells, glial cells and astrocytes.
  • Cerberus or Cerberus-like activity may also include the ability to regulate the interaction of ligands and their protein receptors.
  • “Cerberus or Cerberus-like activity” may further include the ability to regulate the formation, differentiation, proliferation and/or maintenance of other cells and/or tissue, for example connective tissue, organs and wound healing.
  • Cerberus or Cerberus-like activity may include the ability to enhance and/or inhibit the formation, growth, proliferation, differentiation and/or maintenance of cardiac, spleen, liver, pancreas, stomach, kidney, lung and brain cells and tissue, as well as osteoblasts and bone, chondrocytes and cartilage, tendon, epidermis and muscle.
  • Cerberus and Cerberus-like activity also includes the activities of Cerberus and Cerberus-like protein in the assays described in the examples and specification herein. Cerberus and Cerberus-like nucleotide sequences in mouse and human are as disclosed in US 2002/0164682 Al, as SEQ ID NOs. 1 and 7 (incorporated herein by reference).
  • the mysotatin inhibitor is a polypeptide that includes a myostatin binding domain of a Coco protein, such as the human Coco protein shown in Figure 3 or in GenBank Accession number 22749329.
  • An exemplary human Coco protein sequence is
  • antibody and “antibody agent” are used interchangeably herein, and refer to an immunoglobulin molecule obtained by in vitro or in vivo generation of the humoral response, and includes both polyclonal and monoclonal antibodies.
  • the term also includes genetically engineered forms such as chimeric antibodies (e.g., humanized murine antibodies), heteroconjugate antibodies (e.g., bispecific antibodies), and recombinant single chain Fv fragments (scFv).
  • antibody also includes antigen binding forms of antibodies (e.g., Fab', F(ab') 2 , Fab, Fv, rlgG, and, inverted IgG).
  • antigen binding fragment includes any portion of an antibody that binds to a target epitope.
  • An antigen binding fragment may be, for example, a polypeptide including a CDR3 region, or other fragment of an immunoglobulin molecule which retains the affinity and specificity of the myostatin epitope.
  • Specifically binds includes reference to the preferential association of a ligand, in whole or part, with a particular target molecule (i.e., "binding partner” or “binding moiety”) relative to compositions lacking that target molecule. It is, of course, recognized that a certain degree of non-specific interaction may occur between the subject myostatin neutralizing antibodies and a other proteins.
  • specific binding may be distinguished as mediated through specific recognition of the myostatin protein.
  • specific binding results in a much stronger association between the antibody and myostatin protein than between the antibody and other proteins, e.g., GDF11.
  • Specific binding by an antibody to myostatin under such conditions requires an antibody that is selected for its specificity for a particular protein.
  • the affinity constant (Ka, as opposed to Kd) of the antibody binding site 7 ft 0 for its cognate monovalent antigen is at least 10 , usually at least 10 , preferably at least 10 , more preferably at least 10 10 , and most preferably at least 10 ⁇ M.
  • affinity constant Ka, as opposed to Kd
  • solid-phase ELISA immunoassays are routinely used to select monoclonal antibodies specifically reactive with a protein. See Harlow and Lane (1988) Antibodies, A Laboratory Manual, Cold Spring Harbor Publications, New York, for a description of immunoassay formats and conditions that can be used to determine specific reactivity. Immunoassays in the competitive binding format can be used to determine cross- reactivity of antibodies with myostatin, e.g., to identify whether a test antibody is a myostatin neutralizing antibody. For example, the myostatin protein, or a fragment thereof is immobilized to a solid support.
  • Test antibodies are added to the assay compete with the binding of a TGF receptor, such as ActRII or ALK7, to the immobilized antigen.
  • a TGF receptor such as ActRII or ALK7
  • the ability of the test antibodies to compete with the binding of a TGF receptor to the immobilized myostatin antigen is compared.
  • immunoassays in the competitive binding format can be used to determine cross-reactivity determinations, e.g., to determine the specificity of a myostatin neutralizing antibody.
  • the myostatin protein, or the myostatin epitope thereof is immobilized to a solid support.
  • Epitopes from other proteins such as GDF-11, Nodal or BMP-4 or other proteins having sequence homology with myostatin are added to the assay to compete with the binding of a potential myostatin neutralizing antibody to the immobilized antigen.
  • the ability of the test peptides to compete with the binding of potential myostatin neutralizing antibody with the immobilized myostatin antigen is compared.
  • the percent cross-reactivity of the potential myostatin neutralizing antibody for the other antigens is calculated, using standard calculations.
  • the subject myostatin neutralizing antibodies have less than 10% cross-reactivity with GDF-11. In other preferred embodiments, the subject myostatin neutralizing antibodies have less than 1%, 5%, or 10% cross-reactivity with BMP-4.
  • the mysotatin inhibitor is a Cerberus polypeptide sharing at least about 50%, 60%, 70%, 80%, 90%, 95%, 99% or more sequence identity over the full- length of the human or mouse Cerberus protein (infra). In certain other embodiments, the mysotatin inhibitor is a polypeptide that includes a
  • the mouse protein is largely homologous to the human protein throughout the sequences, with the exception of 5 additional residues at the C-terminus. Therefore, whenever a non-human Cerberus derivative is used, the residue numbers refers to those corresponding to the human sequences.
  • preferred fragments of the human Cerberus derivative proteins are ones which begins anywhere from residues 106-119 (inclusive) at the N-terminus, and ends anywhere after residue 241. Also included are Cerberus derived variant sequence, including mutants or variants of the wild-type myostatin binding domains that retain myostatin binding activity, optionally substantially loses BMP-4 binding.
  • Variant sequences without BMP binding affinity may be desirable as a way to alter selectivity of the inhibitor (e.g., relative to GDF-11 or nodal binding, where preferential binding to one of the proteins occur. Also includes more preferential - higher affinity than wild-type - binding to myostatin, or more discrimitory - lower affinity than wild-type truncated version - binding to BMP-4), alter other binding characteristics with respect to myostatin (such as K , and/or K on or K off rates), or improve biodistribution or half life in vivo or on the shelf. Certain other Cerberus sequences are listed below based on homology search in databases of identified proteins, and the subject variant Cerberus polypeptides can be derived from those proteins as well.
  • conserved regions include the kinase domain, and/or the ligand binding domain. These same conserved regions may be used to generate probes for screening nucleic acid libraries at moderate to low stringency hybridization conditions (see definition section).
  • Xenopus homolog gi
  • Fugu rubripes FuguGenscan_32561 / SINFRUP00000076662.
  • the mysotatin inhibitor is a Cerberus polypeptide sharing at least about 50%, 60%, 70%, 80%, 90%, 95%, 99% or more sequence identity over the full- length of the human or mouse Cerberus protein (infra).
  • the mysotatin inhibitor is a polypeptide that includes a Coco sequence obtained from human, mouse, or other species, their variants or derivatives, including N-terminally truncated versions of Coco.
  • the full-length human Coco protein is disclosed above.
  • the various Cerberus and Coco polypeptides may be prepared as fusion proteins.
  • a fusion protein may include one or more additional polypeptide portion that enhance one or more of in vivo stability, in vivo half life, uptake/administration, tissue localization or distribution, formation of protein complexes, and/or purification.
  • a fusion protein may include an immunoglobulin Fc domain and/or a purification subsequence selected from: an epitope tag, a FLAG tag, a polyhistidine sequence, and a GST fusion.
  • the myostatin antagonist protein may include one or more modified amino acid residues selected from: a glycosylated amino acid, a PEGylated amino acid, a famesylated amino acid, an acetylated amino acid, a biotinylated amino acid, an amino acid conjugated to a lipid moiety, and an amino acid conjugated to an organic derivatizing agent.
  • a fusion protein or coupled protein system (e.g. non-fusion covalent linkage by crosslinking) may also include a second myostatin inhibitor domain, which is a polypeptide affinity reagent that selectively binds to myostatin and competes with the binding of an ALK7 or ALK4 receptor.
  • the affinity reagent may be an antibody agent.
  • An antibody agent may be, for example, a recombinant antibody; a monoclonal antibody; a VH domain; a VL domain; an scFv; an Fab fragment; an Fab' fragment; an F(ab')2; an Fv; or a disulfide linked Fv, a fully human antibody or a humanized chimeric antibody, or an antigen binding fragment thereof.
  • An affinity reagent is a peptide or scaffolded peptide that selectively binds to myostatin and competes with the binding of an ALK7 or ALK4 receptor.
  • An affinity reagent may include a myostatin binding domain of ALK7 or ALK4.
  • an extracellular domain of ALK7 or ALK4 (preferably human ALK7 or ALK4) may be used.
  • the affinity reagent may be a small organic molecule that selectively binds to myostatin and competes with the binding of an ALK7 or ALK4 receptor.
  • An example of a human ALK7 myostatin binding domain is shown below: LKCVCLLCDSSNFTCQTEGACWASVMLTNGKEQVIKSCVSLPELNAQVFCHS
  • SNNVTKTECCFTDFCNNITLHLP An example of a human ALK4 myostatin binding domain is shown below: ALLCACTSCLQANYTCETDGACMVS ⁇ FNLDGMEHHVRTCIPKVELVPAGK PFYCLSSEDLRNTHCCYTDY As shown herein, Caronte, and therefore human Cerberus and presumably Coco also, does not substantially inhibit Activin A signaling in an A204 Reporter Gene Assay. Thus, such myostatin antagonists will preferably exhibit little or no interaction with Activin A- mediated signaling. IV.
