WO2004014952A2 - Anticorps specifiques du probnp (1-108) pour le diagnostic de l'insuffisance cardiaque - Google Patents
Anticorps specifiques du probnp (1-108) pour le diagnostic de l'insuffisance cardiaque Download PDFInfo
- Publication number
- WO2004014952A2 WO2004014952A2 PCT/FR2003/002483 FR0302483W WO2004014952A2 WO 2004014952 A2 WO2004014952 A2 WO 2004014952A2 FR 0302483 W FR0302483 W FR 0302483W WO 2004014952 A2 WO2004014952 A2 WO 2004014952A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- probnp
- sequence
- peptide
- bnp
- seq
- Prior art date
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/26—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against hormones ; against hormone releasing or inhibiting factors
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/575—Hormones
- C07K14/58—Atrial natriuretic factor complex; Atriopeptin; Atrial natriuretic peptide [ANP]; Cardionatrin; Cardiodilatin
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/34—Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
Definitions
- the invention relates to the field of in vitro diagnosis of ventricular heart failure.
- Congestive heart failure is a common clinical syndrome, especially in the elderly. It usually comes in the form of an insidious triggering of non-specific symptoms such as exercise cough, fatigue, and the appearance of peripheral edema.
- the diagnosis is conventionally based on the study of various parameters such as clinical signs (classified into 4 stages: stages I to IV of the NYHA (that is to say of the Cardiology Association of New York), the echocardiography, scintigraphy, stress test, etc.
- cardiomyocytes manufacture and secrete peptides with natriuretic activity: a peptide of atrial origin, ANP (Atrial Natriuretic Peptide) discovered in rats by de Bold et al. Life Science 1981, vol. 28 (1): 89-94, and a natriuretic peptide of atrioventricular origin called BNP (Brain Natriuretic Peptide) discovered by Sudoh et al., Nature 1988, vol. 332: 78-81 in pigs, then in humans.
- ANP Atrial Natriuretic Peptide
- BNP Brain Natriuretic Peptide
- BNP preproBNP (1-134), a form of storage of the molecule inside cardiomyocytes. This is cleaved to release a signal peptide and proBNP (1-108).
- ProBNP (1-108) consists of a 108 amino acid polypeptide, sequence: H ⁇ LGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGV WKSREVATEGIRGHRKMVLYTLRAPR 76 S 77 PKMVQGSGCFGRKMDRISSSSG LGCKVLRRH 108 (SEQ ID NO.1).
- BNP also designated BNP (77-108) or BNP-32, even BNP (1-32 ), and the N-terminal part of the prohormone, BNP (1-76), also known as the N-terminal fragment of proBNP or NT-proBNP.
- BNP or BNP the vasoreactive form of the molecule, consists of a peptide of 32 amino acids, of sequence: S 77 PKMVQGSGCFGRKMDRISSSSGLGCKVLRRH 108 (SEQ ID No. 2).
- NT-proBNP or BNP (1-76) consists of the 76 N-terminal amino acids of proBNP (1-108) constituting the following sequence:
- the half-life of BNP is very short and its plasma concentration is low. As a result, a number of false negative responses are seen in subjects at risk for heart failure.
- the BNP assay (77-108) does not allow to correctly discriminate patients in stage I of the NYHA classification, healthy subjects (Clerico A. et al. J. Endocrinol. Invest. 1998; 21: 170-9 ) (Del Ry S. et al. Scand. J. Clin. Lab. Invest. 2000; 60: 81-90).
- patent application WO 93/24531 describes a method of in vitro diagnosis of heart failure based on the detection of BNP (1-76) (N-terminal fragment of proBNP), an abundant compound which has a long half-life compared to that of the hormone BNP (77-108).
- BNP (1-76) N-terminal fragment of proBNP
- the method described in application WO 93/24531 does not seem simple to implement on BNP (1-76) in blood samples. Indeed, the only examples shown are made, not on real sera, but on standard ranges obtained using a synthetic peptide, the BNP peptide (47-64), BNP sub-sequence (1-76 ).
- a highly sophisticated automated system has since proven necessary.
- proBNP (1-108) does not appear to be recognized. Rather, it suggests that proBNP (1-108) could be secreted into the circulation from cardiac tissue but would then be rapidly degraded to a smaller peptide by cleavage of N-terminal acids. Or, according to the article, proBNP (1-108) would be presented in such a way that the anti proBNP (1-108) antiserum would be unable to bind to it. Finally, the authors suggest that BNP (1-76) (N-terminal fragment of proBNP) could even be a more specific marker of cardiac dysfunction than BNP (77-108) or than the N-terminal fragment of proANP.
- proBNP (1-108) When studying the various circulating forms of proBNP (1-108), they hypothesized that proBNP (1-108) would circulate in the blood, both as an intact prohormone and as cleavage products, BNP (1-76) (N-terminal fragment of proBNP) and BNP (77-108). However, nothing is said or suggested in the article concerning a possible physiological activity of proBNP (1-108) or any diagnostic interest of proBNP (1-108) as a predictive or diagnostic marker of ventricular heart failure.
- BNP-32 degradation product that has lost the N-terminal serine and praline (this is des-SerPro-BNP (BNP3-32)) of the hormonal form of BNP-32 (here called BNP (1-32)).
- BNP (1-32) the hormonal form of BNP-32
- ProBNP (1-108) and hormonal BNP are therefore secreted by the heart into the blood.
- proBNP (1-108) in its oligomerized form (trimer) is present in a concentration close to that of circulating BNP (77-108), but they do not measure it. Consequently, the correlation of the concentration of proBNP (1-108) with the clinical condition of the patients is not studied. It follows that the diagnostic or prognostic benefit of serum proBNP (1-108) has not been demonstrated. It is also not suggested that it is possible to dose it routinely.
- proBNP a number of epitopes present on proBNP (1-108) are known.
- the epitope with sequence S 77 PKMVQGSGC 86 SEQ ID No. 105
- the epitope with sequence R 65 KMVLYTLRAPR 76 SEQ ID No.
- the authors of the present invention therefore set out to develop an alternative method for solving the problem posed.
- At the heart of the present invention is the unexpected discovery, made by the inventors, of an epitope with unique properties located in the domain of the hinge sequence Y 70 TLRAPR 76 S 77 PKMVQGSG 85 (SEQ ID No. 4) or of the sequence Y 70 TLRAPR 76 S 77 PKMVQGS 84 (SEQ ID No. 108) of proBNP (1-108) and comprising at least the sequence RAPR 76 S 77 P (SEQ ID No. 5).
- the authors of the present invention have demonstrated that the minimum epitope recognized by the antibodies according to the invention has the following sequence: RAPR 76 S 77 P. They have further shown that a good way of obtaining the antibodies object of the present invention is to immunize animals with a peptide of general formula: a 1 - X 1 - RAPRSP - X 2 - a 2 (I) where
- a 1 can be H or represent a chemical function or group chosen from a thiol, alcohol, aminoxy, primary or secondary amine function, an amino-carboxyl group, a biotinyl group and an acetyl group,
- X 1 represents a peptide sequence of 0 with 3 amino acids, whether from the natural sequence of proBNP (1-108) or not,
- X 2 represents a peptide sequence of 0 to 8 amino acids, preferably 7 amino acids, derived from the natural sequence of proBNP (1-108) or not, a 2 can represent an OH, NH 2 function or an alkoxyl group.
- the authors of the present invention have shown that it is possible to obtain the same specific antibodies by immunization of an animal with a peptide of formula:
- X-Y70TLRAPR76S77PKMVQGS84- Z (III) where X can be H or represent either an acetyl group or 1 to 3 amino acids not belonging to the proBNP (1-108) sequence, and where Z can represent an OH function, or 1 to 3 amino acids not belonging to the proBNP sequence (1-108).
- the authors of the present invention have also developed a simple and reliable method for the early diagnosis of heart failure based on the detection of proBNP (1-108) circulating in the blood and a kit allowing the implementation of this procedure. detection of circulating proBNP (1-108).
- the present invention therefore relates to an anti proBNP antibody (1-
- proBNP (1-108) characterized in that, on the one hand, it specifically recognizes the sequence Y 70 TLRAPR 76 S 77 PKMVQGSG 85 of proBNP (1-108) and does not substantially recognize BNP (1-76) nor BNP ( 77-108), and, on the other hand, has the ability to specifically recognize proBNP (1-108) circulating in human serum or plasma samples.
- the present invention further relates to an anti proBNP antibody (1- 108) characterized in that, on the one hand, it specifically recognizes the sequence Y 70 TLRAPR 76 S 77 PKMVQGS 84 of proBNP (1-108) and does not substantially recognize BNP (1-76) or BNP (77-108), and on the other hand, has the ability to specifically recognize proBNP (1-108) circulating in human serum or plasma samples.
- the present invention more particularly relates to an anti proBNP antibody (1-108) characterized in that, on the one hand, it specifically recognizes the RAPR 76 S 77 P sequence of proBNP (1-108) and does not substantially recognize not BNP (1-76) nor BNP (77-108), and, on the other hand, ability to specifically recognize proBNP (1-108) circulating in human serum or plasma samples.
- the present invention further relates to a process for obtaining anti proBNP (1-108) antibodies specifically recognizing the sequence Y 7 oTLRAPR 76 S 77 PKMVQGSG 85, the sequence Y 7 oTLRAPR 76 S 77 PKMVQGS 84 and / or the RAPR 76 S 77 P sequence of proBNP (1-108) with the substantial exclusion of BNP (1-76) and BNP (77-108), and having the capacity to specifically recognize proBNP (1-108) circulating in human serum or plasma samples characterized in that an animal is immunized with the whole molecule of proBNP (1-108), then in that it is exhausted, using the peptide BNP (77-108 ) and / or the BNP peptide (1-76), the antiserum obtained.
- an antiserum obtained against a given specific antigen (the immunizing antigen)
- the immunizing antigen is meant the elimination of non-specific antibodies, potentially present in this antiserum, by contacting and incubating said antiserum with "non-specific antigens", ie antigens different from the immunizing antigen, then separation
- an antiserum recognizing the sequence Y 7 oTLRAPR 76 S77PKMVQGSG85, and / or the sequence
- Y 7 oTLRAPR7 6 S77PKMVQGS 8 or the RAPR 76 S 7 7P sequence of proBNP (1-108) can be exhausted, i.e. made specific, by contacting BNP (77-108) and / or BNP (1-76) above-mentioned, the latter being able, for example, to be immobilized in the solid phase and to serve as a support for chromatography by immunoadsorption according to conventional techniques, known to those skilled in the art.
- the antibody finally present in the exhausted antiserum is here a monospecific polyclonal antibody.
- the present invention also relates to a peptide of formula: a ⁇ - X 1 - RAPRSP - X 2 - a 2 (I)
- OR ai can be H or represent a chemical function or group chosen from a thiol, alcohol, aminoxy, primary or secondary amine function, an amino-carboxyl group, a biotinyl group and an acetyl group,
- Xi represents a peptide sequence of 0 to 3 amino acids, originating from the natural sequence of proBNP (1-108) or not,
- X 2 represents a peptide sequence of 0 to 8 amino acids, preferably 7 amino acids, derived from the natural sequence of proBNP (1-108) or not, a 2 can represent an OH, NH 2 function or an alkoxyl group.
