WO2001072322A2 - Administration parenterale de fortes doses de lactoferrine - Google Patents

Administration parenterale de fortes doses de lactoferrine Download PDF

Info

Publication number
WO2001072322A2
WO2001072322A2 PCT/NL2001/000253 NL0100253W WO0172322A2 WO 2001072322 A2 WO2001072322 A2 WO 2001072322A2 NL 0100253 W NL0100253 W NL 0100253W WO 0172322 A2 WO0172322 A2 WO 0172322A2
Authority
WO
WIPO (PCT)
Prior art keywords
lactoferrin
hlf
fragment
variant
heparin
Prior art date
Application number
PCT/NL2001/000253
Other languages
English (en)
Other versions
WO2001072322A3 (fr
Inventor
Johannes Bernardus Mathias Marie Van Bree
Johannes Henricus Nuijens
Original Assignee
Pharming Intellectual Property B.V.
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Pharming Intellectual Property B.V. filed Critical Pharming Intellectual Property B.V.
Priority to AU44865/01A priority Critical patent/AU4486501A/en
Publication of WO2001072322A2 publication Critical patent/WO2001072322A2/fr
Publication of WO2001072322A3 publication Critical patent/WO2001072322A3/fr

Links

Classifications

    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/40—Transferrins, e.g. lactoferrins, ovotransferrins
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics

Definitions

  • the present invention relates to the production, purification and use of recombinant human lactoferrin for parenteral administration in various therapeutic applications.
  • Lactoferrin is a metal binding glycoprotein of Mr 77,000 found in milk, tears, saliva, bronchial, intestinal, vaginal and other secretions. LF is also present in the secondary granules of neutrophils. Lactoferrin plays an important role in numerous inflammatory and immune response functions such as regulation of monocyte colony stimulating factor synthesis, regulation of interleukin synthesis, activation of natural killer cell activity, inhibition of metastasis, and maturation of T-cells. Lactoferrin also inhibits myelopoiesis, binds to members of the low density lipoprotein receptor family, and blocks the clearance of lipoprotein chylomicron remnant particles (Sanchez, L. et al. (1992) Arch Dis. Child.
  • hLF Human LF
  • This protein displays antimicrobial properties against Gram-positive and Gram-negative bacteria by limiting the availability of environmental iron (Bullen, JJ. (1981) Rev. Infect. Dis. 3:1127).
  • iron-saturated hLF is also able to kill certain bacteria (Ellison, R.T. (1994). Adv. Exp. Med. Biol. 357:71), mechanisms other than iron-depletion apparently are involved in the antibacterial activity of lactoferrin.
  • LF Some of the biological activities of LF may instead arise from its capacity to bind to other molecules. Direct intermolecular interactions between hLF and human lysozyme (hLZ) may explain the synergy between the antibacterial action of these two proteins. Interaction of hLF with bacterial outer membrane components such as lipopolysaccharide (LPS) and porins presumably plays an important role in the antimicrobial activity of hLF. Binding of hLF to the lipid A portion of LPS inhibits the LPS priming of neutrophils for enhanced fMLP-triggered superoxide release. Interaction of LF with heparin may account for the neutralization of the anticoagulant activity of heparin.
  • LPS lipopolysaccharide
  • heparin may account for the neutralization of the anticoagulant activity of heparin.
  • LF binding to specific receptors on monocytes, macrophages and activated lymphocytes results in inhibition of cytokine production.
  • Cells that exhibit specific binding to hLF include liver cells, intestinal cells, mammary gland epithelial cells, monocytic cell lines, activated lymphocytes, and platelets.
  • hLF consists of a polypeptide chain of 692 amino acids.
  • the amino terminal region of hLF contains two clusters of basic residues, RRRR
  • bovine LF (residues 2-5) and RNMRKVR (residues 25-31), whereas bovine LF (bLF) has only one cationic domain (residues 17-42 (Tomita, M. et al. (1991) J Dairy Sci. 74:4137, Hoek, K.S. et al. (1997) Antimicrob. Agents Chemother. 41:54)).
  • the LF polypeptide is folded into two globular lobes, each of which contains an iron-binding cleft.
  • the high affinity of LF for iron confers to the protein certain antibacterial properties and, in addition, may play a role in the absorption of dietary iron by the small intestine.
  • the invention provides methods of treating human patients by parenteral administration of relatively high dosages of lactoferrin.
  • the invention is premised, in part, on results that demonstrate that dosages of at least 60 mg/kg body weight of human lactoferrin can be safety administered to human patients (see Examples). These results are in contrast to the significant side effects reported in references discussed in the Background section.
  • practice of the invention is not dependent on an understanding of mechanism, it is believed that the lack of side effects in the present methods results, in part, from the large amounts of human lactoferrin available to the present inventors through the production of lactoferrin in milk of transgenic cattle, and the consequence ease of purification of pharmaceutical grade lactoferrin for parenteral administration.
  • the ability safely to administer high dosages is advantageous in a number of therapeutic applications.
  • Intact LF and fragments or variants of LF are used at high doses, with a lack of adverse effects, to treat diseases and conditions that require a bolus of and/or sustained large doses.
  • Some diseases and conditions that can be treated are gastroenteritis, Inflammatory Bowel Diseases, sepsis, ARDS, MOF, GVD, GVHD and systemic inflammation.
  • Large doses, in the absence of adverse effects, allow the blocking or neutralizing of inflammatory agents and/or boost the clearance of inflammatory agents.
  • IBD ulcerative colitis and Crohn
  • IBD is known to cause leakage of the gut allowing LPS or other infectious agents to pass through into the blood system.
  • Administering hLF can block these free LPS or other infectious or inflammatory agents and cause them to clear from the body more rapidly and/or to mask their inflammatory activity, thus rendering them harmless.
  • hLF inflammatory agents are cleared more quickly through the liver.
  • hLF assists the passage of antibiotics, thus potentiating their antibacterial effects (see Kuipers et al., Antimicrobial Agents and Chemotherapy 43, 2635-2641).
  • hLF is useful in a variety of therapeutic and prophylactic applications, including use as antimicrobial agents and the treatment of, e.g., inflammation, anemia, myelopoieses and for reducing reperfusion injury, cytokine release, and proteoglycan-mediated entry of virus into cells.