  • the subject variant Coco and Cerberus polypeptides can be used in a number of therapeutic settings to treat a number of diseases resulting from or exacerbated by the presence of myostatin.
  • the subject polypeptides and derivatives thereof are used as part of a treatment for a muscular dystrophy.
  • muscle dystrophy refers to a group of degenerative muscle diseases characterized by gradual weakening and deterioration of skeletal muscles and sometimes the heart and respiratory muscles. Muscular dystrophies are genetic disorders characterized by progressive muscle wasting and weakness that begin with microscopic changes in the muscle.
  • Exemplary muscular dystrophies that can be treated with a regimen including the subject myostatin include: Duchenne Muscular Dystrophy (DMD), Becker Muscular Dystrophy (BMD), Emery-Dreifuss Muscular Dystrophy (EDMD), Limb-Girdle Muscular Dystrophy (LGMD), Facioscapulohumeral Muscular Dystrophy (FSH or FSHD) (Also known as Landouzy-Dejerine), Myotonic Dystrophy (MMD) (Also known as Steinert's Disease), Oculopharyngeal Muscular Dystrophy (OPMD), Distal Muscular Dystrophy (DD), Congenital Muscular Dystrophy (CMD).
  • DMD Duchenne Muscular Dystrophy
  • BMD Becker Muscular Dystrophy
  • EDMD Emery-Dreifuss Muscular Dystrophy
  • LGMD Limb-Girdle Muscular Dystrophy
  • Becker Muscular Dystrophy (BMD) is named after the German doctor Peter Emil Becker, who first described this variant of DMD in the 1950s.
  • DMD is one of the most frequent inherited diseases in males, affecting one in 3,500 boys.
  • DMD occurs when the dystrophin gene, located on the short arm of the X chromosome, is broken. Since males only carry one copy of the X chromosome, they only have one copy of the dystrophin gene. Without the dystrophin protein, muscle is easily damaged during cycles of contraction and relaxation. While early in the disease muscle compensates by regeneration, later on muscle progenitor cells cannot keep up with the ongoing damage and healthy muscle is replaced by non- functional fibro-fatty tissue.
  • DMD muscular dystrophy
  • boys begin to show signs of muscle weakness as early as age 3.
  • the disease gradually weakens the skeletal or voluntary muscles, those in the arms, legs and trunk.
  • the boy's heart and respiratory muscles may also be affected.
  • BMD is a much milder version of DMD. Its onset is usually in the teens or early adulthood, and the course is slower and far less predictable than that of DMD. (Though DMD and BMD affect boys almost exclusively, in rare cases they can affect girls. Until the 1980s, little was known about the cause of any kind of muscular dystrophy.
  • the dystrophin gene deficiency was identified as the cause of DMD.
  • BMD results from different mutations in the same gene.
  • BMD patients have some dystrophin, but it's either insufficient in quantity or poor in quality. Having some dystrophin protects the muscles of those with BMD from degenerating as badly or as quickly as those of people with DMD.
  • Recent researches demonstrate that blocking or eliminating Myostatin function in vivo can effectively treat at least certain symptoms in DMD and BMD patients (Bogdanovich et al, supra; Wagner et al., supra).
  • the subject Cerberus derivatives, especially the N- terminally truncated versions thereof constitute an alternative means of blocking the function of Myostatin in vivo in DMD and BMD patients.
  • the subject Coco or Cerberus derivatives provide an effective means to increase muscle mass in other disease conditions that are in need of muscle growth.
  • Foset al. reported that that Myostatin expression correlates inversely with fat-free mass in humans and that increased expression of the Myostatin gene is associated with weight loss in men with AIDS wasting syndrome.
  • Myostatin expression correlates inversely with fat-free mass in humans and that increased expression of the Myostatin gene is associated with weight loss in men with AIDS wasting syndrome.
  • By inhibiting the function of Myostatin in ALDS patients at least certain symptoms of ALDS may be alleviated, if not completely eliminated, thus significantly improving quality of life in ALDS patients. Since loss of Myostatin function is also associated with fat loss without diminution of nutrient intake (Zimmers et al., supra; McPherron and Lee, supra), the subject Coco or
  • Cerberus derivatives may further be used as a therapeutic agent for slowing or preventing the development of obesity and type II diabetes.
  • the cancer anorexia-cachexia syndrome is among the most debilitating and life- threatening aspects of cancer. Progressive weight loss in cancer anorexia-cachexia syndrome is a common feature of many types of cancer and is responsible not only for a poor quality of life and poor response to chemotherapy, but also a shorter survival time than is found in patients with comparable tumors without weight loss.
  • cachexia arises from a complex interaction between the cancer and the host.
  • anorexia-cachexia syndrome affects cytokine production, release of lipid- mobilizing and proteolysis-inducing factors, and alterations in intermediary metabolism.
  • Cachexia should be suspected in patients with cancer if an involuntary weight loss of greater than five percent of premorbid weight occurs within a six- month period. Since systemic overexpression of Myostatin in adult mice was found to induce profound muscle and fat loss analogous to that seen in human cachexia syndromes (Zimmers et al, supra), the subject Coco or Cerberus derivatives, especially the N-terminally truncated versions thereof as a pharmaceutical composition can be beneficially used as a Myostatin antagonist / blocker to prevent, treat, or alleviate the symptoms of the cachexia syndrome, where muscle growth is desired.
  • the subject variant Coco or Cerberus polypeptides can be used to form pharmaceutical compositions that can be beneficially used to prevent, treat, or alleviate symptoms of a host of diseases involving neurodegeneration.
  • the subject Cerberus derivatives may antagonize the inhibitory feedback mechanism mediated through the wild-type ALK7 receptor, thus allowing new neuronal growth and differentiation.
  • the subject Cerberus derivative as a pharmaceutical composition can be beneficially used to prevent, treat, or alleviate symptoms of diseases with neurodegeneration, including Alzheimer's Disease (AD), Parkinson's Disease (PD), Amyotrophic Lateral Sclerosis (ALS), Huntington's disease, etc.
  • AD Alzheimer's disease
  • CNS central nervous system
  • AD patients most commonly die from pneumonia, 8 to 20 years from disease onset.
  • Parkinson's disease is a chronic, incurable, and unstoppable CNS disorder that occurs gradually and results in uncontrolled body movements, rigidity, tremor, and gait difficulties.
  • These motor system problems are related to the death of brain cells in an area of the brain that produces dopamine - a chemical that helps control muscle activity.
  • symptoms appear after age 50.
  • the initial symptoms of PD are a pronounced tremor affecting the extremities, notably in the hands or lips.
  • Subsequent characteristic symptoms of PD are stiffness or slowness of movement, a shuffling walk, stooped posture, and impaired balance.
  • ALS Amyotrophic lateral sclerosis
  • motor neuron disease is a chronic, incurable, and unstoppable CNS disorder that attacks the motor neurons, components of the CNS that connect the brain to the skeletal muscles.
  • ALS the motor neurons deteriorate and eventually die, and though a person's brain normally remains fully functioning and alert, the command to move never reaches the muscles.
  • ALS irritable bowel syndrome
  • Those with ALS may have trouble walking, they may drop things, fall, slur their speech, and laugh or cry uncontrollably.
  • Eventually the muscles in the limbs begin to atrophy from disuse. This muscle weakness will become debilitating and a person will need a wheel chair or become unable to function out of bed.
  • Most ALS patients die from respiratory failure or from complications of ventilator assistance like pneumonia, 3-5 years from disease onset. The causes of these neurological diseases has remained largely unknown. They are conventionally defined as distinct diseases, yet clearly show extraordinary similarities in basic processes and commonly demonstrate overlapping symptoms far greater than would be expected by chance alone.
  • HD Huntington's disease
  • This degeneration causes uncontrolled movements, loss of intellectual faculties, and emotional disturbance.
  • HD is a familial disease, passed from parent to child through a dominant mutation in the wild-type gene.
  • Some early symptoms of HD are mood swings, depression, irritability or trouble driving, learning new things, remembering a fact, or making a decision.
  • concentration on intellectual tasks becomes increasingly difficult and the patient may have difficulty feeding himself or herself and swallowing.
  • the rate of disease progression and the age of onset vary from person to person.
  • Tay-Sachs disease and Sandhoff disease are glycolipid storage diseases caused by the lack of lysosomal ⁇ -hexosaminidase (Gravel et al, in The Metabolic Basis of Inherited Disease, eds. Scriver et al., McGraw-Hill, New York, pp. 2839-2879, 1995).
  • GM 2 ganglioside and related glycolipidssubstrates for ⁇ -hexosaminidase accumulateate in the nervous system and trigger acute neurodegeneration.
  • the onset of symptoms begins in early infancy. A precipitous neurodegenerative course then ensues, with affected infants exhibiting motor dysfunction, seizure, visual loss, and deafness.
  • Apoptosis of neurons and astrocytes was also detected in brain tissue from 10/11 AIDS patients, including 5/5 patients with HIV-1 dementia and 4/5 nondemented patients.
  • Neuronal loss is a also a salient feature of prion diseases, such as Creutzfeldt- Jakob disease in human, BSE in cattle (mad cow disease), Scrapie Disease in sheep and goats, and feline spongiform encephalopathy (FSE) in cats.