- the present invention also relates to a peptide of formula: XY 7 ⁇ TLRAPR7 6 S 7 7PKMVQGSG85-Z (ll) where X may be H, or represent either an acetyl group, or 1 to 3 amino acids not belonging to the sequence proBNP (1-108), and where Z can represent an OH function, or 1 to 3 amino acids not belonging to the proBNP (1-108) sequence.
- the present invention further relates to a peptide of formula: X-Y7 ⁇ TLRAPR 76 S7 7 PKMVQGS 8 4-Z (III) where X may be H, or represent either an acetyl group, or 1 to 3 amino acids not belonging to the sequence of proBNP (1-108), and where Z can represent an OH function, or 1 to 3 amino acids not belonging to the sequence of proBNP (1-108).
- X may be H, or represent either an acetyl group, or 1 to 3 amino acids not belonging to the sequence of proBNP (1-108), and where Z can represent an OH function, or 1 to 3 amino acids not belonging to the sequence of proBNP (1-108).
- a peptide comprising a sequence derived from the sequence X-Y70TLRAPR76S77PKMVQGSG85-Z (II) or from the sequence XY 7 oTLRAPR 76 S 77 PKMVQGS 84 -Z (III) by substitution of one or more of the amino acids Y70, T 71 , L 72 , K 79 , M 8 o, V 8 ⁇ , Qs2, G 8 3, S 84 and G 8 5, with X possibly being absent or representing either an NH 2 function or 1 to 3 amino acids not belonging to the proBNP sequence (1-108), and where Z may be absent or represent either an OH function, or 1 to 3 amino acids not belonging to the proBNP sequence (1-108 ).
- the invention relates to the peptide of sequence Y70TLRAPR76S77PKMVQGSG85, and the peptide of sequence Y70TLRAPR76S77PKMVQGS84.
- a subject of the invention is also a process for obtaining anti proBNP (1-108) antibodies specifically recognizing the sequence Y70TLRAPR76S77PKMVQGSG85, Y70TLRAPR76S77PKMVQGS84 and / or the RAPR 76 S 77 P sequence of proBNP (1-108).
- the antibody thus obtained is a monospecific antibody.
- the subject of the invention is also a process for obtaining anti proBNP (1-108) antibodies specifically recognizing the sequence Y70TLRAPR76S77PKMVQGSG85, Y70TLRAPR76S77PKMVQGS 84 and / or the RAPR 76 S 77 P sequence of proBNP (1-108).
- substantial exclusion of BNP (1- 76) and BNP (77-108), and having the ability to specifically recognize proBNP (1-108) circulating in serum or plasma samples humans characterized in that an animal is immunized with a peptide of formula:
- the subject of the invention is also a process for obtaining a hybridoma secreting anti proBNP antibodies (1-108) specifically recognizing the sequence Y70TLRAPR76S77PKMVQGSG85 Y7oTLRAPR 7 6S 77 PKIv1VQGS 8 4 and / or the sequence RAPR 76 S 77 P proBNP (1-108) with the substantial exclusion of BNP (1-76) and BNP (77-108), and having the ability to specifically recognize proBNP (1-108) circulating in human serum or plasma samples characterized in that an animal is immunized with a peptide of formula:
- X-Y7 ⁇ TLRAPR7 6 S7 7 PKMVQGSG 8 5- Z (II) or with a peptide of formula XY 7 oTLRAPR 76 S7 7 PKMVQGS 84 -Z (III), in substituted form, conservatively or not, provided that it retains intact (in particular unsubstituted) the RAPR75S77P portion, where X and Z are as defined above and, optionally, in what is exhausted, using the BNP peptide (77-108) and / or the BNP peptide (1-76), the antiserum obtained.
- Another subject of the invention is a process for obtaining anti proBNP antibodies (1-108) which specifically recognize the sequence
- Another subject of the invention is a process for obtaining a hybridoma anti proBNP antibody secretor (1- 08) specifically recognizing the sequence Y 7 oTLRAPR7 6 S77 KMVQGSG 85l the sequence
- an animal is immunized with a peptide chosen from the peptides of the following formulas: ai - Xi - RAPRSP - X 2 - a 2 (I) where ai, Xi, X 2 , and a 2 have the same meaning as above,
- lymphocyte is fused with myeloma cells to obtain at least one immunoglobulin secreting hybridoma.
- the subject of the invention is also such a hybridoma and the monoclonal anti proBNP (1-108) antibody secreted by said hybridoma.
- the present invention further relates to a method of in vitro diagnosis of heart failure in a human comprising bringing a biological sample, preferably blood, plasma or serum, into contact with an anti proBNP antibody (1- 108) specifically recognizing the sequence Y 7 oTLRAPR76S77PKMVQGSG 85 , the sequence
- the invention generally provides a method of in vitro diagnosis of heart failure in a human comprising: a) bringing a biological sample, preferably blood, plasma or serum, into contact with an anti proBNP antibody ( 1-108) specifically recognizing the sequence Y oTLRAPR7 6 S77PKMVQGSG 8 5, the sequence Y 7 oTLRAPR 7 6S77PKMVQGS 8 4 and / or the sequence RAPR 76 S 7 7P of proBNP (1- 108) with the substantial exclusion of BNP (1-76) and BNP (77-108), and having the capacity to specifically recognize proBNP (1-108) circulating in human serum or plasma samples, b) incubation of the mixture under conditions allowing the formation antigen-antibody complexes; and c) revealing the antigen-antibody complexes formed, optionally using a labeled detection antibody capable of specifically binding to proBNP (1-108) present in the first complex, or using '' a labeled detection antigen capable of binding to the directed antibody against said proBNP
- the invention provides a method of diagnosing heart failure which comprises, in addition to steps a, b and c above, a step d) of correlating the amount of antigen-antibody complexes revealed in clinical state from subject.
- the present invention further relates to a kit for the detection of proBNP (1-108) in a biological sample, in particular in a blood, plasma or serum sample, containing at least one anti proBNP antibody (1- 108) so recognizing specific the sequence Y70TLRAPR76S77PKMVQGSG85, the sequence Y7oTLRAPR7 6 S 7 7PKMVQGS 8 4 and / or the RAPR 76 S 77 P sequence of proBNP (1-108) with the substantial exclusion of BNP (1-76) and BNP (77-108 ), and having the ability to specifically recognize proBNP (1-108) circulating in human serum or plasma samples.
- a kit for the detection of proBNP (1-108) in a biological sample in particular in a blood, plasma or serum sample
- at least one anti proBNP antibody (1- 108) so recognizing specific the sequence Y70TLRAPR76S77PKMVQGSG85, the sequence Y7oTLRAPR7 6 S 7 7PKMVQGS 8 4 and / or the RAPR
- the invention relates to a kit for detecting proBNP (1-108) in a biological sample, in particular in a blood, plasma or serum sample, containing, as standard and / or control, a compound containing at least one peptide chosen from the group of peptides of the following formulas:
- a “biological sample” or even a “biological fluid sample” is preferably constituted by a biological fluid, such as blood, plasma, serum, urine, cerebrospinal fluid, saliva, etc.
- heart failure is meant the medical condition in which an abnormality in cardiac function is responsible for the inability of the heart to pump blood sufficiently to meet the metabolic needs of the body and / or in which the heart provides for the needs but with abnormally high filling pressures. It may especially be a right and / or left ventricular failure.
- antibody refers to any whole antibody or functional fragment of an antibody (obtained by genetic engineering or not), comprising, or consisting of, at least one antigenic combination site, allowing said antibody to bind to at least an antigenic determinant of an antigenic compound. Examples of antibody fragments that may be mentioned are the Fab, Fab ', F (ab') 2 fragments and also the variable single-chain fragments (scFv chains).
- the anti proBNP (1-108) antibodies according to the invention can be of polyclonal or monoclonal type.
- a polyclonal anti proBNP antibody (1-108) according to the invention can, inter alia, be obtained by immunization of an animal such as a rabbit, a mouse, etc. using proBNP (1 -108) whole, removal and then exhaustion of the antiserum obtained on, for example, an immunoadsorbent containing BNP (77-108) and / or BNP (1-76) according to methods known per se to those skilled in the art.
- An anti proBNP monoclonal antibody (1-108) according to the invention can, inter alia, be obtained by the conventional method of Kôhler and Milstein (Nature (London), 256: 495-497 (1975)).
- capture antibody an antibody or a part of antibody, preferably fixed on a solid phase, which is capable of retaining the proBNP (1-108) antigen present in a biological sample, by affine binding.
- the presence of the antigen in the biological sample is revealed by "detection means".
- the invention provides in particular for detection using at least one “detection antibody”.
- a detection antibody labeled, is capable of binding to the captured antigen, by affine bonding, by recognizing an epitopic site, different from that recognized by the capture antibody.
- labeled refers both to direct labeling (by means of enzymes, radioisotopes, fluorochromes, luminescent compounds, etc.) and to indirect labeling (for example, by means of antibodies themselves labeled directly or using reagents of a labeled “affinity pair”, such as, but not exclusively, the labeled avidin-biotin pair, etc.).
- antigenic fragment any part of proBNP (1-108) capable of inducing the synthesis of antibodies substantially specific for only proBNP (1-108) in an immunized animal.
- an “antigenic fragment” contains at least the “epitopic site” or epitope RAPR75S77P.
- An “epitopic site” or “epitope” is an amino acid sequence which is recognized by at least one antibody and allows the specific binding thereof.
- the term “monospecific polyclonal antibody” applies to any polyclonal antibody having specificity for a single epitope. This means that the antibody is capable of binding an amino acid sequence of the sequence of proBNP (1-108) containing the amino acids comprising epitope, but is unable to link an amino acid sequence of the proBNP (1-108) sequence that does not contain the amino acids comprising the epitope.
- amino acids with a polar side chain such as asparagine, glutamine, serine, threonine and tyrosine
- amino acids with a non-polar side chain such as glycine, alanine, valine, leucine, isoleucine, phenylalanine, methionine, tryptophan and cysteine
- basic side chain amino acids such as lysine, arginine and histidine
- amino acids with an acid side chain such as aspartic acid and glutamic acid.
- non-conservative substitution is meant any other type of substitution, which does not significantly modify the immunoreactivity of the peptide obtained compared to that of the original peptide.
- the determination of the percentage of the cross-reaction is done according to methods known per se to those skilled in the art, for example, that illustrated in Example 5.
- the "substantial" non-recognition of the BNP (1-76) and BNP (77-108) peptides preferably corresponds to an absence or almost absence of reaction of the antibodies of the invention with these peptides.
- the expression “with the substantial exclusion of BNP (1-76) and BNP (77-108)” means that the antibody “does not substantially recognize BNP (1-76) or BNP (77 -108) ”in the sense seen above.
- the antibodies used in the present invention are antibodies specific for the antigen, and, for this reason, are monoclonal antibodies or monospecific polyclonal antibodies, that is to say that they specifically recognize only one epitope.