  • LF variants are also useful for treatment of these diseases and conditions, and are especially useful for treatment of those conditions for which beneficial effects of natural LF treatment are due to binding to a high affinity LF receptor.
  • Such LF variants have the biological activities of natural LF, e.g., binding to high affinity LF receptors on cells, but with reduced binding, relative to natural LF, to heparin, DNA, human lysozyme, the Lipid A component of bacterial lipopolysaccharide (LPS), and sulfated cell surface molecules.
  • LPS bacterial lipopolysaccharide
  • an advantage to the use of the LF variants is that the desired physiological effect can be achieved while avoiding side effects caused by the binding of natural LF to heparin, DNA, human lysozyme, Lipid A, or cell surface proteoglycans.
  • the LF variants can be used to deliver nutritional iron to cells, without concurrent neutralization of heparin and similar effects. Because some LF variants have little or no binding to sulfated cell surface molecules, and bind with increased affinity to high affinity LF receptors, more efficient targeting of LF to these receptors can be achieved.
  • variants include short polypeptides having one or more arginines in the N- terminal segment of the polypeptide, such as found in the first cationic domain of hLF, which have been found to exhibit significant therapeutic activity.
  • Other variants of LF have 1-4 arginine residues from the first basic cluster (i.e., residues 2-5) deleted.
  • Some variants include one or more residues from the first cationic domain of hLF, but not amino acids from the second cationic domain.
  • Some polypeptides are quite short, such as less than 27 amino acids in length. Given their short length, such polypeptides are easily and inexpensively prepared and are readily amenable to use in pharmaceutical compositions.
  • polypeptide peptide
  • protein protein
  • amino acid polymers in which one or more amino acids are chemical analogues of a corresponding naturally occurring amino acid.
  • lactoferrin proteins have a modified protein backbone. Examples of such modifications include acetylations, carboxylation, glycosylation modifications and other processing variants of hLF.
  • lactoferrin variants comprise polypeptides having the sequence of natural LF from which 1, 2, 3 or 4 arginine residues at the amino terminus have been removed (i.e., deletion of all or part of the first basic cluster) or from which the residues of the second basic cluster have been removed, or from which both the first and second basic clusters have been removed.
  • Other LF variants have a deletion of the second basic cluster and deletions of one or more ammo-terminal arginine residues.
  • Still other LF variants are hLF from which the residues of the second basic cluster have been mutated (e.g., to uncharged residues).
  • the amino-terminal sequence of hLF is: N'-GRRRSVQWC.
  • Some LF variants include a variant having a deletion of one arginine (along with the terminal glycine) residue (referred to as hLF-2N), a variant having two arginine residues removed (referred to as hLF-3N), a variant having three arginine residues removed (referred to as hLF-4N), and a variant having all four arginine residues removed (referred to as hLF-5N).
  • the arginine residues of the first basic cluster can be removed by proteolysis of natural LF or by expression of a polynucleotide encoding a truncated hLF.
  • one or more arginine residues of the first basic cluster can substituted for by other (i.e., other than arginine) amino acids, e.g. , by directed mutagenesis of a polynucleotide encoding hLF.
  • one or more arginine residues of the first basic cluster are deleted or mutated to an amino acid that is not positively charged at physiological pH, i.e., a neutral or acidic residue, usually to a neutral amino acid, most often alanine, leucine, glycine, valine or isoleucine.
  • reference to a hLF variant from which all or some of the arginine residues the first basic cluster have been "deleted” or “removed” refers both to removal of the arginines of the first basic cluster by deletion or by mutagenesis, unless stated otherwise.
  • Natural lactoferrin includes recombinantly encoded hLF ("rhLF") expressed in a transgenic non-human animal, such as a bovine, where the glycosylation pattern may be distinct from glycosylation patterns of naturally occurring hLF obtained from human milk.
  • Natural hLF includes recombinantly encoded hLF expressed in a transgenic non-human animal, such as a bovine, where the glycosylation pattern may be distinct from glycosylation patterns of naturally occurring hLF obtained from human milk.
  • Neutralized lactoferrin is LF having substantially the sequence of native LF but that, by virtue of modification of the residues of the first basic cluster, is not able to bind to a LF ligand, e.g., heparin, as measured by solid phase ligand binding assay, but still binds 105 kD LF receptor found on Jurkat human lymphoblastic T-cells (Bi et al. (1994) Eur. J. Cell Biol. 65:164 and i et al. (1996) Eur. J. Cell Biol. 69:288).
  • a LF ligand e.g., heparin
  • Modification includes chemical modification of the residues of the first basic cluster or, alternatively, binding of a molecule that blocks (i.e., through steric hinderance) the interaction of the first basic cluster of LF and heparin.
  • Blocking molecules include monoclonal antibodies, fragments thereof, and LF ligands such as human lysozyme or heparin.
  • hLF(l-l 1) refers to residues 1 to 11 inclusively from the N-terminus of hLF; similarly, hLF(2-l 1) refers to residues 2 to 11 inclusively from the N-terminal region of hLF.
  • hLF i.e., the full-length protein
  • hLF _ N where x is the number of N-terminal residues missing.
  • hLF in which the N-terminal glycine and arginine are removed is referred to as hLF "2N ; hLF missing the N-terminal glycine and the two N-te ⁇ ninal arginines, is referred to as hLF “3N , and hLF lacking the N- terminal glycine and first three arginine residues is referred to as hLF "41 " 1 .
  • the three arginines located at the N-terminus i.e., residues 2, 3 and 4 of SEQ ID NO:l
  • Arg 2 , Arg 3 and Arg 4 are referred to as Arg 2 , Arg 3 and Arg 4 , respectively.
  • N-terminal amino acid of hLF refers to Gly 1 (see SEQ ID NO:l); the 31 residues located at the amino- terminus of hLF are: N'-GRRRRSVQWCAVSQPEATKCFQWQRNMRKVR (residues 1-31 of SEQ ID NO: 1).
  • “conservatively modified variations” of a particular amino acid sequence refers to amino acid substitutions of those amino acids that are not critical for protein activity or substitution of amino acids with other amino acids having similar properties (e.g., acidic, basic, positively or negatively charged, polar or non-polar) such that the substitutions of even critical amino acids do not substantially alter activity.
  • Conservative substitution tables providing functionally similar amino acids are well-known in the art. See, e.g., Creighton (1984) Proteins, W.H. Freeman and Company.