  • the subject Cerberus derivatives, including the N-terminally truncated Cerberus derivatives are also useful to prevent, treat, and alleviate symptoms of various PNS disorders, such as the ones described below.
  • the PNS is composed of the nerves that lead to or branch off from the CNS.
  • the peripheral nerves handle a diverse array of functions in the body, including sensory, motor, and autonomic functions.
  • nerves of the PNS When an individual has a peripheral neuropathy, nerves of the PNS have been damaged. Nerve damage can arise from a number of causes, such as disease, physical injury, poisoning, or malnutrition. These agents may affect either afferent or efferent nerves. Depending on the cause of damage, the nerve cell axon, its protective myelin sheath, or both may be injured or destroyed.
  • the term peripheral neuropathy encompasses a wide range of disorders in which the nerves outside of the brain and spinal cord — peripheral nerves — have been damaged.
  • Peripheral neuropathy may also be referred to as peripheral neuritis, or if many nerves are involved, the terms polyneuropathy or polyneuritis may be used.
  • Peripheral neuropathy is a widespread disorder, and there are many underlying causes. Some of these causes are common, such as diabetes, and others are extremely rare, such as acrylamide poisoning and certain inherited disorders.
  • the most common worldwide cause of peripheral neuropathy is leprosy. Leprosy is caused by the bacterium Mycobacterium leprae, which attacks the peripheral nerves of affected people. According to statistics gathered by the World Health Organization, an estimated 1.15 million people have leprosy worldwide. Leprosy is extremely rare in the United States, where diabetes is the most commonly known cause of peripheral neuropathy.
  • peripheral neuropathies include chronic alcoholism, infection of the varicella-zoster virus, botulism, and poliomyelitis.
  • Peripheral neuropathy may develop as a primary symptom, or it may be due to another disease.
  • peripheral neuropathy is only one symptom of diseases such as amyloid neuropathy, certain cancers, or inherited neurologic disorders. Such diseases may affect the peripheral nervous system (PNS) and the central nervous system (CNS), as well as other body tissues.
  • PNS peripheral nervous system
  • CNS central nervous system
  • PNS diseases treatable with the subject Cerberus derivatives include: Brachial Plexus Neuropathies (Diseases of the cervical and first thoracic roots, nerve trunks, cords, and peripheral nerve components of the brachial plexus. Clinical manifestations include regional pain, paresthesia; muscle weakness, and decreased sensation in the upper extremity. These disorders may be associated with trauma, including birth injuries; thoracic outlet syndrome; neoplasms, neuritis, radiotherapy; and other conditions.
  • Diabetic Neuropathies Peripheral, autonomic, and cranial nerve disorders that are associated with disbetes mellitus. These conditions usually result from diabetic microvascular injury involving small blood vessels that supply nerves (vasa nervorum). Relatively common conditions which may be associated with diabetic neuropathy include third nerve palsy; mononeuropathy; mononeuropathy multiplex; diabetic amyotrophy; a painful polyneuropathy; autonomic neuropathy; and thoracoabdominal neuropathy.
  • Mononeuropathies Disease or trauma involving a single peripheral nerve in isolation, or out of proportion to evidence of diffuse peripheral nerve dysfunction.
  • Mononeuropathy multiplex refers to a condition characterized by multiple isolated nerve injuries. Mononeuropathies may result from a wide variety of causes, including ischemia; traumatic injury; compression; connective tissue diseases; cumulative trauma disorders; and other conditions); Neuralgia (Intense or aching pain that occurs along the course or distribution of a peripheral or cranial nerve); Peripheral Nervous System Neoplasms (Neoplasms which arise from peripheral nerve tissue.
  • Nerve Compression Syndromes Mechanisms of nerves or nerve roots from internal or external causes. These may result in a conduction block to nerve impulses, due to, for example, myelin sheath dysfunction, or axonal loss.
  • the nerve and nerve sheath injuries may be caused by ischemia; inflammation; or a direct mechanical effect); Neuritis (A general term indicating inflammation of a peripheral or cranial nerve.
  • Clinical mamfestation may include pain; paresthesias; paresis; or hyperthesia); Polvneuropathies (Diseases of multiple peripheral nerves.
  • the various forms are categorized by the type of nerve affected (e.g., sensory, motor, or autonomic), by the distribution of nerve injury (e.g., distal vs. proximal), by nerve component primarily affected (e.g., demyelinating vs. axonal), by etiology, or by pattern of inheritance).
  • the subject full-length Coco or Cerberus polypepetides or variants thereof are used as part of a treatment for diseases or conditions characterized by excessive or undesirable levels of BMP, such as the ones described below.
  • the heterotopic ossification of muscles, tendons, and ligaments is a common problem faced by orthopaedic surgeons. Hannallah et al. (J Bone Joint Surg Am. 2004 Jan; 86-
  • A(l):80-91) investigated the ability of Noggin (a BMP [bone morphogenetic protein] antagonist) to inhibit heterotopic ossification.
  • Noggin a BMP [bone morphogenetic protein] antagonist
  • Three varying doses of Noggin-expressing muscle-derived stem cells inhibited the heterotopic ossification elicited by BMP-4-expressing muscle-derived stem cells.
  • Each of three varying doses of Noggin-expressing muscle-derived stem cells also significantly inhibited the heterotopic ossification elicited by demineralized bone matrix.
  • All eleven animals that underwent Achilles tenotomy developed heterotopic ossification at the site of the injury in the control limbs. In contrast, the limbs treated with the
  • Noggin-expressing muscle-derived stem cells had a reduction in the formation of heterotopic ossification of 83% and eight of the eleven animals had no radiographic evidence of heterotopic ossification (p ⁇ 0.05).
  • delivery of Noggin mediated by muscle-derived stem cells can inhibit heterotopic ossification caused by BMP-4, demineralized bone matrix, and trauma in an animal model, indicating that gene therapy to deliver BMP inhibitors (Noggin or Cerberus) may become a powerful method to inhibit heterotopic ossification in targeted areas of the body. See also Glaser et al. (J Bone Joint Surg Am. 2003 Dec; 85- A(12):2332-42).
  • Osteoarthritis is a joint disease characterized by osteophyte development, fibrosis, and articular cartilage damage. Effects of exogenous transforming growth factor beta (TGFbeta) isoforms and bone morphogenetic proteins (BMPs) suggest a role for these growth factors in the pathogenesis of OA.
  • TGFbeta transforming growth factor beta
  • BMPs bone morphogenetic proteins
  • the inhibitors studied include a secreted, pan-specific TGF-beta antagonist called murine latency- associated peptide 1 (mLAP-1), intracellular inhibitory Smad6 (a BMP antagonist), and Smad7 (a TGF-beta/BMP inhibitor).
  • mLAP-1 murine latency- associated peptide 1
  • Smad6 a BMP antagonist
  • Smad7 a TGF-beta/BMP inhibitor
  • the secreted TGF-beta inhibitor mLAP-1 increased articular cartilage PG loss.
  • These results indicate a pivotal role of excessive endogenous TGF-beta and BMP in the development of osteophytes and synovial thickening, implicating excessive endogenous TGFbeta and BMP in the pathogenesis of OA.
  • the prevention of cartilage damage by endogenous TGFbeta signifies the protective role of TGF-beta in articular cartilage.
  • the subject Coco or Cerberus pharmaceutical compositions can be used as BMP antagonists to treat OA, including the development of osteophytes and synovial thickening.
  • Fibrodysplasia ossificans progressiva (FOP), a rare genetic disabling disease characterized by heterotopic bone formation, is of special interest for general medicine since the bone morphogenetic proteins (especially BMP-4) involved in its pathogenesis are known to play a role in skeletal morphogenesis, and the gene antagonist to BMP-4 (such as noggin) might be useful in preventing lamellar bone formation.
  • BMP-4 bone morphogenetic proteins
  • noggin such as noggin
  • Atherosclerosis is now viewed as an inflammatory disease occurring preferentially in arterial regions exposed to disturbed flow conditions, including oscillatory shear stress (OS), in branched arteries.
  • OS oscillatory shear stress
  • Sorescu et al. J Biol Chem. 278(33):31128-35, 2003
  • BMP4 is a mechanosensitive, inflammatory factor playing a critical role in early steps of atherogenesis in the lesion-prone areas.
  • the subject Cerberus therapeutics may be used to control BMP-4 induced inflammatory response in early steps of atherogenesis in those areas.
  • the cranial connective tissue framework undergoes intramembranous ossification to form skull bones (calvaria).
  • the subject compositions may be used alone, or as part of a conjoint therapy with other compounds / pharmaceutical compositions.
  • the soluble Coco or Cerberus derivative therapeutics including the N-terminally truncated Cerberus derivative therapeutics for use in the subject methods may be conveniently formulated for administration with a biologically acceptable medium, such as water, buffered saline, polyol (for example, glycerol, propylene glycol, liquid polyethylene glycol and the like) or suitable mixtures thereof.
  • a biologically acceptable medium such as water, buffered saline, polyol (for example, glycerol, propylene glycol, liquid polyethylene glycol and the like) or suitable mixtures thereof.
  • the optimum concentration of the active ingredient(s) in the chosen medium can be determined empirically, according to procedures well known to medicinal chemists.
  • biologically acceptable medium includes any and all solvents, dispersion media, and the like which may be appropriate for the desired route of administration of the pharmaceutical preparation.