- the monoclonal antibodies can be obtained according to the conventional method of lymphocyte fusion and culture of hybridomas described by Kôhler and Milstein, Nature, 1975, 256: 495-497. Other methods for preparing monoclonal antibodies are also known (Harlow et al, ed., 1988 "Antibodies: a laboratory manual”).
- Monoclonal antibodies can be prepared by immunizing a mammal (for example a mouse, a rat, a rabbit, or even a human being, etc.) and using the lymphocyte fusion technique leading to hybridomas (Kôhler and Milstein, 1975) .
- Monoclonal antibodies can, for example, be produced by expression of a cloned nucleic acid from a hybridoma.
- Antibodies can also be produced by the phage display technique, by introducing antibody cDNAs into vectors, which are typically filamentous phages which have V gene libraries on the surface of the phage (e.g. fUSE5 for E. coli, Scott, JK and Smith, GP, Science, 1990, 249: 386-390). Protocols for the construction of these antibody libraries are described in Marks et al, 1991, J. Mol. Biol, 222 -.581-597).
- Polyclonal antibodies can be obtained from the serum of an animal immunized against an antigen of peptide nature according to the usual procedures.
- the polyclonal antibodies thus obtained may, if necessary, and by exhaustion with BNP (77-108) and BNP1-76, according to techniques known to those skilled in the art such as, for example, column immunoadsorption , be made monospecific of the sequence Y 7 oTLRAPR 7 6S 77 PKMVQGSG 8 5, of the sequence Y7oTLRAPR 7 6S 7 7PKMVQGS 84 and / or a peptide comprising the sequence RAPR76S77P, thus ensuring the specificity with respect to proBNP (1-108), with the substantial exclusion of BNP (1-76) and BNP (77-108).
- the capture antibody is chosen so that it specifically recognizes an epitope, on the patient's natural antigen, while the detection antibody is chosen, preferably, but not necessarily so as to what he specifically recognizes is another epitope, on the patient's natural antigen.
- the biological sample can optionally be treated in a preliminary step, or placed directly in the presence of at least one capture antibody under conditions favoring exposure of the epitope to be detected.
- the diagnostic method according to the invention can be carried out according to various formats well known to those skilled in the art: in solid phase or in homogeneous phase; in one or two steps; in the sandwich method or in the competitive method, by way of nonlimiting examples.
- the capture antibody is immobilized on a solid phase.
- Microplates in particular polystyrene microplates, such as those sold by the company Nunc, Denmark, may be used, by way of nonlimiting examples of solid phase. It is also possible to use particles or solid beads, paramagnetic beads, such as those supplied by Dynal or Merck-Eurolab (France) (under the brand name EstaporT) ⁇ 0 u or test tubes made of polystyrene or polypropylene, etc.
- a sandwich type immunoassay format between two antibodies is particularly advantageous for the detection of antigens present in the biological sample.
- Kits Kits and reagents useful for the detection of proBNP (1-108) in a biological fluid sample in accordance with the method of the invention, can be provided for easy practice of the invention and applicable to many samples organic.
- ProBNP detection kits (1-108) in a biological sample can contain at least one antibody as defined above.
- Other kits, containing as standard and / or control, at least one peptide of formula (I), (II) or a substituted peptide as defined above, can also be useful for the implementation of the invention.
- kits for detecting proBNP (1-108) in a sample of biological fluid comprising:
- At least one anti proBNP antibody (1-108) specifically recognizing the sequence Y70TLRAPR7 6 S 7 7PKMVQGSG 85 , the sequence Y7oTLRAPR 76 S77PKMVQGS 8 4 and / or the RAPR 76 S 7 7P sequence of proBNP (1- 108) to substantial exclusion of BNP (1-76) and BNP (77-108), and having the ability to specifically recognize proBNP (1-108) circulating in human serum or plasma samples, and which is preferably an antibody for capturing said proBNP (1-108) present in the biological sample, and - a labeled conjugate capable of specifically binding to the antibody antigen complexes formed.
- the capture antibody can be advantageously presented in a form immobilized on a solid phase, such as a microplate, for example, but not exclusively.
- a preferred kit includes at least:
- an anti proBNP capture antibody specifically recognizing the sequence Y 7 oTLRAPR 76 S 77 PKMVQGSG 85 , the sequence Y 7 oTLRAPR 76 S 77 PKMVQGS 8 , and / or the sequence RAPR76S 77 P of proBNP (1 - 108) with the substantial exclusion of BNP (1-76) and BNP (77-108), and having the capacity to specifically recognize proBNP (1-108) circulating in human serum or plasma samples, said capture antibody being immobilized on a solid phase; and - a detection antibody, labeled, directed against another intact epitope, proBNP (1-108), or optionally,
- a labeled detection antigen which is a peptide of proBNP (1-108) or proBNP (1-108) itself.
- a kit for detecting proBNP (1-108) in a biological sample may contain:
- At least one peptide as defined above useful in particular as a standard and / or control.
- FIG. 1 represents the reactivity of the polyclonal rabbit antibodies # 046 805 purified on protein A-sepharose with proBNP (1-108), the BNP fragment (1-76), BNP (77-108), or GST ( Glutathione-S-transferase, used as a control protein) adsorbed on a microplate at 0.25 ⁇ g / ml.
- FIG. 2 represents the reactivity of the polyclonal antibodies of the rabbit filtrate # 046 805 obtained after exhaustion on BNP-K 3 -NHS-sepharose resin.
- the polyclonal antibodies are prepared in the form of dilution ranges from 2 to 20 ⁇ g / ml, then tested on wells coated with the proBNP (1-108), BNP (1-76) or BNP (77-108) polypeptide adsorbed at 0, 25 ⁇ g / ml.
- FIG. 3 represents the reactivity of the polyclonal antibodies of the rabbit filtrate # 046 832 obtained after exhaustion on BNP-K 3 -NHS-sepharose resin.
- the polyclonal antibodies are prepared in the form of dilution ranges from 5 to 20 ⁇ g / ml, then tested on wells coated with the proBNP (1-108), BNP (1-76) or BNP (77-108) polypeptide adsorbed at 0 , 25 ⁇ g / ml.
- FIG. 4 represents the reactivity of the polyclonal serum eluate from the rabbit # 046 805 obtained after exhaustion on BNP-K 3 -NHS-sepharose resin.
- the polyclonal antibodies are prepared in the form of dilution ranges from 2 to 20 ⁇ g / ml, then tested on wells coated with proBNP (1-108), BNP (1-76) or BNP (77-108) polypeptide adsorbed at 0 , 25 ⁇ g / ml.
- FIG. 5 represents the reactivity of the eluate of the polyclonal rabbit serum # 046 832 obtained after exhaustion on BNP-K 3 -NHS-sepharose resin.
- the polyclonal antibodies are prepared in the form of dilution ranges from 5 to 20 ⁇ g / ml, then tested on wells coated with the proBNP (1-108), BNP (1-76) or BNP (77-108) polypeptide adsorbed at 0 , 25 ⁇ g / ml.
- FIG. 6 represents an epitopic analysis using the spot technique of the polyclonal rabbit serum # 046 805 before exhaustion. (For this example, the background noise is 30.4 ⁇ 5.93 relative intensity units.)
- FIG. 7 represents an epitopic analysis using the spot technique of the polyclonal rabbit serum # 046 805 after exhaustion on BNP-K 3 -NHS-sepharose resin.
- the background noise is 31.3 ⁇ 6.31 relative intensity units.
- FIG. 8 represents the reactivity of the culture supernatant of the 3D4 hybridoma diluted to 1/2, tested on wells coated either with proBNP (1- 108), or BNP (1-76), or BNP (77- 108), or of peptide YTLRAPRSPKMVQGSG (C13P30), adsorbed at 1 ⁇ g / ml.
- FIG. 9 shows a photograph of the 16% acrylamide gel into which each protein has been migrated (1 ⁇ g of protein per lane).
- Lane 1 molecular weight marker
- lane 2 proBNP (1-108) -GST
- lane 3 GST (negative control protein)
- lane 4 BNP (1-76) -GST
- lane 5 BNP (77-108).
- FIG. 10 shows the results of the westem-blot test of the antibody produced by the 3D4 hybridoma on proBNP (1-108) -GST (lane 2), GST
- Figure 11 shows a calibration curve for the IRMA assay of proBNP (1-108).
- Figure 12 shows the results in cpm (counts per minute of radioactivity) of the IRMA assay of proBNP (1-108) from samples from 14 healthy subjects and 15 patients suffering from heart failure.
- FIG. 13 shows the correlation between the concentrations of proBNP (1-108) (in pg / ml) determined using the radioimmunometric assay according to the invention and the concentrations of BNP (1-76) (pg / ml) determined , using the assay on the Elecsys® automated device (Hoffmann La Roche brand), samples from 14 patients suffering from heart failure.
- FIG. 14 represents a calibration curve for the ELISA assay of proBNP (1-108) according to the invention.
- FIG. 15 represents an evaluation of the cross reaction, with respect to BNP (1-76) and BNP (77-108), of the polyclonal rabbit antibody # 046 805 coupled with biotin, used in sandwich in the proBNP ELISA assay (1-108) together with the anti-BNP polyclonal antibody (77-108).
- FIG. 16 represents the evaluation of the cross reaction, with respect to the
- Synthetic peptides are produced by standard techniques well known to those skilled in the art. We can cite, as an example, the Merrifield type synthesis which is advantageous given its ease of implementation (Merrifield, (1963); R.C. Sheppard (1971); Atherton et al. (1989)). As an automatic synthesizer, you can use the "9050 Plus Pep Synthesizer” from Millipore, the “Pioneer” from Perspective, or the "433A” from ABI. The peptides can also be obtained by synthesis in homogeneous phase.
- the inventors have synthesized the following peptides containing the amino acid sequence of the hinge region R 76 S 77 :
- NB ⁇ A means beta-alanine.
- the invention therefore also relates to any peptide chosen from the group consisting of the above sequences.
- the peptide is coupled to a carrier protein KLH (Keyhole Lympet Hemocyanin), Thyroglobulin, BSA (Bovine Serum Albumin, via different functions (thiol, amino, aldehyde ...) so as to make the peptide more immunogenic.
- coupling agent used to bind the peptide to the protein can be hetero or homo-bifunctional.
- the most commonly used reagents are BS 3, sSMCC, SPDP, glutaraldehyde ...
- One of the coupling techniques used is that which uses glutaraldehyde as a coupling chemical agent and KLH as a carrier protein.
- the coupling of KLH with the peptide is carried out on the basis of the amino functions of the peptide (mainly N-terminal group and amino group carried by lysine).
- a solution of the peptide C13P30 of sequence YTLRAPRSPKMVQGSG-NH 2 (SEQ ID No. 16) or of peptide CN32 of sequence YTLRAPRSPKMVQGS- NH 2 (SEQ ID No. 109) at 5 mg / ml is prepared in PBS buffer Dulbecco NaCI 0.15M at pH 7.4.