  • individual substitutions, deletions or additions, which alter, add or delete a single amino acid or a small percentage of amino acids in an encoded sequence are also “conservatively modified variations.”
  • telomere binding reaction which is determinative of the presence of the protein in the presence of a heterogeneous population of proteins and other biologies.
  • a specified antibody binds preferentially to a particular protein and does not bind in a significant amount to other proteins present in the sample. Specific binding to a protein under such conditions requires an antibody that is selected for its specificity for a particular protein.
  • a molecule such as an antibody that specifically binds to a protein has an association constant of at least 10 6 M “1 or 10 7 M “1 , preferably 10 8 M “1 to 10 9 M “1 , and more preferably, about 10 10 M “1 to 10 11 M “1 or higher.
  • a variety of immunoassay formats can be used to select antibodies specifically immunoreactive with a particular protein.
  • solid- phase ELISA immunoassays are routinely used to select monoclonal antibodies specifically immunoreactive with a protein. See, e.g., Harlow and Lane (1988) Antibodies, A Laboratory Manual, Cold Spring Harbor Publications, New York, for a description of immunoassay formats and conditions that can be used to determine specific immunoreactivity.
  • Intact human lactoferrin its fragments and variants are "substantially free" of other human proteins when at least about 90%, more usually at least about 95%, and most commonly at least about 99% of the human protein present in the sample is the human lactoferrin, fragment or variant.
  • the amount of any specific protein present in a sample can be determined by quantitative SDS-PAGE (for relatively simple mixtures) or by immunological assays (e.g., ELISA and RIA) for more complex mixtures (e.g., a mixture of bovine milk proteins and LF variant).
  • substantially pure means an object species is the predominant species present (i.e., on a molar basis it is more abundant than any other individual species in the composition), and preferably a substantially purified fraction is a composition wherein the object species comprises at least about 50 percent (on a molar basis) of all macromolecular species present. Generally, a substantially pure composition comprises more than about 80 to 90 percent, and preferably 95%, 99%, 99.5% or 99.9% of all macromolecular species present in the composition. Most preferably, the object species is purified to essential homogeneity (contaminant species cannot be detected in the composition by conventional detection methods) wherein the composition consists essentially of a single macromolecular species.
  • patient includes human and veterinary subjects.
  • LF is abundant in milk and is most easily purified from this source, although it is also found in exocrine secretions and secondary granules of neutrophils.
  • a preferred source of hLF is milk from a transgenic bovine species containing a hLF transgene (see section III, C).
  • the transgene-encoded hLF is substantially purified from other milk proteins in the milk of transgenic cows, and is preferably substantially isolated from endogenous bovine LF, if present in the milk. Numerous methods for purification of hLF from milk have been reported. See, for example, U.S. Patents 4,436, 658; 4,791,193; and 4,668,771, which are incorporated herein by reference. See also, Nuijens et al.
  • milk or a milk fraction containing hLF is contacted with a strong cation exchange resin (e.g., S SepharoseTM) in the presence of relatively high ionic strength (0.2M to 0.5M NaCl or KCl, preferably 0.4M NaCl or KCl) to prevent binding of non-LF proteins and other substances to the strong cation exchange resin and to reduce electrostatic interactions of LF with other proteins (e.g., caseins) or substances (e.g., lipopolysaccharide), and to liberate LF from complexes.
  • a strong cation exchange resin e.g., S SepharoseTM
  • relatively high ionic strength 0.2M to 0.5M NaCl or KCl, preferably 0.4M NaCl or KCl
  • the strong cation exchange resin containing the bound LF is separated from the unbound compounds in the milk or milk fraction, typically by centrifugation or sedimentation followed by batchwise washing and/or by pouring the resin into a column and washing the beads with buffer having approximately equal or lower salt concentration.
  • the LF bound to the cation exchange resin is eluted with an aqueous, typically buffered, NaCl or KCl gradient (e.g., linear gradient of 0-1M NaCl in 20 mM sodium phosphate, pH 7.5) or by batch elution or stepwise elution with an aqueous, preferably buffered, NaCl or KCl solution of 0.4M or greater, preferably at least 0.5M NaCl or KCl.
  • hLF can be substantially purified from bovine milk and substantially separated from bovine LF by an efficient method.
  • hLF e.g., rhLF
  • hLF can be further purified from endogenous LF (e.g., bLF) by the additional subsequent step of rechromatography on a strong cation exchanger, such as S SepharoseTM Fast Flow, with salt gradient or stepwise elution to separate hLF from remaining traces of endogenous non-human LF species (e.g., bLF), and/or can optionally include affinity chromatography with a concanavalin A resin to further separate hLF from bLF, with bLF being more strongly bound to the Con A resin than hLF.
  • a strong cation exchanger such as S SepharoseTM Fast Flow
  • a modified and improved procedure for the purification of hLF from milk is described in the Example under (II) Methods. Briefly, milk or a milk fraction, preferably skimmed milk, is contacted with a strong cation exchanger, preferably S Sepharose.
  • the strong cation exchange resin containing the bound LF is washed with a buffer containing at least about 0.1 M salt, preferably NaCl, and then washed with a buffer containing at least about 0.4 M salt, preferably NaCl.
  • the bound LF is eluted from the strong cation exchanger using a buffer containing at least 1.0 M salt, preferably NaCl, and concentrated and desalted to about 0.1 M of the salt.
  • the LF preparation is further microfiltrated and subjected to virus inactivation by adding a non- ionic surfactant, such as Tween 80 (at about 1% w/v), and a di- or trialkylphosphate, such as tri-n-butyl phosphate (at about 0.3% w/v), and incubating for at least 10 hours at a temperature between 15°C and 30°C, preferably about 25 ⁇ 1°C.
  • the (virus inactivated) LF sample is then loaded onto a Q Sepharose column serially connected with a Macroprep High S Support (MPHS, Biorad) column, both equilibrated in a buffer with about 0.1 M salt, preferably NaCl.
  • MPHS Macroprep High S Support
  • the columns are washed with a buffer containing 0.1 M salt, preferably NaCl.
  • the Q Sepharose column is then disconnected and the MPHS column is washed extensively with low salt buffer (e.g. 20mM sodium phosphate at pH 7.5).
  • the MPHS column is stepwise eluted with first a buffer with about 0.4 M salt and then with a buffer with at least 0.5 M salt, preferably NaCl.