  • the use of such media for pharmaceutically active substances is known in the art. Except insofar as any conventional media or agent is incompatible with the activity of the therapeutics, its use in the pharmaceutical preparation of the invention is contemplated. Suitable vehicles and their formulation inclusive of other proteins are described, for example, in the book Remington 's Pharmaceutical Sciences (Remington 's Pharmaceutical Sciences. Mack Publishing Co., Easton, Pa., USA 1985).
  • compositions of the present invention can also include veterinary compositions, e.g., pharmaceutical preparations of the Coco or Cerberus derivative therapeutics suitable for veterinary uses, e.g., for the treatment of live stock (cow, sheep, goat, pig, and horse, etc.) or domestic animals, e.g., cats and dogs.
  • Methods of invention may also be provided by rechargeable or biodegradable devices.
  • compositions according to the present invention may be administered as either a single dose or in multiple doses.
  • the pharmaceutical compositions of the present invention may be administered either as individual therapeutic agents or in combination with other therapeutic agents.
  • the treatments of the present invention may be combined with conventional therapies, which may be administered sequentially or simultaneously.
  • compositions of the present invention may be administered by any means that enables the Coco or Cerberus derivatives to reach the targeted cells / tissues / organs.
  • routes of administration include those selected from the group consisting of oral, intravesically, intravenous, intraarterial, intraperitoneal, local administration into the blood supply of the organ in which the targeted cells reside or directly into the cells.
  • Intravenous administration is the preferred mode of administration. It may be accomplished with the aid of an infusion pump.
  • parenteral administration and “administered parenterally” as used herein means modes of administration other than enteral and topical administration, usually by injection, and includes, without limitation, intravenous, intramuscular, intraarterial, intrathecal, intracapsular, intraorbital, intracardiac, intradermal, intraperitoneal, transtracheal, subcutaneous, subcuticular, intraarticulare, subcapsular, subarachnoid, intraspinal and intrastermal injection and infusion.
  • systemic administration means the administration of a compound, drug or other material other than directly into the central nervous system, such that it enters the patient's system and, thus, is subject to metabolism and other like processes, for example, subcutaneous administration.
  • These compounds may be administered to humans and other animals for therapy by any suitable route of administration, including orally, intravesically, nasally, as by, for example, a spray, rectally, intravaginally, parenterally, intracisternally and topically, as by powders, ointments or drops, including buccally and sublingually.
  • the compounds of the present invention which may be used in a suitable hydrated form, and/or the pharmaceutical compositions of the present invention, are formulated into pharmaceutically acceptable dosage forms such as described below or by other conventional methods known to those of skill in the art.
  • Actual dosage levels of the active ingredients in the pharmaceutical compositions of this invention may be varied so as to obtain an amount of the active ingredient which is effective to achieve the desired therapeutic response for a particular patient, composition, and mode of administration, without being toxic to the patient.
  • the selected dosage level will depend upon a variety of factors including the activity of the particular compound of the present invention employed, or the ester, salt or amide thereof, the route of administration, the time of administration, the rate of excretion of the particular compound being employed, the duration of the treatment, other drugs, compounds and/or materials used in combination with the particular therapeutic employed, the age, sex, weight, condition, general health and prior medical history of the patient being treated, and like factors well known in the medical arts.
  • a physician or veterinarian having ordinary skill in the art can readily determine and prescribe the effective amount of the pharmaceutical composition required. For example, the physician or veterinarian could start doses of the compounds of the invention employed in the pharmaceutical composition at levels lower than that required in order to achieve the desired therapeutic effect and gradually increase the dosage until the desired effect is achieved.
  • a suitable daily dose of a compound of the invention will be that amount of the compound which is the lowest dose effective to produce a therapeutic effect. Such an effective dose will generally depend upon the factors described above. Generally, intravenous, intracerebrovenitricular and subcutaneous doses of the compounds of this invention for a patient will range from about 0.0001 to about 100 mg per kilogram of body weight per day. If desired, the effective daily dose of the active compound may be administered as two, three, four, five, six or more sub-doses administered separately at appropriate intervals throughout the day, optionally, in unit dosage forms. The term "treatment" is intended to encompass also prophylaxis, therapy and cure.
  • the patient receiving this treatment is any animal in need, including primates, in particular humans, and other non-human mammals such as equines, cattle, swine and sheep; and poultry and pets in general.
  • the compound of the invention can be administered as such or in admixtures with pharmaceutically acceptable carriers and can also be administered in conjunction with other antimicrobial agents such as penicillins, cephalosporins, aminoglycosides and glycopeptides.
  • Conjunctive therapy thus includes sequential, simultaneous and separate administration of the active compound in a way that the therapeutical effects of the first administered one is not entirely disappeared when the subsequent is administered.
  • the subject Coco or Cerberus derivatives can be effective soluble agents.
  • the therapeutic polypeptide can be provided a fusion peptide along with a second peptide which promotes solubility.
  • the Cerberus derivatives of the present invention can be provided as part of a fusion polypeptide with all or a fragment of the hinge or Fc portion of the immunoglobulin, which can promote solubility and/or serum stability.
  • the present invention also contemplates a peptidomimetic sequence of the subject polypeptide derivatives as described herein.
  • the nomenclature used herein and the laboratory procedures utilized in the present invention include molecular, biochemical, microbiological and recombinant DNA techniques. Such techniques are thoroughly explained in the literature.
  • Example 1 Sources of Caronte and human Cerberus protein.
  • a human Cerberus sequence was cloned into a human CMV derived expression vector. This construct was transiently transfected in HEK293 cells using polyethylenimine (PEI). After culturing, cells were harvested and conditioned media was collected for purification.
  • Caronte from Gallus gallus was ordered from R&D Systems (Minneapolis, MN).
  • Example 2 Caronte binds GDF-11.
  • GDF-11 is a close homolog of myostatin that regulates neurological processes. GDF-11 was immobilized on a BiaCore CM5 chip using standard amine coupling procedure. Trace: Caronte (200 ⁇ g/ml; R&D Systems) was injected on the GDF-11 coupled chip. The tracing in Figure 4 shows binding of Caronte to GDF-11.
  • Example 3 Caronte and human Cerberus inhibit GDF-11 and Myostatin-mediated signaling.
  • An A-204 Reporter Gene Assay was used to evaluate the effects of Caronte and Cerberus on signaling by GDF-11, myostatin and Activin A.
  • Cell line Human Rhabdomyosarcoma ( derived from muscle).
  • Reporter vector pGL3(CAGA)12 (Described in Dennler et al, 1998, EMBO 17: 3091-3100.) See Figure 5.
  • the CAGA12 motif is present in TGF-Beta responsive genes ( PAI-1 gene) , so this vector is of general use for factors signaling through Smad2 and 3.
  • Day 1 Split A-204 cells into 48-well plate.
  • Day 2 A-204 cells transfected with 10 ug pGL3(CAGA)12 or pGL3(CAGA) 12(10 ug)+ pRLCMV (1 ug) and Fugene.
  • Day 3 Add factors (diluted into medium+ 0.1 % BSA). Inhibitors need to be preincubated with Factors for 1 hr before adding to cells. 6 hrs later, cells rinsed with PBS, and lyse cells. This is followed by a Luciferase assay. In the absence of any inhibitors, Activin A showed 10 fold stimulation of reporter gene expression and an ED50 ⁇ 2 ng/ml. GDF-8: ED50: ⁇ 5 ng/ml, 15 fold stimulation.
  • GDF-11 16 fold stimulation
  • ED50 ⁇ 1.5 ng/ml.
  • Caronte inhibits GDF-11 signaling in the A-204 Reporter Gene Assay.
  • An ActRIIA-Fc ("IIA muG2a") fusion also inhibits GDF-11 signaling.
  • Caronte does not inhibit Activin A in the A-204 Reporter Gene Assay.
  • An ActRIIA-Fc fusion ("IIA muG2a"), as expected, does inhibit Activin A signaling.
  • Caronte is a selective inhibitor of GDF-11/myostatin while not affecting Activin A signaling. This type of selectivity suggests that Caronte, Cerberus and Coco will have relatively few side effects when used as a therapeutic. As expected, Cerberus behaved much like Caronte, and inhibited myostatin signaling. See Figure 8.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Engineering & Computer Science (AREA)
  • Animal Behavior & Ethology (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • General Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Organic Chemistry (AREA)
  • Neurology (AREA)
  • Neurosurgery (AREA)
  • Biomedical Technology (AREA)
  • Physical Education & Sports Medicine (AREA)
  • Diabetes (AREA)
  • Orthopedic Medicine & Surgery (AREA)
  • Immunology (AREA)
  • Epidemiology (AREA)
  • Zoology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Obesity (AREA)
  • Hematology (AREA)
  • Cardiology (AREA)
  • Psychology (AREA)
  • Rheumatology (AREA)
  • Pain & Pain Management (AREA)
  • Heart & Thoracic Surgery (AREA)
  • Endocrinology (AREA)
  • Hospice & Palliative Care (AREA)
  • Psychiatry (AREA)
  • Emergency Medicine (AREA)
  • Urology & Nephrology (AREA)
  • Child & Adolescent Psychology (AREA)
  • Vascular Medicine (AREA)
PCT/US2005/018928 2004-05-27 2005-05-27 Cerberus/coco derivatives and uses thereof Ceased WO2005115439A2 (en)