- a 20 mg vial of lyophilized KLH in PBS buffer (Pierce # 77600) is taken up in 2 ml of PPI water (water for injection), so as to obtain a solution of KLH at 10 mg / ml in PBS buffer.
- 1 ml of the peptide solution i.e. 5 mg
- 1.25 ml of the KLH solution i.e. 12.5 mg
- 2.25 ml of a 2% glutaraldehyde solution prepared extamporarily from 25% glutaldehyde, Sigma # G-5882
- the 2% glutaraldehyde solution is added dropwise and with stirring of the mixture.
- the conjugation reaction is carried out for 2 hours 30 minutes of incubation at room temperature.
- the coupling reaction is stopped by adding a 100 mg / ml sodium borohydride solution so as to reach a final concentration of 10 mg / ml.
- the mixture is incubated overnight at 4 ° C.
- the solution is dialyzed overnight at 4 ° C. against Dulbecco PBS buffer at pH 7.4.
- the solution is finally aliquoted and stored at -80 ° C.
- rabbits females of New Zealand strain
- rabbits were immunized using the peptide Cys-YTLRAPRSPKMVQGSG-NH 2 coupled to KLH according to Example 2.
- an emulsion of 1.5 ml of peptide coupled to KLH with 1.5 ml of complete Freund's adjuvant (Sigma # F-5881) is produced, and 1 ml of this latter emulsion (i.e. 200 ⁇ g of peptide) is injected intradermally at each of the rabbits.
- Two boosters are made 20 days apart by injecting intradermally 1 ml of a peptide emulsion coupled to KLH (ie 200 ⁇ g of peptide) with incomplete Freund's adjuvant (Sigma # F-5506). Twenty days after the second booster, a third booster is given in the same way as the previous booster but with subcutaneous injection. Twenty days after this last reminder, and after evaluation of the antibody titer obtained, the rabbits are bled. More particularly, the polyclonal antibodies of rabbits identified by the numbers # 046 805 and 046 832 obtained by immunization with the peptide C-YTLRAPRSPKMVQGS-NH2 (SEQ ID No.
- the rabbit sera are centrifuged for 30 minutes at 4,500 rpm at 4 ° C. After decantation, the serum is diluted by half in 1.5M glycine buffer, pH 8.0 containing 1M NaCl.
- polyclonal antibodies The purification of polyclonal antibodies is carried out by affinity chromatography on a protein A-sepharose gel (Amersham Biosciences # 17.1279.02). Protein A extracted from Staphylococcus aureus specifically combines with the Fc fragment of the IgG molecules. Then the IgGs, all subclasses combined, are eluted at pH 3.0.
- All the buffers used are degassed for 15 minutes in an ultrasonic bath before passing through the column, in order to prevent the formation of bubbles.
- a chromatography column is prepared using 12 ml of protein A-sepharose.
- the gel column is equilibrated for 40 minutes with distilled and degassed water, then for 40 minutes with Dulbecco PBS buffer at pH 7.4 containing 0.5 M NaCl, and finally with 1.5 M glycine buffer. at pH 8.0 containing 1 M NaCl, until a correct baseline is obtained.
- the reactivity of the polyclonal antibodies is tested by ELISA on wells coated either with proBNP (1-108), or BNP (1-76), or BNP (77-108) adsorbed at 0.25 mcg / ml.
- the obtained results for the rabbit polyclonal antibodies # 046 805 are presented in FIG. 1.
- the rabbit polyclonal antibodies # 046 832 gave identical results.
- the polyclonal antibodies in rabbits # 046 805 and # 046 832 are relatively specific for proBNP (1-108).
- Example 4.b Depletion of IgG on BNP-K 3 -NHS-Sepharose resin
- the purpose of this operation is to eliminate the cross-reactivity observed with respect to BNP (77-108).
- BNP (77-108) was synthesized with an extension of 3 lysine residues in the C-terminal position (BNP-K 3 ) in order to promote its coupling to the NHS-sepharose resin by its C-terminal end. .
- BNP-K 3 SPKMVQGSGCFGRKMDRlSSS-SGLG-CKVLRRHKKK (SEQ ID No. 104) was synthesized on a Pioneer synthesizer, using the chemistry "Fmoc" (9-fluorenylmethyloxy carbonyl) cited above under Example 1.
- BNP-K 3 5 mg are dissolved using the NaHC03 100mM buffer, at pH 8.3 added with 0.5M NaCl at a concentration of 10mg / ml.
- 2ml of NHS-Sepharose resin NHS-activated Sepharose 4 Fast Flow, Amerscham Biosciences # 17.0906.01
- NHS-Sepharose resin NHS-activated Sepharose 4 Fast Flow, Amerscham Biosciences # 17.0906.01
- the resin is washed with 15 ml of a cold 1 mM HCl solution. After centrifugation and elimination of the HCl solution, the resin is mixed with the BNP-K3 ligand at 10 mg / ml. The mixture is incubated for 1 hour at room temperature with slow stirring.
- the non-reactive groups of the resin are blocked using 5 ml of 0.1 M glycine buffer, at pH 8.0. The mixture is incubated for 1 hour at room temperature with slow stirring. After centrifugation and elimination of the blocking buffer, the resin is taken up in 5 ml of 100 mM NaHCO 3 buffer, at pH 8.3 added with 0.5 M NaCl. Four washes using this buffer are carried out. At the last wash, the mixture is deposited on a chromatography column. After preparation of the chromatography column, 10 mg of rabbit IgG
- # 046 805 and # 046 832 is specific for proBNP (1-108): no reactivity is observed on BNP (1-76) or on BNP (77-108). The eluate retains a high reactivity towards proBNP (1-108), but also a reactivity towards BNP (77-108). These results confirm the efficacy of the depletion of the polyclonal rabbit serum on the BNP-K3-NHS-sepharose resin.
- BNP (77-108) is from Sigma (# B-5900), while proBNP (1-108) and BNP (1-76) were produced as recombinant proteins expressed after cloning into the vector pGEX- 2T (Amersham Pharmacia Biotech) and transfection in E coli, by conventional techniques well known to those skilled in the art.
- the original vector was supplied by the company Berlex Biosciences (Richmond, CA, USA) and its preparation is described by Yan et al. (PNAS, 2000, vol. 97, pp. 8525-8529).
- the concentration of proBNP (1-108) and that of BNP (1-76) were determined by the Bradford method of colorimetric determination of proteins (Bradford M. Anal. Biochem. 1976; 72: 248-54).
- EXAMPLE 5 Determination of the Percentage of Cross Reaction of Anti ProBNP Antibodies (1-108) in Rabbits # 046 805 and # L01235 with Respect to BNP (1-76) and BNP (77-108)
- BNP (77-108) is from Sigma (# B-5900), while proBNP (1-108) and BNP (1-76) have been produced as recombinant proteins.
- concentration of these protein solutions was determined by the Bradford method of colorimetric determination of proteins (Bradford M. Anal. Biochem. 1976; 72: 248-54).
- the conjugate used is a polyclonal anti-rabbit IgG antibody coupled to peroxidase (Sigma # A-9169)
- Saturation buffer Dulbecco PBS buffer at pH 7.4 containing 1% serum bovine albumin (BSA, Sigma # A-7888) 5) Dilution buffer: PBS Dulbecco buffer at pH 7.4
- Washing solution Dulbecco PBS buffer at pH 7.4 containing 0.1% Tween 20.
- Development solution is composed: 7a) of a substrate buffer: 0.01 M citric acid solution, and 0.04 M trisodium citrate containing H 2 0 2 at 0.33 %, final pH 5.6, and
- the test consists in evaluating the immunoreactivity of polyclonal antibodies directly on the various proteins immobilized in the wells of a microtiter plate.
- sensitization solutions in PBS buffer Dulbecco pH 7.4 are first prepared: a first containing BNP (77-108) at 0.25 ⁇ g / ml, a second containing proBNP (1-108) at 0.25 ⁇ g / ml, one third containing BNP (1-76) at 0.25 ⁇ g / ml, and a fourth containing GST (background noise control protein) at 0.25 ⁇ g / ml. 100 ⁇ l of each of these solutions are deposited separately in the wells of a microplate. S The microplate is incubated overnight at 4 ° C.
- the microplate is washed using 300 ⁇ l of Dulbecco PBS buffer at pH 7.4 containing 0.1% Tween 20, then saturated by adding 250 ⁇ l of Dulbecco PBS buffer to pH 7.4 containing 1% BSA. The microplate is then incubated for 1 hour at 37 ° C.
- the microplate is then washed (3 times) using the washing solution.
- 100 ⁇ l of polyclonal antibody solution previously diluted to 2 and 1 ⁇ g / ml for the polyclonal rabbit serum # 046 805 and at 1/2500 and 1/5000 for the polyclonal rabbit serum # L01235, are deposited .
- the reaction medium is incubated for 2 hours at room temperature.
- the microplate is then washed 3 times with 300 ⁇ l of the washing solution.
- 100 ⁇ l of the anti-rabbit anti-IgG polyclonal antibody conjugate coupled to peroxidase diluted to 1/8000 in dilution buffer, are added to each well of the microplate.
- the reaction medium is incubated for 1 hour at room temperature.
- the plates are then washed (5 washes) with 300 ⁇ l of the washing solution. In each well, 100 ⁇ l of the developer solution are distributed. The reaction is allowed to develop in the dark for 20 minutes at room temperature (18-24 ° C). s Then 50 ⁇ l of the stop solution are distributed in each well.
- Example 6 Identification of the epitope recognized by the polyclonal sera from rabbits # 046 805 and # 046 832 before and after exhaustion on BNP-K 3 -NHS-sepharose resin
- the polyclonal sera from rabbits # 046 805 and # 046 832 before and after exhaustion on BNP-K 3 -NHS-sepharose resin were tested by the spot method in order to identify the epitope recognized by these polyclonal sera.
- This method described by Frank (Tetrahedron, 1992; 48: 9217-32), allows rapid synthesis on the nitrocellulose membrane of a large number of peptides with predefined sequences.
- the protocols used are those described by Molina et al. (Pept. Res., 1996; 9: 151-5).
- On a sheet of paper are created circular areas (spots) of about 5 mm in diameter, with an amino function, which serve as anchors for the C-terminal amino acid of the synthetic peptide.
- the peptide chain is extended by successive additions of activated Fmoc-amino acids.
- the side chains of amino acids are blocked by suitable chemical groups. All peptides are synthesized with their N-terminal N-acetylated residue. At the end of the synthesis, the side chains are deprotected by the action of trifluoroacetic acid. This treatment does not affect the bond between the peptide and the cellulosic support, and the reactivity of the peptides can be evaluated by a colorimetric test.
- the series of membrane-synthesized peptides consists of 32 pentadecapeptides shifted by 3 amino acid residues representing the entire sequence of proBNP (1-108).