  • Eluted fractions are tested for hLF (e.g., rhLF) content and endogenous LF (e.g. bLF) impurity.
  • hLF e.g., rhLF
  • endogenous LF e.g. bLF
  • rhLF fractions free of endogenous LF are pooled, concentrated, filtered over a 15 nm filter, concentrated, buffer exchanged to saline (0.9% NaCl), sterile filtrated (0.1 ⁇ m) and stored at ⁇ -65°C.
  • Some methods employ various polypeptides which include at least one or more arginines from the first cationic domain of hLF (residues 2-5 of SEQ ID NO:l), but which exclude the residues which make up the second cationic domain (residues 28-31 of SEQ ID NO:l).
  • some polypeptides comprise at least 6 but no more than 27 contiguous amino acids from the N-terminal segment of hLF (SEQ ID NO:l), wherein the N- terminus of the polypeptide is residue 1 of SEQ ID NO:l, i.e., glycine.
  • Some methods employ polypeptides that include the first cationic domain but not the second cationic domain of hLF, and that also lack one or more residues from the N- terminus of hLF.
  • some methods of the invention use polypeptides comprising at least 6 amino acids but no more than 26 contiguous amino acids from hLF, wherein the N-terminus of the polypeptide is Arg 2 (for example, a hLF fragment lacking Gly ).
  • Some methods use polypeptides comprising at least 6 but no more than 25 contiguous amino acids from the N-terminal segment of hLF, wherein the N-terminus of the polypeptide is Arg 3 (for example, a hLF fragment lacking Gly 1 Arg 2 ).
  • the hLF polypeptide fragments just described are chosen so that cysteine residue 10 (see SEQ ID NO:l) is retained.
  • the polypeptide includes a cysteine at approximately the same location in the sequence.
  • Such a cysteine can be used to dimerize one fragment with another polypeptide having a cysteine residue, such as another hLF fragment, for example.
  • dimerization can increase the activity of the polypeptide.
  • Some fragments include more than 6 contiguous amino acids from the N-terminus of hLF.
  • some polypeptides include 7, 8, 9, 10, 11 or 12 contiguous amino acids from hLF, for example.
  • Some polypeptides include fewer than 27, 26 or 25 contiguous amino acids of hLF.
  • Some polypeptides include less than 24, 22, 20, 18, 16, 14 or 12 contiguous amino acids from hLF, or any number of amino acids therebetween.
  • Some polypeptides include no more than 19 contiguous amino acids from hLF.
  • Some polypeptides include no more than 11 contiguous amino acids from hLF, for example, hLF(l-l 1), hLF(2-l 1) and hLF(3-l 1).
  • lactoferrin Some fragments of lactoferrin contain at least residues 1-90 of lactoferrin (designated N-terminal domain I). This domain has been show to bind specifically to phytohemagglutinin-stimulated peripheral blood human lymphocyte receptors (see Rochard et al., Fed. Eur. Biochem. Soc. 1, 201-204 (1989). Some fragments contain at least residues 1-47. Such fragments have been reported to show bactericial activity (see Kiwata et al., Biochem. Biophys. Res. Commun. 245, 764-3 (1998)).
  • -- LF variants lacking one or more of the amino terminal arginine residues can be produced by a variety of methods. Preferred methods of production include (a) proteolytic cleavage of natural LF, (b) synthesis, or (c) recombinant expression, e.g., mutagenesis of a LF gene followed by expression in cells or transgenic animals of the LF variant, with recombinant expression most preferred. Deletion of the residues of the second basic cluster is preferably carried out by in vitro mutagenesis.
  • Proteolysis LF variants can be produced by cleavage of purified LF with a protease, preferably a serine protease and most preferably trypsin. ⁇
  • the tryptic digestion of purified natural LF can be carried out as follows: Five milligrams of native hLF are incubated with trypsin at an enzyme: substrate molar ratio of 1 :8 at 37°C in PBS. Digestion is stopped after 1, 5, 25 min and 3 h by the addition of a 12-fold molar excess of SBTI and N-terminal integrity is monitored, for example by analytical Mono S chromatography (Van Berkel et al. (1995) Biochem. J. 312:107) and standard techniques such as SDS-PAGE, chromatography, and protein sequencing.
  • the LF variants can be separated from each other and from natural (i.e., uncleaved) hLF (and other proteins, if present) by cationic exchange chromatography (e.g., Mono S; heparin), Hydrophobic Interaction Chromatography (HIC) or Cibracon Blue Sepharose chromatography.
  • LF variants can be separated from uncleaved LF (and each other) by batch- wise incubation of recombinantly expressed LF or LF variants and S Sepharose for 4 h. The mixture is poured into a column and the LF eluted with 20 mM sodium phosphate, 0.5 M NaCl, pH 7.5.
  • the S Sepharose eluate is diluted in 20 mM sodium phosphate, pH 7.5 (buffer A), applied on a Mono S HR 5/5 cation exchange column and eluted with a linear salt gradient of 0 to 0.5 M NaCl in 60 ml of buffer A at a flow rate of 0.5 ml min.
  • Natural hLF elutes at 0.7 M NaCl (Van Berkel et al. (1995) Biochem. J. 312:107) and hLF-5N elutes at about 0.33 M NaCl.
  • the hLF-3N and hLF-2N species elute from Mono S at about 0.5 and about 0.6 M NaCl, respectively.
  • Certain polypeptides used in the present methods can also be prepared via a reduction and proteolysis method.
  • This approach begins with pepsin digestion of hLF according to known methods (see, e.g., Bellamy, W. et al, (1992) Biochim. Biophys. Ada. 1121:130; and Tomita, M. et al, (1991) J. Dairy Sci. 74:4137).
  • the digested products are subsequently reduced and alkylated using standard reagents (e.g.
  • hLF variants can be obtained by proteolytic cleavage of purified intact hLF using one or more proteases, such as bromelain, cathepsin B, cathepsin D, cathepsin G, chymotrypsin, clostripain, elastase, endoproteinase-Arg-C, endoproteinase-Asp-N, endoproteinase-Glu-C, endoproteinase-Lys-C, Factor Xa, papain, pepsin, proteinase K, subtilisin, thermolysin and trypsin.