Priority Applications (9)

Application Number Priority Date Filing Date Title
AU2005247508A AU2005247508A1 (en) 2004-05-27 2005-05-27 Cerberus/coco derivatives and uses thereof
CA002567810A CA2567810A1 (en) 2004-05-27 2005-05-27 Cerberus/coco derivatives and uses thereof
EP05780089A EP1755648A2 (en) 2004-05-27 2005-05-27 Cerberus/coco derivatives and uses thereof
US11/597,182 US20100183695A1 (en) 2004-05-27 2005-05-27 Cerberus/coco derivatives and uses thereof
JP2007515450A JP2008500373A (ja) 2004-05-27 2005-05-27 ケルベロス(Cerberus)/ココ(Coco)誘導体およびそれらの使用
IL179602A IL179602A0 (en) 2004-05-27 2006-11-27 Cerberus/coco derivatives and uses thereof
US13/533,733 US20130029908A1 (en) 2004-05-27 2012-06-26 Cerberus/coco derivatives and uses thereof
US13/774,585 US9045553B2 (en) 2004-05-27 2013-02-22 Cerberus/Coco derivatives and uses thereof
US14/727,819 US20160115209A1 (en) 2004-05-27 2015-06-01 Cerberus/coco derivatives and uses thereof

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US57506204P 2004-05-27 2004-05-27
US60/575,062 2004-05-27