- Table 11 Spot membrane consisting of 32 pentadecapeptides shifted by 3 into 3 amino acid residues representing the entire sequence of proBNP (1-108)
- TBS buffer Tris Buffer Saline
- Blocking buffer Euromedex # SU-07-250
- sucrose 5% sucrose
- the spots are revealed by adding 30 ml of substrate solution (30 ml solution of CBS buffer (Citrate Buffer Saline) at pH 7.0 containing 120 ⁇ l of BCIP (5-bromo-4-chloro-3-lndolyl phosphate) 0.15M, 150 ⁇ l of MgCl 2 1M and 180 ⁇ l of MTT (Thiazolyl blue tetrazolium bromide) 0.1 M.
- substrate solution 30 ml solution of CBS buffer (Citrate Buffer Saline) at pH 7.0 containing 120 ⁇ l of BCIP (5-bromo-4-chloro-3-lndolyl phosphate) 0.15M, 150 ⁇ l of MgCl 2 1M and 180 ⁇ l of MTT (Thiazolyl blue tetrazolium bromide) 0.1 M.
- MTT Thiazolyl blue tetrazolium bromide
- Example 7 Identification of the minimum epitope of polyclonal sera from rabbits # 046 805 and # 046 832 before and after exhaustion, by the Ala-scan method
- polyclonal sera from rabbits # 046 805 and # 046 832, before and after exhaustion on BNP-K 3 -NHS-sepharose resin were tested by the spot method (described in example 6) in order to identify the epitope minimum, in the hinge peptide, allowing specific recognition of the only proBNP (1-108) by polyclonal sera.
- YTLRAPRSPKMVQGS carrying a step-by-step substitution of each amino acid with an alanine or glycine residue. Reactivity of polyclonal sera from rabbits # 046 805 and # 046 832 before and after exhaustion on BNP-K 3 -NHS-sepharose resin.
- NB the alanine or glycine residues substituted for the initial amino acids are underlined (A and G).
- the amino acids critical in the recognition of the epitope recognized by the polyclonal rabbit serum # 046 805 before exhaustion are R 76 S 77 P, while after exhaustion of the polyclonal rabbit serum # 046 805 on BNP-K resin 3 - NHS-Sepharose, in addition to the motif R 76 S 77 P, the motif RA becomes a contributor.
- Example 8 Identification of the minimum epitope of rabbit polyclonal serum # L01235, by the Ala-scan method
- the polyclonal rabbit serum # L01235 specific from the start of proBNP (1-108) (unnecessary exhaustion), was tested by the spot method (described in example 6) in order to identify the minimum epitope, in the pivotal peptide, allowing specific recognition of the only proBNP (1-108) by polyclonal serum.
- the membrane used is that described in Example 7.
- the results of the Ala-scan analysis of the polyclonal rabbit serum # L01235 are presented in Table IV.
- Table IV spot membrane with 16 pentadecapeptides YTLRAPRSPKMVQGS carrying a step-by-step substitution of each amino acid with an alanine or glycine residue. Reactivity of rabbit polyclonal serum # L01235.
- NB the alanine or glycine residues substituted for the initial amino acids are underlined (A and G).
- BALB / c strain mice (6 week old females) were immunized using the recombinant proBNP (1-108) described in Example 4.b, by standard techniques well known to those skilled in the art. .
- an emulsion of 1 ml of proBNP (1-108) with 1 ml of complete Freund's adjuvant (Sigma # F-5881) is produced, and 300 ⁇ l of this emulsion (ie 100 ⁇ g of protein) are injected with subcutaneously to each of the mice.
- Two boosters are performed 15 days apart by intraperitoneal injection of 300 ⁇ l of an emulsion of proBNP (1-108) (ie 100 ⁇ g of protein) with incomplete Freund's adjuvant (Sigma # F-5506).
- mice 12 Fifteen days after the second reminder, a third reminder is carried out in the same way as the previous reminders but in injection subcutaneous. Finally, 15 days after this last reminder, blood samples are taken from the mice to analyze the immune response using the spot technique. The immune response of mouse 12 was found to be particularly interesting for the rest of the work.
- the membrane-synthesized peptide series consists of 94 pentadecapeptides, each shifted by an amino acid residue, representing the entire sequence of proBNP (1-108).
- the reactivity of the polyclonal serum of the mouse 12 diluted to 1 / 500th is tested on this membrane as described in Example 6. After scanning the membrane, the intensity of the spots of the membrane is evaluated (in units d relative intensity) using image processing software. The background noise, calculated from spots not detected by the antiserum, was 30 relative intensity units.
- sequence H1PLGSPGSASDLETS15 SEQ ID No. 23
- sequence L 17 QEQRNHLQGK 27 SEQ ID N ° 123
- sequence L 38 EPLQESPRPTG 49 SEQ ID N ° 124) (spots 38 to 49).
- the antiserum of mouse 12 also contains antibodies capable of recognizing spots whose peptide sequence comprises the motif RAPR7 6 S 7P: spots 64 to 68.
- the peptide sequences of the spots are described in Table V.
- Table V Epitopes of the hinge region recognized, using the spot technique, by the antiserum of the mouse 12.
- Example 11 Obtaining monoclonal antibodies specifically recognizing proBNP (1-108), with the substantial exclusion of BNP (1-76) and BNP (77-108) Mice (5 week female BALB / c ) selected for the production of monoclonal antibodies was immunized with the peptide SEQ ID No. 16 C-YTLRAPRSPKMVQGSG-NH2 (C13P30) coupled to KLH (Keyhole Limpet Hemocyanin) according to the following protocol: 100 ⁇ g of the peptide coupled to KLH diluted volume to volume with complete Freund's adjuvant were injected subcutaneously. Four boosters were performed at an interval of 3 weeks with 100 ⁇ g of the peptide coupled to KLH diluted volume by volume with incomplete Freund's adjuvant, injected subcutaneously.
- the mouse Three days before carrying out the lymphocyte fusion, the mouse underwent hyperimmunization according to the following protocol: the total dose of immunogen, here 100 ⁇ g of peptide C-YTLRAPRSPKMVQGSG-NH2 coupled to KLH in sterile PBS buffer, is fractionated in 4 injections. The first and second injections each correspond to 1 / 10th of the total dose. These injections are given subcutaneously in different places and 45 minutes apart. The third injection, which corresponds to 2 / 10ths of the total dose, is given 45 minutes after the second injection, by subcutaneous route.
- the total dose of immunogen here 100 ⁇ g of peptide C-YTLRAPRSPKMVQGSG-NH2 coupled to KLH in sterile PBS buffer
- the first and second injections each correspond to 1 / 10th of the total dose. These injections are given subcutaneously in different places and 45 minutes apart.
- the third injection which corresponds to 2 / 10ths of the total dose, is given 45 minutes after
- Lymphocyte hybridization is carried out according to the method described by Ko ⁇ hler and Milstein (Nature, 1975; 256: 495-97). It is carried out from lymphocyte cells extracted from the mouse spleen and myeloma cells (P3-X63-Ag8.653) previously cultured in RPMI 1640 medium (Bio-Whittaker # BE12-167F), supplemented with a mixture L-glutamine, penicillin and streptomycin (Sigma # G-6784), supplemented with 10% fetal calf serum previously decomplemented (Bio-Whittaker # BE02701E) and 8-azaguanine (Sigma # A-8526).
- Lymphocyte cells and myeloma cells previously placed in RPMI 1640 medium (Bio-Whittaker # BE12-167F) supplemented with a mixture of L-glutamine, penicillin and streptomycin (Sigma # G-6784) without addition of fetal calf serum, are mixed at the rate of 5 lymphocyte cells for 1 myeloma cell. After centrifugation of the mixture 7 minutes at 900 r / min at room temperature, and resuspending the cell pellet, 1 ml of polyethylene glycol Hybri-Max ® (Sigma # P-7777) was added.
- the cells After 1 minute of incubation in a water bath at 37 ° C, the cells are centrifuged for 1 minute and thirty seconds at 1000 rpm at room temperature. Finally after 2 minutes incubation in a water bath at 37 ° C, the pellet is resuspended and 6 ml of RPMI 1640 medium (Bio-Whittaker # BE12-167F) supplemented with a mixture of L-glutamine, penicillin and streptomycin (Sigma # G-6784) previously placed at 37 ° C, are added at the rate of 10O ⁇ l every 5 seconds, and 9ml of this same medium are added all at once.
- RPMI 1640 medium Bio-Whittaker # BE12-167F
- the pellet is taken up in RPMI 1640 medium (Bio-Whittaker # BE12-167F), supplemented with a mixture of L-glutamine, penicillin and streptomycin ( Sigma # G-6784), supplemented with 15% fetal calf serum previously decomplemented (Bio-Whittaker # BE02701 E) and HAT (Hypoxanthine, aminopterin, thymidine Sigma # H-0262) distribute, under 100 ⁇ l, 120,000 cells per well. The solution is deposited under 100 ⁇ l in the wells of the 96-well culture plates previously seeded with murine macrophages. The plates are then placed in a CO 2 incubator. Fifteen days after lymphocyte hybridization, the number of clones present in the fusion plates is estimated and expressed as a percentage of development of the hybridomas.
- hybridomas The selection of hybridomas is carried out by ELISA on proBNP (1-108), BNP (1-76), BNP (77-108) and a peptide carrying the sequence RAPR 76 S 7 P (C13P30). Only hybridomas secreting antibodies capable of detecting proBNP (1-108) and the C13P30 peptide carrying the sequence RAPR 76 S 77 P and not substantially recognizing BNP (1- 76) nor BNP (77-108), are retained. The selected hybridomas are maintained in culture and clones in limiting dilution. The hybridomas thus cloned can then be used for the production of the monoclonal antibody in ascites fluid.
- the inventors produced a murine hybridoma, the clone 3D4, secreting an immunoglobulin of isotype lgG- ⁇ having the characteristics of the antibodies according to the invention.
- This hybridoma was deposited on July 31, 2003 at the CNCM (National Collection of Cultures of Microorganisms, Institut Pasteur, 25, rue du Dondel Roux, 75 724 Paris, Cedex 15, France) under the registration number CNCM I-3073.
- the invention therefore also relates to the 3D4 hybridoma deposited at the CNCM under the registration number CNCM I-3073 and the monoclonal antibody which it secretes.
- Example 12 Validation in ELISA of the Specificity of the Antibody Produced by the 3D4 Hybridoma
- BNP (77-108) is from Sigma (# B-5900), while proBNP (1-108) and BNP (1-76) have been produced as recombinant proteins.
- concentration of these protein solutions has been determined by the Bradford method of colorimetric determination of proteins (Bradford M. Anal. Biochem. 1976; 72: 248-54).
- the conjugate used is a polyclonal donkey antibody anti-mouse IgG coupled to peroxidase (Jackson Immunoresearch # 715-035-150)
- Saturation buffer PBS Dulbecco buffer at pH 7.4 containing 1% of serum bovine albumin (BSA, Sigma # A-7888)
- Dilution buffer Dulbecco PBS buffer at pH 7.4 containing 0.1% BSA and 0.1% Tween 20.
- Washing solution Dulbecco PBS buffer at pH 7.4 containing 0.1% Tween 20.