  • proteases such as bromelain, cathepsin B, cathepsin D, cathepsin G, chymotrypsin, clostripain, elastase, endoproteinase-Arg-C, endoproteinase-Asp-N, endoproteinase-Glu-C, end
  • lactoferrin can also be converted to fragments by a variety of mechanisms in vivo.
  • lactoferrin can be degraded by release of elastase (a serine protease) as a result of neutrophil degranulation (Nuijens et al., J. Lab. Clin. Med. 119, 159-168 (1992).
  • Lactoferrin can also be degraded by bacterial derived protease (see Britigan et al., J. Clin. Invest. 88, 1092-102 (1991), by membrane bound proteases (see Birgens et al. Eur. J. Haematol.
  • Such fragments can be produced in vitro by vitro proteolytic cleavage of intact hLF, using one or more of the above-mentioned commercially available endoproteases.
  • the in vitro produced hLF derived peptides are purified using conventional means before formulating as a pharmaceutical composition for administration..
  • lactoferrin and fragments and variants thereof can be prepared using recombinant techniques in which a nucleotide sequence encoding the polypeptide of interest is expressed in cultured cells such as described in Ausubel et al. , Current Protocols in Molecular Biology, Greene Publishing and Wiley-Interscience, New York (1987) and in Sambrook et al. , Molecular Cloning - A Laboratory Manual, 2nd ed., vols. 1-3, Cold Spring Harbor Laboratory, Cold Spring Harbor, New York (1989) both of which are incorporated herein by reference in their entirety. Also see, Kunkel (1985) Proc. Natl. Acad. Sci. 82:488 (describing site directed mutagenesis) and Roberts et al. (1987) Nature 328:731-734 or Wells, J.A., et al. (1985) Gene 34:315 (describing cassette mutagenesis).
  • nucleic acids encoding the desired polypeptides are used in expression vectors.
  • expression vector generally refers to nucleotide sequences that are capable of affecting expression of a gene in hosts compatible with such sequences. These expression vectors typically include at least suitable promoter sequences and optionally, transcription termination signals. Additional factors necessary or helpful in effecting expression can also be used as described herein.
  • DNA encoding a polypeptide is incorporated into DNA constructs capable of introduction into and expression in an in vitro cell culture. Specifically, DNA constructs are suitable for replication in a prokaryotic host, such as bacteria, e.g., E. coli, or can be introduced into a cultured mammalian, plant, insect, e.g., Sf9, yeast, fungi or other eukaryotic cell lines.
  • DNA constructs prepared for introduction into a particular host typically include a replication system recognized by the host, the intended DNA segment encoding the desired polypeptide, and transcriptional and translational initiation and termination regulatory sequences operably linked to the polypeptide encoding segment.
  • a DNA segment is "operably linked" when it is placed into a functional relationship with another DNA segment.
  • a promoter or enhancer is operably linked to a coding sequence if it stimulates the transcription of the sequence.
  • DNA for a signal sequence is operably linked to DNA encoding a polypeptide if it is expressed as a preprotein that participates in the secretion of the polypeptide.
  • DNA sequences that are operably linked are contiguous, and, in the case of a signal sequence, both contiguous and in reading phase.
  • enhancers need not be contiguous with the coding sequences whose transcription they control. Linking is accomplished by ligation at convenient restriction sites or at adapters or linkers inserted in lieu thereof.
  • the selection of an appropriate promoter sequence generally depends upon the host cell selected for the expression of the DNA segment. Examples of suitable promoter sequences include prokaryotic, and eukaryotic promoters well-known in the art. See, e.g., Sambrook et al, Molecular Cloning: A Laboratory Manual (2d ed.), vols. 1-3, Cold Spring Harbor Laboratory (1989).
  • the transcriptional regulatory sequences typically include a heterologous enhancer or promoter which is recognized by the host.
  • the selection of an appropriate promoter depends upon the host, but promoters such as the trp, lac and phage promoters, tRNA promoters and glycolytic enzyme promoters are known and available. See Sambrook et al, supra.
  • Expression vectors include the replication system and transcriptional and translational regulatory sequences together with the insertion site for the polypeptide encoding segment can be employed. Examples of workable combinations of cell lines and expression vectors are described in Sambrook et al, supra, and in Metzger et al. (1988) Nature 334:31-36.
  • suitable expression vectors can be expressed in, e.g., insect cells, e.g., Sf9 cells, mammalian cells, e.g., CHO cells and bacterial cells, e.g., E. coli.
  • insect cells e.g., Sf9 cells
  • mammalian cells e.g., CHO cells
  • bacterial cells e.g., E. coli.
  • mutant proteins are described generally in
  • polypeptides Another method for preparing polypeptides is to employ an in vitro transcription/translation system. DNA encoding a polypeptide is cloned into an expression vector as described supra. The expression vector is then transcribed and translated in vitro. The translation product can be used directly or first purified. Polypeptides resulting from in vitro translation typically do not contain the post- translation modifications present on polypeptides synthesized in vivo. Methods for synthesis of polypeptides by in vitro translation are described by, for example, Berger & Kimmel, Methods in Enzymology, Volume 152, Guide to Molecular Cloning Techniques, Academic Press, Inc., San Diego, CA, 1987 (incorporated herein by reference in its entirety).
  • hLF or hLF polypeptides or variants are produced by expression in transgenic animals (i.e., non-human animals containing an exogenous DNA sequence in the genome of germ-line and somatic cells introduced by way of human intervention) such as bovines, goats, rabbits, sheep, pigs or mice.
  • transgenic animals i.e., non-human animals containing an exogenous DNA sequence in the genome of germ-line and somatic cells introduced by way of human intervention
  • transgenic animals i.e., non-human animals containing an exogenous DNA sequence in the genome of germ-line and somatic cells introduced by way of human intervention
  • transgenic animals i.e., non-human animals containing an exogenous DNA sequence in the genome of germ-line and somatic cells introduced by way of human intervention
  • bovines, goats, rabbits, sheep, pigs or mice such as bovines, goats, rabbits, sheep, pigs or mice.
  • transgenic animals are incorporated herein by reference in their entirety, as well as in PCT publications PCT/US93/05724 and PCT/US95/09580, both of which are incorporated herein by reference in their entirety.
  • An advantage of the transgenic animals is the isolation of hLF, variants and polypeptides of interest in large amounts, especially by economical purification methods.