Related Child Applications (3)

Application Number Title Priority Date Filing Date
US10/597,182 A-371-Of-International US20080232216A1 (en) 2004-01-20 2005-01-10 Focus Control Scheme with Jumping Focal Point
US11/597,182 A-371-Of-International US20100183695A1 (en) 2004-05-27 2005-05-27 Cerberus/coco derivatives and uses thereof
US13/533,733 Continuation US20130029908A1 (en) 2004-05-27 2012-06-26 Cerberus/coco derivatives and uses thereof

Publications (3)

Publication Number Publication Date
WO2005115439A2 true WO2005115439A2 (en) 2005-12-08
WO2005115439A9 WO2005115439A9 (en) 2006-02-02
WO2005115439A3 WO2005115439A3 (en) 2007-09-13

Family

ID=35451405

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2005/018928 Ceased WO2005115439A2 (en) 2004-05-27 2005-05-27 Cerberus/coco derivatives and uses thereof

Country Status (8)

Country Link
US (4) US7316998B2 (https=)
EP (1) EP1755648A2 (https=)
JP (1) JP2008500373A (https=)
KR (1) KR20070026650A (https=)
AU (1) AU2005247508A1 (https=)
CA (1) CA2567810A1 (https=)
IL (1) IL179602A0 (https=)
WO (1) WO2005115439A2 (https=)

Cited By (20)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2007123402A3 (en) * 2006-04-20 2008-01-31 Academisch Ziekenhuis Leiden Therapeutic intervention in a genetic disease in an individual by modifying expression of an aberrantly or abnormally expressed gene
WO2008073351A3 (en) * 2006-12-08 2008-11-27 Acceleron Pharma Inc Uses of cerberus, coco and derivatives thereof
WO2010148010A1 (en) * 2009-06-15 2010-12-23 4S3 Bioscience Inc. Methods and compositions for treatment of myotubular myopathy using chimeric polypeptides comprising myotubularih 1 (mtm1) polypeptides
WO2011056896A1 (en) 2009-11-03 2011-05-12 Acceleron Pharma Inc. Methods for treating fatty liver disease
WO2012065852A3 (de) * 2010-11-18 2012-10-11 Eberhard-Karls-Universitaet Tuebingen Universitaetsklinikum Therapeutisches gremlin protein
WO2016008966A1 (en) * 2014-07-17 2016-01-21 INSERM (Institut National de la Santé et de la Recherche Médicale) Methods for treating neuromuscular junction-related diseases
US9243245B2 (en) 2007-10-26 2016-01-26 Academisch Ziekenhuis Leiden Means and methods for counteracting muscle disorders
WO2017177013A1 (en) * 2016-04-06 2017-10-12 Acceleron Pharma Inc. Alk7 antagonists and uses thereof
US9890379B2 (en) 2006-08-11 2018-02-13 Biomarin Technologies B.V. Treatment of genetic disorders associated with DNA repeat instability
EP3345921A1 (en) 2009-06-08 2018-07-11 Acceleron Pharma Inc. Use of anti-actriib antibodies for increasing thermogenic adipocytes
US10179912B2 (en) 2012-01-27 2019-01-15 Biomarin Technologies B.V. RNA modulating oligonucleotides with improved characteristics for the treatment of duchenne and becker muscular dystrophy
US10246707B2 (en) 2008-05-14 2019-04-02 Biomarin Technologies B.V. Method for efficient exon (44) skipping in duchenne muscular dystrophy and associated means
US10533171B2 (en) 2009-04-24 2020-01-14 Biomarin Technologies B.V. Oligonucleotide comprising an inosine for treating DMD
US10882904B2 (en) 2016-01-08 2021-01-05 Scholar Rock, Inc. Methods for inhibiting myostatin activation by administering anti-pro/latent myostatin antibodies
USRE48468E1 (en) 2007-10-26 2021-03-16 Biomarin Technologies B.V. Means and methods for counteracting muscle disorders
US10946036B2 (en) 2016-06-13 2021-03-16 Scholar Rock, Inc. Use of myostatin inhibitors and combination therapies
US11135291B2 (en) 2014-11-06 2021-10-05 Scholar Rock, Inc. Methods for making and using anti-myostatin antibodies
US11155611B2 (en) 2017-01-06 2021-10-26 Scholar Rock, Inc. Compositions and methods for making and using anti-myostatin antibodies
US11439704B2 (en) 2015-09-15 2022-09-13 Scholar Rock, Inc. Methods for using anti-myostatin antibodies
US12338279B2 (en) 2022-12-22 2025-06-24 Scholar Rock, Inc. Selective and potent inhibitory antibodies of myostatin activation

Families Citing this family (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US9045553B2 (en) * 2004-05-27 2015-06-02 Acceleron Pharma, Inc. Cerberus/Coco derivatives and uses thereof
EA018221B1 (ru) * 2007-02-09 2013-06-28 Акселерон Фарма Инк. АНТАГОНИСТЫ АКТИВИНА-ActRIIa И ПРИМЕНЕНИЕ ДЛЯ СТИМУЛЯЦИИ РОСТА КОСТИ У БОЛЬНЫХ РАКОМ
WO2008106478A1 (en) * 2007-02-27 2008-09-04 Lanx, Llc Compositions and methods for modification of target cells and to their uses thereof
US20100150881A1 (en) * 2007-06-01 2010-06-17 Lanx, Inc. Compositions and Methods for Use of Scar Tissue in Repair of Weight Bearing Surfaces
WO2009105606A1 (en) * 2008-02-21 2009-08-27 Lanx, Llc Compositions and methods for use of scar tissue in repair of weight bearing surfaces
US9149319B2 (en) * 2008-09-23 2015-10-06 Lanx, Llc Methods and compositions for stabilization of a vertebra
RS61778B1 (sr) 2013-05-06 2021-06-30 Scholar Rock Inc Kompozicije i postupci za modulaciju faktora rasta
CN109758616B (zh) * 2019-03-05 2021-11-19 中国医学科学院北京协和医院 一种新型促进骨再生材料及其制备方法