- Development solution is composed: 7a) of a substrate buffer: 0.01 M citric acid solution, and 0.04 M trisodium citrate containing H 2 0 2 at 0.33 %, final pH 5.6, and
- the test consists in evaluating the immunoreactivity of the culture supernatant of the 3D4 hybridoma directly on the various proteins immobilized in the wells of a microtiter plate.
- the microplate is incubated overnight at 4 ° C. S After elimination of the sensitization solution, the microplate is washed using a Dulbecco PBS buffer at pH 7.4 containing 0.1% Tween 20, then saturated by adding 250 ⁇ l of Dulbecco PBS buffer at pH 7 , 4 containing 1% BSA. - / The microplate is then incubated for 1 hour at 37 ° C. The microplate is then washed (3 times) with 300 ⁇ l of the washing solution.
- reaction medium is incubated for 2 hours at room temperature
- microplate is then washed 3 times with 300 ⁇ l of the washing solution.
- 100 ⁇ l of conjugate, polyclonal anti-mouse IgG antibody coupled to peroxidase diluted to 1/2000 in dilution buffer are added to each well of the microplate.
- the reaction medium incubated for 1 hour at room temperature.
- • / The plates are then washed (5 washes) with 300 ⁇ l of the washing solution.
- 100 ⁇ l of the developer solution are distributed.
- the reaction is allowed to develop in the dark for 20 minutes at room temperature (18-24 ° C).
- 50 ⁇ l of the stop solution are distributed in each well. After stopping the reaction, the reading of the optical density is carried out with a spectrophotometer at 490/620 nm.
- FIG. 8 illustrates the result of this test: the antibody produced in the supernatant of the 3D4 hybridoma is capable of detecting only proBNP (1 -108) and the immunization peptide C13P30, no reactivity is obtained on the BNP (1-76) and BNP (77-108).
- These results validate the specificity of the antibody produced by the 3D4 hybridoma for proBNP (1-108) excluding BNP (1-76) and BNP (77-108).
- the antibody according to the invention derived from the 3D4 hybridoma is therefore indeed an antibody specifically recognizing proBNP (1-108), with the substantial exclusion of BNP (1-76) and BNP (77-108) .
- EXAMPLE 13 Western Blot Validation of the Specificity of the Antibody Produced by the 3D4 Hybridoma
- Electrophoretic transfer device 0.1 M Tris-tricin; 0.1% SDS 6) Sample buffer: Tris 0.5M, pH 6.8; 25% glycerol; 2% SDS; 14.4 mM beta-mercaptoethanol; 0.1% bromophenol blue 7) Electrophoretic transfer device
- BNP (77-108) comes from Sigma (# B-5900), while proBNP (1- 108) -GST, BNP (1-76) -GST and GST ( used as a negative control) were produced as recombinant proteins. The concentration of these protein solutions was determined by the Bradford method of colorimetric determination of proteins (Bradford M. Anal. Biochem. 1976; 72: 248-54).
- the conjugate used is a polyclonal donkey anti-mouse IgG antibody coupled with peroxidase (Jackson Immunoresearch # 715-035-150) 11) ECL kit for detection in western blot (Amersham Biosciences # RPN2106)
- the implementation of this test comprises three main stages: the electrophoretic migration of the different proteins in a 16% acrylamide gel, then the transfer of these proteins onto a nitrocellulose membrane, and finally the western-blot.
- Various solutions are prepared in sample buffer with a final volume of 35 ⁇ l: a first comprising 1 ⁇ g of proBNP (1-108) -GST, a second comprising 1 ⁇ g of GST, a third comprising 1 ⁇ g of BNP (1-76) -GST, and a fourth comprising 1 ⁇ g of BNP (77-108).
- Each solution is incubated in a water bath for 5 minutes at 100 ° C., then deposited in a well of the gel.
- the migration through the acrylamide gel is carried out at constant voltage at 120 V for 1 hour 30 minutes.
- FIG. 9 corresponds to a photograph of the acrylamide gel obtained.
- the proteins deposited are colored by coomassie blue. After migration, the proteins of the gel are transferred to a nitrocellulose membrane for 1 hour at 120 mA.
- nitrocellulose membrane is then washed with 0.1% PBS + Tween buffer and saturated for 30 minutes at room temperature in 0.1% PBS + Tween buffer + 2% skimmed milk After 3 washes with 0.1% PBS + Tween buffer, the membrane is incubated for 1 hour at + 37 ° C., with stirring, with 5 ml of 3D4 hybridoma supernatant.
- the membrane is incubated for 1 hour at room temperature with shaking with 10 ml of anti-mouse IgG conjugate coupled to peroxidase diluted to 1/2000 in 0.1% PBS + Tween buffer + 2% skimmed milk After 3 washes with 0.1% PBS + Tween buffer, the membrane is soaked in the ECL development reagent, before being exposed to a photographic film for 4 minutes.
- the antibody produced in the supernatant of the 3D4 hybridoma is capable of detecting only the band corresponding to proBNP (1-108).
- BNP (1-76), BNP (77-108), and GST are not detected by the 3D4 hybridoma antibody.
- the antibody according to the invention derived from the 3D4 hybridoma is therefore indeed an antibody specifically recognizing proBNP (1-108), with the substantial exclusion of BNP (1-76) and BNP (77-108) .
- the supernatant of the 3D4 hybridoma was tested by the spot method (described in example 6) in order to identify the epitope recognized by the antibody to the 3D4 hybridoma.
- the results obtained indicate that the 3D4 antibody effectively recognizes peptide sequences comprising the motif RAPR7 6 S 7 7P.
- the capture antibody used is the polyclonal antibody obtained from rabbit serum # 046 805 which is not exhausted.
- the conjugate used is anti-BNP antibody (77-108) labeled N125 (anti-BNP-l 125). It is the tracer antibody of the BNP Shionoria kit marketed by the company Shionogi.
- Saturation buffer Dulbecco PBS buffer at pH 7.4 containing 1% serum bovine albumin (BSA, Sigma # A-7888)
- Dilution buffer Dulbecco PBS buffer at pH 7.4 containing 0.1% BSA and 0.1% tween 20 (Sigma, # P-1379).
- Wash buffer Dulbecco PBS buffer at pH 7.4 containing
- Standard proBNP (1-108) produced in the form of a recombinant protein.
- the principle of the test used is based on the radioimmuno logical method of the sandwich type, carried out in a microplate with a flat bottom and with breakable cups. he this is a one-time test where the sample (or standard solution of proBNP (1-108)) and tracer are added one after the other without intermediate washing.
- An sensitization solution is firstly prepared with the polyclonal rabbit antibody # 046 805 diluted in PBS buffer Dulbecco at pH 7.4 at 40 ⁇ g / ml. 300 ⁇ l of this solution are deposited in each of the wells of the microplate.
- microplate is incubated overnight at 4 ° C. After elimination of the sensitization solution, the microplate is washed using 300 ⁇ l of Dulbecco PBS buffer at pH 7.4 containing 0.1% Tween 20, then saturated by adding 300 ⁇ l of Dulbecco PBS buffer to pH 7.4 containing 1% BSA. The microplate is then incubated for 1 hour at 37 ° C. • f The microplate is then washed (3 times) using 300 ⁇ l of the washing solution (PBS buffer Dulbecco at pH 7.4 added with 0.1% Tween 20). In each well, 100 ⁇ l of standard solution of proBNP (1-108), serum or plasma are deposited.
- ProBNP (1-108) if present, binds to the capture antibody retained on the solid phase.
- 200 ⁇ l of the ready-to-use anti-BNP- 125 125 tracer solution (extracted from the Shionoria BNP Shionoria kit) are added to each of the wells.
- the reaction medium is incubated overnight (18-22h) at 4 ° C.
- the microplate is washed (3 times) using 300 ⁇ l of the washing solution. At the last washing and after aspiration of the washing solution, each well is transferred into a previously identified tube.
- FIG. 12 presents the results in cpm (counts per minute) of the tests of these samples with the IRMA proBNP assay (1-108) according to the invention.
- the results obtained on samples from patients suffering from heart failure are significantly higher than those obtained on samples from healthy subjects.
- the coupling method uses an N-Hydroxy Succinimide derivative (NHS) of biotin which reacts with the primary amines of IgG to form an amide bond.
- NHS N-Hydroxy Succinimide derivative
- a 100mM solution of (+) - Biotin N-succinimidyl ester (Fluka # 14405) is prepared by dissolving Biotin in dimethylfomamide. Biotinylation is carried out in a glass bottle. 500 ⁇ g of the rabbit polyclonal antibody # 046 805 previously purified but not exhausted are deposited in the flask with 17 ⁇ l of the 100 mM biotin solution (the biotin / antibody molar ratio is 500). The reaction is carried out in PBS Dulbecco buffer at pH 7.4. The reaction mixture is incubated for 1 30 hours at room temperature with slow stirring. After coupling, the biotin is inactivated by adding a volume of 2M glycine buffer.
- the mixture is incubated for 10 minutes at room temperature with slow shaking. Finally, the mixture is dialyzed overnight at 4 ° C. against Dulbecco PBS buffer at pH 7.4. The following day, a solution of sodium azide is added at 0.02% in final concentration. The conjugate is stored at 4 ° C.
- An immunoenzymometric assay according to the invention has also been developed.
- the capture antibody used is a polyclonal anti-BNP antibody (77-108) marketed by the company Stratrete Biosolution (# B9105RA00-A0).
- the conjugate used is the polyclonal antibody of rabbit # 046 805 not exhausted coupled with biotin according to the method described in example 17.
- Saturation buffer Dulbecco PBS buffer at pH 7.4 containing 1% serum bovine albumin (BSA, Sigma # A-7888)
- Dilution buffer Dulbecco PBS buffer at pH 7.4 containing 0.1% BSA and 0.1% Tween 20.
- Washing solution Dulbecco PBS buffer at pH 7.4 containing 0.1% of Tween 20.
- proBNP standard (1-108) recombinant protein.
- development solution is made up of:
- the principle of the test used is based on the enzymoimmunological method of the sandwich type, produced in a microplate with a flat bottom. This is a two-step test where the sample (or the standard solution) is first incubated with the capture antibody, then after incubation and washing, the detection antibody is added.
- An sensitization solution is firstly prepared with the anti-BNP polyclonal antibody (77-108) diluted in Dulbecco PBS buffer at pH 7.4 at 10 ⁇ g / ml. 100 ⁇ l of this solution are deposited in each of the wells of the microplate. The microplate is incubated overnight at 4 ° C. After elimination of the sensitization solution, the microplate is washed using 300 ⁇ l of a Dulbecco PBS buffer at pH 7.4 containing 0.1% Tween 20, then saturated by adding 250 ⁇ l of Dulbecco PBS buffer to pH 7.4 containing 1% BSA. The microplate is then incubated for 1 hour at 37 ° C.
- the microplate is then washed (3 times) using the washing solution.
- 100 ⁇ l of standard proBNP solution (1 -108), serum or plasma are deposited.
- ProBNP (1-108) if present, binds to the capture antibody retained on the solid phase.
- the reaction medium is incubated for 2 hours at room temperature.
- the microplate is then washed (5 washes) with 300 ⁇ l of the washing solution.