  • transgenic bovine species containing a transgene encoding a human LF polypeptide targeted for expression in mammary secreting cells is described in WO 91/08216, incorporated herein by reference in its entirety.
  • LF variants When LF variants are produced in transgenic bovines the human protein typically is separated from the bovine milk proteins (e.g., whey proteins, caseins, bovine LF, IgA, albumin, lysozyme, ⁇ -lactoglobulin) before use (e.g., administration to patients).
  • bovine milk proteins e.g., whey proteins, caseins, bovine LF, IgA, albumin, lysozyme, ⁇ -lactoglobulin
  • use can be made of whole or partially purified bovine milk containing the desired hLF protein, variant or polypeptide.
  • deletion of the residues in the first or second basic cluster of hLF is a preferred method for generating a hLF with changed physiological properties
  • other methods for neutralizing one or both basic clusters exist.
  • the first basic cluster can be neutralized by incubating hLF with ligands such as heparin, which binds at the first cluster and inhibits binding of LF to the 105kd LF receptor, LPS, hLZ, and other molecule for which binding is first-cluster dependent.
  • a preferred method for neutralizing the first basic cluster is to incubate hLF with a monoclonal antibody that binds at the amino terminus and prevents binding between the first basic cluster and a target molecule (e.g., heparin).
  • a target molecule e.g., heparin.
  • Methods for producing monoclonal antibodies are well known (see, e.g., Goding et al, Monoclonal Antibodies: Principles and Practice (2d ed.) Acad. Press, N. Y., and Harlow and Lane, Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory, New York , 1988).
  • Use of human or humanized monoclonal antibodies are most preferred because this reduces the possibility ofan antigenic response following administration to a patient (see e.g., U.S.
  • Patent Nos. 5,569,825 and 5,585,089) Antigen-binding fragments of monoclonal antibodies, e.g., Fab, Fab' F(ab')2, Fabc and Fv fragments, are similarly useful. Antibodies or antibody fragments can also be used for binding to the second basic cluster and preventing second-cluster dependent binding.
  • Natural hLF binds to heparin, Lipid A, DNA and hLZ.
  • LF variants lacking one, two or three arginines of the first basic cluster show a strong decrease in reactivity for each of these four ligands, and binding is undetectable in standard assays (e.g., solid phase ligand binding assays) when all four of the amino-terminal arginine residues are deleted.
  • standard assays e.g., solid phase ligand binding assays
  • the binding properties of natural LF and the LF variants can be measured in standard binding assays (see next section) and expressed in terms of reactivity where the level of binding of natural LF to a ligand is defined as 100% reactivity.
  • the reactivity of the LF variants with the natural LF ligands heparin, DNA, Lipid A and hLZ is typically less than 80%, more usually less than 60%, often less than 15%.
  • LF variants e.g., those with a deletion of all four arginine residues from the first basic cluster
  • reactivity is undetectable.
  • Assays suitable for measuring ligand-receptor interactions include assays solid-phase ligand binding assays and competitive solid-phase binding assays (see, e.g., Mann et al. (1994) J. Biol. Chem. 269:23661-67).
  • the solid-phase binding assays 1 measure binding by LF variants and natural LF.
  • binding of the LF receptor by hLF or a hLF variant results in activation of the LF receptor.
  • LF binds to cell surfaces through two classes of LF binding sites: relatively low affinity sites which are cell surface sulfated molecules (e.g., cell surface proteoglycans or glycosaminoglycans) and high affinity receptors. Binding to the low affinity sites is mediated by the first cluster of basic arginine residues, and deletion (or neutralization) of one or more of these residues reduces or eliminates binding to the low affinity sites.
  • an hLF variant typically binds a high affinity LF receptor with an affinity of at least about 10 nM, usually between about 10 nM and about 40 nM.
  • Cell binding assays are well known and are described in, e.g., Mazurier (1989) Eur. J. Biochem. 179:481-87.
  • deletion of one or more of the amino-terminal arginine residues does not reduce or abolish binding to the high affinity LF receptor.
  • High affinity LF binding sites have been found on activated lymphocytes, mammary gland epithelial cells, platelets, monocytes, macrophages, intestinal cells, and hepatocytes and are thought to exist on other cell types as well.
  • a 105 kD specific hLF receptor has been characterized in activated lymphocytes (Mazurier et al. (1989) Eur. J. Biochem. 179, 481-487), the Jurkat T-cell line (Bi et al. (1994) Eur. J. Cell Biol. 65, 164- lll; Bi et al. (1996) Eur. J. Cell Biol. 69, 288-296) and platelets (Leveugle et al. (1993) Eur. J. Biochem., 213, 1205-1211).
  • Binding of LF to the 105 kD receptor has been shown to inhibit platelet aggregation and is likely involved in the growth factor and/or differentiation activities of hLF.
  • This receptor has been localized in human lymphoblastic T-cells (i.e., Jurkat cells, Pawelec et /.(1982) Eur. J. Immuno. 12:387-92) to the cell surface in coated pits vesicles as well as in intracellular vesicles. Internalization of hLF by Jurkat cells has been demonstrated.
  • Jurkat cells can be obtained from the American Tissue Type Collection American Type Culture Collection [ATCC] located at 12301 Parklawn Dr., Rockville, Maryland, USA 20852.
  • LF binds to the lymphocyte (Jurkat cell) high affinity receptor with a kD of approximately 40 nM.
  • the 105 kD receptor can be identified by immunological methods. For example, a specific rabbit anti-105 kD receptor polyclonal antibody has been described. This, or a similar polyclonal antibody, or an anti-105 kD receptor monoclonal antibody, can be used to identify the receptor on other cell types.
  • the polyclonal antibody referred to supra has been found to bind to epithelial cells from non-malignant human breast, benign mastopathies and breast carcinomas (Rochard et al. (1992) Anticancer Research 12: 2047-52).
  • the 105 kD receptor can be identified by ligand blotting (see, e.g., Ausubel et al, Current Protocols in Molecular Biology, Greene Publishing and Wiley-Interscience, New York) using labeled hLF (or amino-terminally deleted hLF) and membrane protein preparations of cells.
  • ligand blotting see, e.g., Ausubel et al, Current Protocols in Molecular Biology, Greene Publishing and Wiley-Interscience, New York
  • labeled hLF or amino-terminally deleted hLF
  • LF hLF receptor
  • Mr Mr of 110
  • LRP Low density lipoprotein Receptor-related Protein
  • LF binding to murine peritoneal macrophages apparently occurs via the LRP, a member of the structurally related cell surface receptor family that mediates endocytosis of lipoproteins and other plasma proteins.