Family Cites Families (26)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6133232A (en) * 1996-06-20 2000-10-17 The Regents Of The University Of California Endoderm, cardiac and neural inducing factors
WO1998034951A1 (en) 1997-02-11 1998-08-13 Amrad Operations Pty. Ltd. A new cytokine family and uses thereof
US6610510B1 (en) * 1997-04-29 2003-08-26 Regeneron Pharmaceuticals, Inc. Morphogenic proteins
US5935852A (en) 1997-07-03 1999-08-10 Genetics Institute, Inc. DNA molecules encoding mammalian cerberus-like proteins
US6656475B1 (en) 1997-08-01 2003-12-02 The Johns Hopkins University School Of Medicine Growth differentiation factor receptors, agonists and antagonists thereof, and methods of using same
CA2319703C (en) 1998-02-05 2005-09-20 The Johns Hopkins University School Of Medicine Growth differentiation factor-8
US20040009535A1 (en) 1998-11-27 2004-01-15 Celltech R&D, Inc. Compositions and methods for increasing bone mineralization
WO2000055193A2 (en) 1999-03-12 2000-09-21 Regeneron Pharmaceuticals, Inc. Human dan/cerberus related protein 6 (dcr6)
AU2002227172A1 (en) 2000-10-19 2002-04-29 Genaissance Pharmaceuticals, Inc. Haplotypes of the cer1 gene
WO2002054940A2 (en) 2001-01-12 2002-07-18 University Of Medicine & Dentistry Of New Jersey Bone morphogenetic protein-2 in the treatment and diagnosis of cancer
EP1383867A2 (en) 2001-03-23 2004-01-28 Axordia Limited Stem cell differentiation
WO2002078516A2 (en) 2001-03-30 2002-10-10 Corixa Corporation Compositions and methods for the therapy and diagnosis of cancer
GB0111004D0 (en) 2001-05-04 2001-06-27 Univ Sheffield Screening method
US6513196B2 (en) 2001-06-22 2003-02-04 Maytag Corporation Top cover hinge and method for using same
CN1161875C (zh) 2001-07-01 2004-08-11 周符明 开关稳功率电源
GB0118223D0 (en) 2001-07-26 2001-09-19 Univ Sheffield Stem loop RNA
KR100996226B1 (ko) 2001-10-31 2010-11-24 유니버시티 오브 노스 텍사스 헬스 사이언스 센터 뼈 형태발생 단백질(bmp), bmp 수용체 및 bmp결합 단백질 및 녹내장 진단 및 치료에서 그의 용도
GB0130738D0 (en) 2001-12-21 2002-02-06 Serono Internat S A Protein
US20030134790A1 (en) 2002-01-11 2003-07-17 University Of Medicine And Dentistry Of New Jersey Bone Morphogenetic Protein-2 And Bone Morphogenetic Protein-4 In The Treatment And Diagnosis Of Cancer
BR0307871A (pt) * 2002-02-21 2005-04-12 Wyeth Corp Proteìnas contendo domìnio de folistatina
US7193069B2 (en) 2002-03-22 2007-03-20 Research Association For Biotechnology Full-length cDNA
US20030194704A1 (en) 2002-04-03 2003-10-16 Penn Sharron Gaynor Human genome-derived single exon nucleic acid probes useful for gene expression analysis two
KR20080045764A (ko) 2002-06-14 2008-05-23 신젠타 파티서페이션즈 아게 자일라나제, 이를 암호화하는 핵산, 및 이의 제조 및 사용방법
US20040023356A1 (en) 2002-06-14 2004-02-05 Robb Krumlauf Wise/Sost nucleic acid sequences and amino acid sequences
BR0317538A (pt) * 2002-12-20 2005-11-29 Amgen Inc Agente ligante, sequência de polinucleotìdeo, vetor de expressão, célula hospedeira, composição farmacêutica, e, métodos de inibir a atividade de miostatina, de aumentar a massa muscular magra e a razão de massa muscular magra para gordura, de tratar uma doença de emaciação muscular e um distúrbio metabólico relacionado com miostatina em um indivìduo, de detectar e medir miostatina em uma amostra, e, de diagnosticar um distúrbio relacionado com miostatina em um indivìduo
WO2004074460A2 (en) 2003-02-19 2004-09-02 The Rockefeller University Nucleotide and protein sequences of coc genes and methods based thereon