- 100 ⁇ l of rabbit polyclonal antibody # 046 805 biotinyl (concentrated to 6 ⁇ g / ml) are added to each well of the microplate.
- the reaction medium incubated for 2 hours at room temperature.
- microplate is then washed (5 washes) with 300 ⁇ l of the washing solution. Finally, 100 ⁇ l of streptavidin-POD conjugate diluted to 1 / 1000th are added to each of the wells of the microplate.
- reaction medium is incubated for 1 hour 30 minutes at room temperature. • The plates are then washed (5 washes) with 300 ⁇ l of the washing solution. In each well, 100 ⁇ l of the developer solution are distributed. The reaction is allowed to develop in the dark for 20 minutes at room temperature (18-24 ° C). Then 50 ⁇ l of the stop solution are distributed in each well.
- the optical density is read in a spectrophotometer at 490/620 nm.
- Figure 14 shows the results obtained using a standard range of proBNP (1-108).
- BNP (1-76) or BNP (77-108) No cross-reaction is observed with respect to BNP (1-76) or BNP (77-108): the signal obtained is equivalent to background noise, whatever the concentration tested.
- the rabbit polyclonal antibody # 046 805 can be used in its non-exhausted version without causing the appearance of cross-reaction.
- rabbit polyclonal antibody # 046 805 not exhausted coupled with biotin used in sandwich in the ELISA proBNP assay (1-108) together with the polyclonal anti-NT antibody -proBNP (1- 29).
- ELISA assay of proBNP (1-108) using the protocol and the reagents described in Example 18, except that the anti-BNP polyclonal antibody (77-108) is here replaced by a anti-NT-proBNP polyclonal antibody (1-29), the cross-reaction of rabbit polyclonal antibody # 046 805, biotinyl with respect to BNP (1-76) and BNP (77-108) was evaluated ).
- the anti-NT-proBNP (1-29) polyclonal antibody was produced according to the protocol described in Example 3, except that the peptide used as immunogen was the NT-proBNP (1-29) peptide coupled to the KLH. Concentration ranges from 5ng / ml to 100ng / ml were carried out with proBNP (1- 108), BNP (1-76) and BNP (77-108) and tested using the proBNP ELISA assay (1-108). The results of the variation of the optical density at 490nm as a function of the concentration are represented in FIG. 16 for each of the proteins.
- the present invention has made it possible to discover a new epitope, RAPR 76 S 77 P, located on the hinge region of human proBNP (108), to derive immunogenic peptides therefrom. the container, and to obtain antibodies specific to proBNP (108), which do not substantially recognize BNP (1-76) and BNP (77-108), some of which have the ability to specifically recognize proBNP (1-108) circulating in human serum or plasma samples.
- the present invention has made it possible to develop a dosage of circulating proBNP (1-108) thus allowing a diagnosis of heart failure in a simple manner, usable in routine and reliable.
Abstract
Description
Claims
Priority Applications (7)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
AT03756532T ATE486093T1 (de) | 2002-08-07 | 2003-08-07 | Antikörper, die spezifische für probnp(1-108) sind, und ihre verwendung zur diagnose von herzinfarkt |
JP2004526985A JP4576232B2 (ja) | 2002-08-07 | 2003-08-07 | 心不全を診断するための特異性抗体 |
CA2494140A CA2494140C (fr) | 2002-08-07 | 2003-08-07 | Anticorps specifiques pour le diagnostic de l'insuffisance cardiaque |
DE60334696T DE60334696D1 (de) | 2002-08-07 | 2003-08-07 | Antikörper, die spezifische für probnp(1-108) sind, und ihre verwendung zur diagnose von herzinfarkt |
US10/523,400 US7553937B2 (en) | 2002-08-07 | 2003-08-07 | Specific antibodies for diagnosing heart failure |
AU2003282194A AU2003282194B2 (en) | 2002-08-07 | 2003-08-07 | Specific proBNP(1-108) antibodies for diagnosing heart failure |
EP03756532A EP1527101B1 (fr) | 2002-08-07 | 2003-08-07 | Anticorps specifiques du probnp(1-108) et leur utilisation pour le diagnostic de l'insuffisance cardiaque |
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
FR0210063A FR2843396B1 (fr) | 2002-08-07 | 2002-08-07 | Anticorps specifiques pour le diagnostic de l'insuffisance cardiaque |
FR0210063 | 2002-08-07 |
Publications (2)
Publication Number | Publication Date |
---|---|
WO2004014952A2 true WO2004014952A2 (fr) | 2004-02-19 |
WO2004014952A3 WO2004014952A3 (fr) | 2004-04-08 |
Family
ID=30470996
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/FR2003/002483 WO2004014952A2 (fr) | 2002-08-07 | 2003-08-07 | Anticorps specifiques du probnp (1-108) pour le diagnostic de l'insuffisance cardiaque |
Country Status (12)
Country | Link |
---|---|
US (1) | US7553937B2 (fr) |
EP (1) | EP1527101B1 (fr) |
JP (1) | JP4576232B2 (fr) |
CN (1) | CN100467489C (fr) |
AT (1) | ATE486093T1 (fr) |
AU (1) | AU2003282194B2 (fr) |
CA (1) | CA2494140C (fr) |
DE (1) | DE60334696D1 (fr) |
ES (1) | ES2354608T3 (fr) |
FR (1) | FR2843396B1 (fr) |
RU (1) | RU2315773C2 (fr) |
WO (1) | WO2004014952A2 (fr) |
Cited By (5)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2010012509A1 (fr) * | 2008-08-01 | 2010-02-04 | Bio-Rad Pasteur | Procédé pour le diagnostic in vitro d'un accident vasculaire cérébral |
US20120028824A1 (en) * | 2009-01-30 | 2012-02-02 | Electrophoretics Limited | Method for the in vitro diagnosis of stroke |
US8407182B1 (en) | 2011-01-21 | 2013-03-26 | Symantec Corporation | Systems and methods for facilitating long-distance live migrations of virtual machines |
US8527990B1 (en) | 2011-04-29 | 2013-09-03 | Symantec Corporation | Systems and methods for migrating virtual machines |
US9481720B2 (en) | 2007-08-03 | 2016-11-01 | Bio-Rad Innovations | BNP(1-32) epitope and antibodies directed against said epitope |
Families Citing this family (22)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US7524635B2 (en) * | 2003-04-17 | 2009-04-28 | Biosite Incorporated | Methods and compositions for measuring natriuretic peptides and uses thereof |
AT500800B1 (de) * | 2004-09-08 | 2008-07-15 | Biomedica Medizinprodukte Gmbh | Verfahren zur bestimmung von probnp |
US7300494B2 (en) * | 2005-02-24 | 2007-11-27 | Hamilton Sundstrand Corporation | On-board inert gas generation system with compressor surge protection |
DE102007010834A1 (de) * | 2007-03-03 | 2008-09-04 | Brahms Aktiengesellschaft | Diagnose und Risikostratifizierung von Herzinsuffizienz für NYHA I Patienten |
AT504942B1 (de) | 2007-03-07 | 2009-08-15 | Biomedica Medizinprodukte Gmbh | Verfahren zur bestimmung von probnp |
PT2222697E (pt) * | 2007-11-01 | 2013-02-15 | Perseid Therapeutics Llc | Polipeptídeos imunossupressores e ácidos nucleicos |
WO2010023749A1 (fr) * | 2008-08-28 | 2010-03-04 | 株式会社 島津製作所 | Procédé pour évaluer l’état ischémique myocardique en utilisant un échantillon de sang |
US20110270530A1 (en) * | 2008-12-08 | 2011-11-03 | Seok-Won Lee | Combined natriuretic peptide assays |
JP5362487B2 (ja) * | 2009-08-27 | 2013-12-11 | 塩野義製薬株式会社 | proBNP−108の新規用途 |
WO2011030286A1 (fr) | 2009-09-14 | 2011-03-17 | Koninklijke Philips Electronics N.V. | Dosage immunologique haute sensibilité à marqueurs à grosses particules |
US20120021431A1 (en) * | 2010-02-25 | 2012-01-26 | Toshio Nishikimi | Diagnostic methods using bnp |
US8778699B2 (en) | 2010-08-04 | 2014-07-15 | Idexx Laboratories, Inc. | Detection of degradation products of canine NT-proBNP |
EP2715353B1 (fr) | 2011-05-31 | 2016-08-24 | IDEXX Laboratories, Inc. | Détection des produits de dégradation de la nt-probnp féline |
CN102887943B (zh) * | 2012-08-30 | 2016-08-03 | 重庆业为基生物科技有限公司 | 氨基末端脑钠肽的b细胞表位肽段及其应用 |
CN103012595B (zh) * | 2012-12-17 | 2014-05-21 | 同昕生物技术(北京)有限公司 | 稳定的NT-proBNP校准品及应用 |
RU2569459C1 (ru) * | 2014-12-02 | 2015-11-27 | Федеральное государственное бюджетное учреждение "Российский кардиологический научно-производственный комплекс" Министерства здравоохранения России (ФГБУ "РКНПК" МЗ РФ) | Способ дифференциальной диагностики этиологии хронической сердечной недостаточности |
RU2569458C1 (ru) * | 2014-12-02 | 2015-11-27 | Федеральное государственное бюджетное учреждение "Российский кардиологический научно-производственный комплекс" Министерства здравоохранения России (ФГБУ "РКНПК" МЗ РФ) | Способ диагностики хронической сердечной недостаточности путем использования циркулирующих уровней микрорнк |
US10368774B2 (en) | 2015-07-30 | 2019-08-06 | Medtronic, Inc. | Absolute intrathoracic impedance based scheme to stratify patients for risk of a heart failure event |
CN105349545A (zh) * | 2015-12-14 | 2016-02-24 | 中国人民解放军军事医学科学院基础医学研究所 | 一种NT-proBNP核酸适配体及其应用 |
US11931207B2 (en) | 2018-12-11 | 2024-03-19 | Eko.Ai Pte. Ltd. | Artificial intelligence (AI) recognition of echocardiogram images to enhance a mobile ultrasound device |
US11446009B2 (en) | 2018-12-11 | 2022-09-20 | Eko.Ai Pte. Ltd. | Clinical workflow to diagnose heart disease based on cardiac biomarker measurements and AI recognition of 2D and doppler modality echocardiogram images |
CN109678958B (zh) * | 2019-01-31 | 2022-03-18 | 重庆探生科技有限公司 | 一种人NT-proBNP特异性重组羊单克隆抗体及其制备方法和应用 |
Citations (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2000035951A1 (fr) * | 1998-12-12 | 2000-06-22 | The University Of Leicester | Fragments de peptide natriuretique |