  • LRP a member of the structurally related cell surface receptor family that mediates endocytosis of lipoproteins and other plasma proteins.
  • the nature of hLF binding to monocytes and macrophages is incompletely characterized, although it is appears to be mediated, at least in part, a member of the LRP/chylomicron remnant receptor (Misra et al. (1994) J. Biol. Chem. 269:18303-306).
  • lactoferrin or a pharmaceutical composition containing the same can be used in a variety of therapeutic and prophylactic applications.
  • lactoferrin, and the fragments and variants thereof as described herein may be used in the preparation of medicaments, such as the pharmaceutical compositions described herein, for the treatment and/or prophylaxis of the indications described herein.
  • the methods are useful in treating various microbial infections such as bacterial infections.
  • the methods are also useful in providing anti-inflammatory, anti-viral and anti-infective activities, as well a pro- and anti-coagulant effects, modulation of complement activation, inhibition of LPS mediated activation of neutrophils, regulation of transcription, growth promotion of intestinal epithelial cells, inhibition of hydroxyl-radical formation, and a role in intestinal iron uptake and excretion.
  • Other properties and biological activities of LF are described in Nuijens et al. (1996) J Mammary Gland Biology and Neoplasia 1 :3, 283-293, which is incorporated herein by reference in its entirety and for all purposes.
  • hLF variants and neutralized LF have generally the same activities and uses as natural LF, except that deletion of the arginines of the first basic cluster results in reduction in binding to heparin, Lipid A, DNA, lysozyme, and cell surface sulfated molecules.
  • some LF fragments can be administered to a patient to effect certain LF-mediated physiological changes (e.g., regulation of cytokines) without causing other physiological consequences of LF administration (e.g., neutralization of heparin by binding).
  • Some lactoferrin fragments have various activities associated with the first cationic cluster of hLF.
  • Such polypeptides are especially useful in selectively triggering responses involving the first cationic domain while avoiding the activation of responses associated with the binding of the second cationic domain and/or activities related to the iron binding activities of hLF.
  • the neutralized hLF and hLF variants have a variety of advantageous properties.
  • hLF variants lacking the first basic cluster are particularly useful for initiating hLF-receptor-mediated immune and inflammatory responses (e.g. , reducing cytokine release, activation of natural killer cells, and anti-tumor effects), efficient receptor mediated delivery of nutritional iron, and other biological effects.
  • Some lactoferrin fragments can bind and neutralize heparin and LPS, lipid A, and DNA and hLZ. Some lactoferrin fragments can also bind to various target cells.
  • LF binds to cell surfaces through two classes of LF binding sites: relatively low affinity sites which are cell surface sulfated molecules (e.g., cell surface proteoglycans or glycosaminoglycans) and high affinity receptors. Since binding of LF to the low affinity sites involves the first cationic domain, some lactoferrin fragments can selectively bind to the low affinity sites without activating the LF high affinity receptors.
  • lactoferrin fragments are useful in neutralizing heparin or LPS without activating the LF high affinity receptor.
  • Some lactoferrin fragments can neutralize the anticoagulant activity of heparin (including low molecular weight heparin). By neutralizing bacterial LPSs, some lactoferrin fragments can reduce the inflammatory response associated with these compounds.
  • Such lactoferrin fragments are also used to inhibit viral entry into cells. Cell binding assays are well-known and are described in, e.g., Mazurier (1989) Eur. J. Biochem. 179:481-87.
  • Cells with which lactoferrin, its fragments and variants can interact with include, intestinal cells (Hu et al. (1990) Biochemistry 29:535-541; Kawakam et al. (1991) Am. J. Physiol. 261 :G841-G846; Mikoga i et al. (1994) Am. J. Physiol. 267:G308-G31), mammary gland epithelial cells (Rochard et al. (1992) Anticancer Res. 1 :2047-2052), hepatocytes (Regoeczi et al. (1985) Am. J. Physiol. 248:G8-G14; MacAbee et al. (1991) J Biol. Chem.
  • Intact lactoferrin and certain fragments and variants can also be used to inhibit entry into a cell of viruses, for example, cytomegalovirus (CMV), human immunodeficiency viruses (HIV) or herpes simplex virus 1 (HSV1) viruses.
  • CMV cytomegalovirus
  • HSV human immunodeficiency viruses
  • HSV1 herpes simplex virus 1
  • the antiviral action is thought to be mediated by interaction of hLF with cell surface proteoglycans (e.g., heparin) employed by viral particles for cell entry, and or by the stimulation of natural killer cells.
  • Therapeutic indications include use in therapy or prophylaxis of infection, including local infection, large scale (bacterial) infection, blood-borne infection (sepsis), as well as inflammation resulting from an infection or non-infectious inflammatory diseases (e.g., chronic inflammatory disease of the ileum or colon).
  • the compositions can also be used to prepare or treat organ transplant recipients or other immunosuppressed individuals (e.g., AIDS patients) against the effects of infections.
  • the pharmaceutical compositions are effective in treating a variety of microbial infections, such as various viral and bacterial infections.
  • the compositions are effective in treating Gram-negative and Gram-positive bacteria.
  • pathogenic bacteria causing infections treatable by methods of the invention include: Listeria, Escherichia, chlamydia, rickettsial bacteria, mycobacteria, staphylococci, streptocci, pneumonococci, meningococci and conococci, Klebsiella, proteus, serratia, pseudomonas, Legionella, diphtheria, salmonella, bacilli, cholera, tetanus, botulism, anthrax, plague, leptospirosis, and Lymes disease bacteria.
  • pathogenic viruses causing infections treatable by methods of the invention include: hepatitis (A, B, or C), herpes virus (e.g., VZV, HSV-I, HAV-6, HSV- II, " and CMV, Epstein Barr virus), adenovirus, influenza virus, flaviviruses, echovirus, rhinovirus, coxsackie virus, coronavirus, respiratory syncytial virus (RSV), mumps virus, rotavirus, measles virus, rubella virus, parvovirus, vaccinia virus, HTLV virus, dengue virus, papillomavirus, molluscum virus, poliovirus, rabies virus, JC virus, arboviral encephalitis virus, and human immunodeficiency virus (HIV virus; e.g.