Cited By (44)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JP2009534378A (ja) * 2006-04-20 2009-09-24 アカデミッシュ ジーケンフイス ライデン 常態ではなく発現された遺伝子又は異常に発現された遺伝子の発現を修正することによる、個体の遺伝病における治療的介入
WO2007123402A3 (en) * 2006-04-20 2008-01-31 Academisch Ziekenhuis Leiden Therapeutic intervention in a genetic disease in an individual by modifying expression of an aberrantly or abnormally expressed gene
US8304398B2 (en) 2006-04-20 2012-11-06 Academisch Ziekenhuis Leiden Therapeutic intervention in a genetic disease in an individual by modifying expression of an aberrantly or abnormally expressed gene
US10689646B2 (en) 2006-08-11 2020-06-23 Biomarin Technologies B.V. Treatment of genetic disorders associated with DNA repeat instability
US11274299B2 (en) 2006-08-11 2022-03-15 Vico Therapeutics B.V. Methods and means for treating DNA repeat instability associated genetic disorders
US9890379B2 (en) 2006-08-11 2018-02-13 Biomarin Technologies B.V. Treatment of genetic disorders associated with DNA repeat instability
WO2008073351A3 (en) * 2006-12-08 2008-11-27 Acceleron Pharma Inc Uses of cerberus, coco and derivatives thereof
US7833971B2 (en) 2006-12-08 2010-11-16 Acceleron Pharma Inc. Uses of cerberus, coco and derivatives thereof
US8796199B2 (en) 2006-12-08 2014-08-05 Acceleron Pharma, Inc. Uses of Cerberus and derivatives thereof
US10876114B2 (en) 2007-10-26 2020-12-29 Biomarin Technologies B.V. Methods and means for efficient skipping of at least one of the following exons of the human Duchenne muscular dystrophy gene: 43, 46, 50-53
US11427820B2 (en) 2007-10-26 2022-08-30 Biomarin Technologies B.V. Methods and means for efficient skipping of exon 45 in Duchenne muscular dystrophy pre-mRNA
USRE48468E1 (en) 2007-10-26 2021-03-16 Biomarin Technologies B.V. Means and methods for counteracting muscle disorders
US9243245B2 (en) 2007-10-26 2016-01-26 Academisch Ziekenhuis Leiden Means and methods for counteracting muscle disorders
US9926557B2 (en) 2007-10-26 2018-03-27 Biomarin Technologies B.V. Methods and means for efficient skipping of exon 45 in Duchenne muscular dystrophy pre-mRNA
US10246707B2 (en) 2008-05-14 2019-04-02 Biomarin Technologies B.V. Method for efficient exon (44) skipping in duchenne muscular dystrophy and associated means
US11634714B2 (en) 2009-04-24 2023-04-25 Biomarin Technologies B.V. Oligonucleotide comprising an inosine for treating DMD
US11034956B2 (en) 2009-04-24 2021-06-15 Biomarin Technologies B.V. Oligonucleotide comprising an inosine for treating DMD
US10533171B2 (en) 2009-04-24 2020-01-14 Biomarin Technologies B.V. Oligonucleotide comprising an inosine for treating DMD
EP3345921A1 (en) 2009-06-08 2018-07-11 Acceleron Pharma Inc. Use of anti-actriib antibodies for increasing thermogenic adipocytes
EP3845239A1 (en) 2009-06-08 2021-07-07 Acceleron Pharma Inc. Use of anti-actriib proteins for increasing thermogenic adipocytes
WO2010148010A1 (en) * 2009-06-15 2010-12-23 4S3 Bioscience Inc. Methods and compositions for treatment of myotubular myopathy using chimeric polypeptides comprising myotubularih 1 (mtm1) polypeptides
US9447394B2 (en) 2009-06-15 2016-09-20 Valerion Therapeutics, Llc Methods and compositions for treatment of myotubular myopathy using chimeric polypeptides comprising myotubularin 1(MTM1) polypeptides
AU2010260145B2 (en) * 2009-06-15 2015-08-20 Valerion Therapeutics, Llc Methods and compositions for treatment of Myotubular Myopathy using chimeric polypeptides comprising myotubularin 1 (MTM1) polypeptides
US8834866B2 (en) 2009-06-15 2014-09-16 Valerion Therapeutics, Llc Methods and compositions for treatment of myotubular myopathy using chimeric polypeptides comprising myotubularin 1(MTM1) polypeptides
WO2011056896A1 (en) 2009-11-03 2011-05-12 Acceleron Pharma Inc. Methods for treating fatty liver disease
EP3260130A2 (en) 2009-11-03 2017-12-27 Acceleron Pharma Inc. Methods for treating fatty liver disease
EP3818988A1 (en) 2009-11-03 2021-05-12 Acceleron Pharma Inc. Methods for treating fatty liver disease
WO2012065852A3 (de) * 2010-11-18 2012-10-11 Eberhard-Karls-Universitaet Tuebingen Universitaetsklinikum Therapeutisches gremlin protein
US10913946B2 (en) 2012-01-27 2021-02-09 Biomarin Technologies B.V. RNA modulating oligonucleotides with improved characteristics for the treatment of Duchenne and Becker muscular dystrophy
US10179912B2 (en) 2012-01-27 2019-01-15 Biomarin Technologies B.V. RNA modulating oligonucleotides with improved characteristics for the treatment of duchenne and becker muscular dystrophy
WO2016008966A1 (en) * 2014-07-17 2016-01-21 INSERM (Institut National de la Santé et de la Recherche Médicale) Methods for treating neuromuscular junction-related diseases
EP3741375A1 (en) * 2014-07-17 2020-11-25 INSERM (Institut National de la Santé et de la Recherche Médicale) Methods for treating neuromuscular junction-related diseases
US11135291B2 (en) 2014-11-06 2021-10-05 Scholar Rock, Inc. Methods for making and using anti-myostatin antibodies
US11925683B2 (en) 2014-11-06 2024-03-12 Scholar Rock, Inc. Compositions for making and using anti-Myostatin antibodies
US12582712B2 (en) 2015-09-15 2026-03-24 Scholar Rock, Inc. Method of making anti-pro/latent myostatin antibodies
US11439704B2 (en) 2015-09-15 2022-09-13 Scholar Rock, Inc. Methods for using anti-myostatin antibodies
US12006359B2 (en) 2016-01-08 2024-06-11 Scholar Rock, Inc. Methods for altering body composition by administering anti-pro/latent myostatin antibodies
US10882904B2 (en) 2016-01-08 2021-01-05 Scholar Rock, Inc. Methods for inhibiting myostatin activation by administering anti-pro/latent myostatin antibodies
WO2017177013A1 (en) * 2016-04-06 2017-10-12 Acceleron Pharma Inc. Alk7 antagonists and uses thereof
US12024563B2 (en) 2016-04-06 2024-07-02 Acceleron Pharma Inc. ALK7 antagonists and uses thereof
AU2020210134B2 (en) * 2016-06-13 2021-11-04 Scholar Rock, Inc. Use of myostatin inhibitors and combination therapies
US10946036B2 (en) 2016-06-13 2021-03-16 Scholar Rock, Inc. Use of myostatin inhibitors and combination therapies
US11155611B2 (en) 2017-01-06 2021-10-26 Scholar Rock, Inc. Compositions and methods for making and using anti-myostatin antibodies
US12338279B2 (en) 2022-12-22 2025-06-24 Scholar Rock, Inc. Selective and potent inhibitory antibodies of myostatin activation

Also Published As

Publication number Publication date
KR20070026650A (ko) 2007-03-08
US20090192080A1 (en) 2009-07-30
IL179602A0 (en) 2007-05-15
CA2567810A1 (en) 2005-12-08
US20130029908A1 (en) 2013-01-31
US20060025340A1 (en) 2006-02-02
US7981857B2 (en) 2011-07-19
EP1755648A2 (en) 2007-02-28
WO2005115439A9 (en) 2006-02-02
AU2005247508A1 (en) 2005-12-08
US20100183695A1 (en) 2010-07-22
WO2005115439A3 (en) 2007-09-13
US7316998B2 (en) 2008-01-08
JP2008500373A (ja) 2008-01-10

Similar Documents

Publication Publication Date Title
US7981857B2 (en) Cerberus/coco derivatives and uses thereof
US8796199B2 (en) Uses of Cerberus and derivatives thereof
US8637450B2 (en) Methods of promoting fat loss comprising administering an ALK7 inhibitor
Glaser et al. In vivo somatic cell gene transfer of an engineered Noggin mutein prevents BMP4-induced heterotopic ossification
US9045553B2 (en) Cerberus/Coco derivatives and uses thereof
US7612040B2 (en) Lefty polypeptides and derivatives thereof

Legal Events

Date Code Title Description
AK Designated states

Kind code of ref document: A2

Designated state(s): AE AG AL AM AT AU AZ BA BB BG BR BW BY BZ CA CH CN CO CR CU CZ DE DK DM DZ EC EE EG ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KM KP KR KZ LC LK LR LS LT LU LV MA MD MG MK MN MW MX MZ NA NG NI NO NZ OM PG PH PL PT RO RU SC SD SE SG SK SL SM SY TJ TM TN TR TT TZ UA UG US UZ VC VN YU ZA ZM ZW

AL Designated countries for regional patents

Kind code of ref document: A2

Designated state(s): BW GH GM KE LS MW MZ NA SD SL SZ TZ UG ZM ZW AM AZ BY KG KZ MD RU TJ TM AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HU IE IS IT LT LU MC NL PL PT RO SE SI SK TR BF BJ CF CG CI CM GA GN GQ GW ML MR NE SN TD TG

121 Ep: the epo has been informed by wipo that ep was designated in this application
COP Corrected version of pamphlet

Free format text: PAGES 1/8-8/8, DRAWINGS, REPLACED BY NEW PAGES 1/10-10/10; DUE TO LATE TRANSMITTAL BY THE RECEIVINGOFFICE

WWE Wipo information: entry into national phase

Ref document number: 2007515450

Country of ref document: JP

WWE Wipo information: entry into national phase

Ref document number: 2567810

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 2005247508

Country of ref document: AU

Ref document number: 179602

Country of ref document: IL

NENP Non-entry into the national phase

Ref country code: DE

WWW Wipo information: withdrawn in national office

Country of ref document: DE

WWE Wipo information: entry into national phase

Ref document number: 2005780089

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 2005247508

Country of ref document: AU

Date of ref document: 20050527

Kind code of ref document: A

WWP Wipo information: published in national office

Ref document number: 2005247508

Country of ref document: AU

WWE Wipo information: entry into national phase

Ref document number: 1020067027257

Country of ref document: KR

WWP Wipo information: published in national office

Ref document number: 2005780089

Country of ref document: EP

WWP Wipo information: published in national office

Ref document number: 1020067027257

Country of ref document: KR

WWE Wipo information: entry into national phase

Ref document number: 11597182

Country of ref document: US