WO2000045176A2 (fr) * | 1999-01-29 | 2000-08-03 | Roche Diagnostics Gmbh | PROCEDE D'IDENTIFICATION DE proBNP N-TERMINAL |
US6117644A (en) * | 1998-06-04 | 2000-09-12 | Ottawa Heart Institute Research Corporation | Predicting and detecting cardiac allograft rejection |
US6162902A (en) * | 1996-03-04 | 2000-12-19 | Scios Inc. | Human BNP-specific antibodies |
Family Cites Families (6)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
GB9211686D0 (en) * | 1992-06-03 | 1992-07-15 | Medisinsk Innovation A S | Chemical compounds |
KR100563358B1 (ko) * | 1997-09-11 | 2006-03-22 | 시오노기 앤드 컴파니, 리미티드 | 뇌성 나트륨 이뇨 펩티드의 면역 측정법 |
AUPS169202A0 (en) * | 2002-04-11 | 2002-05-16 | Goetze, Jens Peter | Neuropeptide assay |
EP1616181B1 (fr) * | 2003-04-17 | 2009-08-12 | Vermillion, Inc. | Polypeptides lies aux peptides natriuretiques, procedes d'identification et d'utilisation de ces derniers |
DK1625164T3 (da) * | 2003-05-12 | 2011-10-31 | Hoffmann La Roche | Fremgangsmåde til at påvise proBNP med et monoklonalt antistof, som binder til aminosyrerne 42-46 |
DE10355731A1 (de) * | 2003-11-28 | 2005-06-30 | Roche Diagnostics Gmbh | Analytischer Sandwichtest zur Bestimmung von NT-proBNP |
-
2002
- 2002-08-07 FR FR0210063A patent/FR2843396B1/fr not_active Expired - Fee Related
-
2003
- 2003-08-07 CA CA2494140A patent/CA2494140C/fr not_active Expired - Fee Related
- 2003-08-07 WO PCT/FR2003/002483 patent/WO2004014952A2/fr active Application Filing
- 2003-08-07 EP EP03756532A patent/EP1527101B1/fr not_active Expired - Lifetime
- 2003-08-07 JP JP2004526985A patent/JP4576232B2/ja not_active Expired - Fee Related
- 2003-08-07 ES ES03756532T patent/ES2354608T3/es not_active Expired - Lifetime
- 2003-08-07 AT AT03756532T patent/ATE486093T1/de active
- 2003-08-07 DE DE60334696T patent/DE60334696D1/de not_active Expired - Lifetime
- 2003-08-07 US US10/523,400 patent/US7553937B2/en not_active Expired - Fee Related
- 2003-08-07 CN CNB038208385A patent/CN100467489C/zh not_active Expired - Fee Related
- 2003-08-07 AU AU2003282194A patent/AU2003282194B2/en not_active Ceased
- 2003-08-07 RU RU2005106230/13A patent/RU2315773C2/ru not_active IP Right Cessation
Patent Citations (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US6162902A (en) * | 1996-03-04 | 2000-12-19 | Scios Inc. | Human BNP-specific antibodies |
US6117644A (en) * | 1998-06-04 | 2000-09-12 | Ottawa Heart Institute Research Corporation | Predicting and detecting cardiac allograft rejection |
WO2000035951A1 (fr) * | 1998-12-12 | 2000-06-22 | The University Of Leicester | Fragments de peptide natriuretique |
WO2000045176A2 (fr) * | 1999-01-29 | 2000-08-03 | Roche Diagnostics Gmbh | PROCEDE D'IDENTIFICATION DE proBNP N-TERMINAL |
Non-Patent Citations (1)
Title |
---|
GOETZE JENS PETER ET AL: "Quantification of pro-B-type natriuretic peptide and its products in human plasma by use of an analysis independent of precursor processing." CLINICAL CHEMISTRY. UNITED STATES JUL 2002, vol. 48, no. 7, juillet 2002 (2002-07), pages 1035-1042, XP001149219 ISSN: 0009-9147 * |
Cited By (10)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US9481720B2 (en) | 2007-08-03 | 2016-11-01 | Bio-Rad Innovations | BNP(1-32) epitope and antibodies directed against said epitope |
US10495649B2 (en) | 2007-08-03 | 2019-12-03 | Centre National De La Recherche Scientifique (C.N.R.S.) | BNP (1-32) epitope and antibodies directed against said epitope |
US11340239B2 (en) | 2007-08-03 | 2022-05-24 | Bio-Rad Europe Gmbh | BNP (1-32) epitope and antibodies directed against said epitope |
WO2010012509A1 (fr) * | 2008-08-01 | 2010-02-04 | Bio-Rad Pasteur | Procédé pour le diagnostic in vitro d'un accident vasculaire cérébral |
US8524459B2 (en) | 2008-08-01 | 2013-09-03 | Bio-Rad Innovations | Method for the in vitro diagnosis of stroke |
US20120028824A1 (en) * | 2009-01-30 | 2012-02-02 | Electrophoretics Limited | Method for the in vitro diagnosis of stroke |
US8486652B2 (en) * | 2009-01-30 | 2013-07-16 | Bio-Rad Innovations | Method for the in vitro diagnosis of stroke |
AU2009339152B2 (en) * | 2009-01-30 | 2015-11-19 | Bio-Rad Europe Gmbh | Method for the in vitro diagnosis of stroke |
US8407182B1 (en) | 2011-01-21 | 2013-03-26 | Symantec Corporation | Systems and methods for facilitating long-distance live migrations of virtual machines |
US8527990B1 (en) | 2011-04-29 | 2013-09-03 | Symantec Corporation | Systems and methods for migrating virtual machines |
Also Published As
Publication number | Publication date |
---|---|
ATE486093T1 (de) | 2010-11-15 |
AU2003282194B2 (en) | 2008-10-30 |
JP4576232B2 (ja) | 2010-11-04 |
US20070299016A1 (en) | 2007-12-27 |
CN1678635A (zh) | 2005-10-05 |
WO2004014952A3 (fr) | 2004-04-08 |
CA2494140A1 (fr) | 2004-02-19 |
FR2843396A1 (fr) | 2004-02-13 |
RU2315773C2 (ru) | 2008-01-27 |
CA2494140C (fr) | 2011-11-01 |
JP2006514609A (ja) | 2006-05-11 |
CN100467489C (zh) | 2009-03-11 |
RU2005106230A (ru) | 2005-10-10 |
DE60334696D1 (de) | 2010-12-09 |
US7553937B2 (en) | 2009-06-30 |
FR2843396B1 (fr) | 2005-04-15 |
ES2354608T3 (es) | 2011-03-16 |
AU2003282194A1 (en) | 2004-02-25 |
EP1527101A2 (fr) | 2005-05-04 |
EP1527101B1 (fr) | 2010-10-27 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
CA2494140C (fr) | Anticorps specifiques pour le diagnostic de l'insuffisance cardiaque | |
US11340239B2 (en) | BNP (1-32) epitope and antibodies directed against said epitope | |
JP3987284B2 (ja) | N末端proBNPの同定方法 | |
WO1994017197A1 (fr) | ANTICORPS DIRIGE CONTRE LE β-AMYLOIDE OU UN DERIVE DE CE DERNIER ET SON UTILISATION | |
FR2764989A1 (fr) | Procede de dosage du c-peptide | |
EP0466565B1 (fr) | Trousse pour le dosage spécifique de l'angiotensine II | |
JP4374316B2 (ja) | β−アミロイドまたはその誘導体に対する抗体およびその用途 | |
FR2841249A1 (fr) | Compositions et methodes pour le dosage de l'apo b48 et de l'apo b100 | |
EP0709455B1 (fr) | Anticorps monoclonal dirigé contre la glicentine humaine, hybridome produisant l'anticorps cité et méthode d'essai pour glicentine humaine utilisant cet anticorps | |
CN115244080A (zh) | 用于治疗或预防休克的抗肾上腺髓质素(ADM)抗体或抗ADM抗体片段或抗ADM非Ig支架 | |
JP2724315B2 (ja) | α−ANPを認識するモノクローナル抗体およびα−ANPの免疫学的測定法 | |
JP2955082B2 (ja) | ヒトカルシトニンのn末端部分を特異的に認識するモノクローナル抗体 | |
FR2863269A1 (fr) | Peptides specifiques pour le diagnostic de l'insuffisance cardiaque | |
JP3778979B2 (ja) | N−ペプチドのサンドイッチ免疫学的測定法 | |
FR2775690A1 (fr) | Anticorps monoclonal et utilisations pour detecter des antigenes de la proteine core de vhc | |
CA2025942A1 (fr) | Anticorps contre les sequences d'acides amines hautement conservees de substances immunogenes, procede de preparation de ces anticorps et leur utilisation pour des dosages immunologiques | |
JPH0523196A (ja) | ヒトグリセンチンのモノクローナル抗体およびそれを用いるヒトグリセンチンの定量法 | |
WO2024023369A1 (fr) | Anticorps anti-adrénomédulline (adm) ou fragment d'anticorps anti-adm ou échafaudage non-ig anti-adm destiné à être utilisé en thérapie ou prévention du choc | |
JP2008500966A (ja) | ヒト副甲状腺ホルモン(hpth)の環式アナログの検出のための組成物および方法 | |
FR2637184A1 (fr) | Anticorps monoclonal reconnaissant une region pre-s1 de la grande proteine d'enveloppe du virus de l'hepatite b et ses applications, notamment pour le diagnostic in vitro et le traitement de l'hepatite b | |
JPH06335397A (ja) | ビッグエンドセリン−3に対する抗体およびその用途 |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
AK | Designated states |
Kind code of ref document: A2 Designated state(s): AE AG AL AM AT AU AZ BA BB BG BR BY BZ CA CH CN CO CR CU CZ DE DK DM DZ EC EE ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MA MD MG MK MN MW MX MZ NI NO NZ OM PG PH PL PT RO RU SC SD SE SG SK SL SY TJ TM TN TR TT TZ UA UG US UZ VC VN YU ZA ZM ZW |
|
AL | Designated countries for regional patents |
Kind code of ref document: A2 Designated state(s): GH GM KE LS MW MZ SD SL SZ TZ UG ZM ZW AM AZ BY KG KZ MD RU TJ TM AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HU IE IT LU MC NL PT RO SE SI SK TR BF BJ CF CG CI CM GA GN GQ GW ML MR NE SN TD TG |
|
DFPE | Request for preliminary examination filed prior to expiration of 19th month from priority date (pct application filed before 20040101) | ||
121 | Ep: the epo has been informed by wipo that ep was designated in this application | ||
WWE | Wipo information: entry into national phase |
Ref document number: 2003756532 Country of ref document: EP |
|
WWE | Wipo information: entry into national phase |
Ref document number: 2003282194 Country of ref document: AU |
|
WWE | Wipo information: entry into national phase |
Ref document number: 2494140 Country of ref document: CA |
|
WWE | Wipo information: entry into national phase |
Ref document number: 2004526985 Country of ref document: JP |
|
WWE | Wipo information: entry into national phase |
Ref document number: 20038208385 Country of ref document: CN |
|
ENP | Entry into the national phase |
Ref document number: 2005106230 Country of ref document: RU Kind code of ref document: A |
|
WWP | Wipo information: published in national office |
Ref document number: 2003756532 Country of ref document: EP |
|
WWE | Wipo information: entry into national phase |
Ref document number: 10523400 Country of ref document: US |
|
WWP | Wipo information: published in national office |
Ref document number: 10523400 Country of ref document: US |