  • pathogenic fungi causing infections treatable by methods of the invention include: Candida (e.g., albicans, krusei, glabrata, tropicalis), Cryptococcus neoformans, Aspergillus (e.g., fumigatus, niger), Genus Mucorales (Mucor, Absidia, Rhizopus), Sporothrix schenkii, Blastomyces dermatitidis, Paracoccidioides brasiliensis, Coccidioides immitis and Histoplasma capsulatum.
  • Candida e.g., albicans, krusei, glabrata, tropicalis
  • Cryptococcus neoformans e.g., Aspergillus (e.g., fumigatus, niger), Genus Mucorales (Mucor, Absidia, Rhizopus), Sporothrix schenkii, Blastomyces dermatitidis, Paracoccidioides brasiliensis,
  • pathogenic parasites causing infections treatable by methods of the invention include: Entamoeba histolytica, Balantidium coli, Naegleria, Fowleri, Acanthamoeba sp., Giardia lambia, Cryptosporidium sp., Pneumocystis carinii, Plasmodium vivax, Babesia microti, Trypanosoma brucei, Trypanosoma cruzi, Leishmania donovani, Toxoplasma gondii and Plasmodium falciparis.
  • Lactoferrin is particularly useful for the treatment of inflammatory diseases. This can occur, as noted above, through neutralization of bacterial LPSs (see also Lee et al., Infect. Immun 66, 1421-6 (1998), as well as through a reduction in cytokine production and neutrophil degranulation.
  • the invention provides methods in which hLF or an LF variant is administered to a patient to reduce inflammation, for example in chronic inflammatory bowel disease (e.g., Crohn's disease and ulcerative colitis).
  • Administration of hLF and hLF variants is useful for reducing reperfusion injury in a patient after myocardial infarction.
  • hLF can be administered to neutralize bacterial LPS. The LPS binds through the first basic cluster, and is cleared from circulation via the second basic cluster.
  • the invention also provides methods in which lactoferrin is administered to a patient to inhibit myelopoieses and reduce production of GM-CSF.
  • Intact hLF, hLF variants and neutralized hLF are also useful for reducing or inhibiting release of a cytokine, such as IL-1, IL-2 or TNF-alpha, from LF-receptor bearing cells in a patient, by administering LF or a LF variant.
  • LF has been shown to reduce the release of cytokines, e.g., IL-1, IL-2, and TNF-alpha from cells, and inhibit proliferation in mixed lymphocyte cultures (Chierici et al (1994) Ada Pediatr Suppl 402:83-89).
  • a reagent can be said to reduce or inhibit release of a cytokine from a cell when the level of cytokine release in the presence of the reagent is less than about 90%, more often less than about 70%, and most often less than about 50% of the levels released in the absence of the reagent under the conditions of the assay.
  • Intact lactoferrin, fragments and variants thereof can be administered to a patient to reduce TNF-alpha-mediated neutrophil degranulation.
  • Neutrophils have been implicated as important mediators in both generalized and local inflammatory reactions, including sepsis, rheumatoid arthritis and ulcerative colitis.
  • clinical studies using anti-TNF monoclonal antibodies indicate that TNF, and likely the TNF-mediated activation of neutrophils, plays an important role in the pathophysiology of rheumatoid arthritis and ulcerative colitis.
  • Intact lactoferrin, fragments and variants thereof are useful for stimulating natural killer (NK) cells in the patient.
  • NK natural killer
  • the LF variants are useful for combating the targets of NK cells, e.g., tumors, viruses and intracellular pathogens. Stimulation of natural killer (NK) cells by LF has been shown in vitro (Shau et al. , 1992, J. Leukoc. Biol. 51 :343-349) and in vivo (Bezault et /., 1994, Cancer Res. 54:2310-2312).
  • NK cells can be stimulated in a patient by administering to the patient a composition comprising a hLF variant and a pharmaceutical excipient.
  • hLF and LF variants can also be administered to a patient to inhibit growth of a solid tumor.
  • a single intraperitoneal injection of LF inhibited growth of solid tumors induced by subcutaneous injection of syngeneic fibroblast-derived tumor cell lines in mice (Bezault et al, supra). LF variants are thus useful for stimulation of NK cells without neutralization of heparin or other undesirable effects.
  • intact lactoferrin, fragments and variants thereof are used to deliver iron to an LF-receptor-bearing cell in a patient by administering to the patient a composition of hLF or a LF fragment or variant which is at least about 95% saturated with iron.
  • Administration of these compounds are beneficial, for example, in treatment of anemia or iron storage diseases.
  • LF- or LF-variant bound iron is delivered to a cell when the polypeptide-iron complex binds to a cell receptor and is internalized by the cell.
  • the compositions disclosed herein are suitable for use in baby formula as well as for administration to patients with disturbances in iron metabolism (e.g. , ferriprive anemia and iron storage diseases, and iron deficiency anemia of premature infants).
  • LF variants can be saturated with iron following the procedure described in van Berkel et al. , 1995, Biochem J. 312, 107-114.
  • a LF variant is at least 3% saturated with iron, more usually 80% saturated, most often at least 95% saturated and often more than 99% saturated.
  • LF variants lacking the first basic cluster, or both the first and second basic clusters are particularly useful when the iron binding activities of LF are desired and when the activities mediated by basic clusters 1 and 2 (e.g., heparin binding, high affinity receptor interaction) are not desired.
  • Intact lactoferrin, fragments and variants can be used as pharmaceutical, food additives, nutritional supplements, and the like.
  • Such pharmaceutical compositions are usually administered parenterally, preferably intravenously.
  • Intradermal, topical, enteral or intramuscular administration is also possible in some circumstances.
  • Oral administration can also be used, optionally but not necessarily, in conjunction with parenteral administration.
  • compositions containing the compounds can be administered for prophylactic and/or therapeutic treatments.
  • compositions are administered to a patient already suffering from a disease, as described above, in an amount sufficient to cure or at least partially arrest the symptoms of the disease and its complications, particularly symptoms associated with a microbial infection, or otherwise prevent, hinder, retard, or reverse the progression of disease or infection or any other undesirable symptoms in any way whatsoever.
  • An amount adequate to accomplish this is defined as "therapeutically effective amount or dose.”
  • Such effective dosage depends on the nature and severity of the disease or condition, and on the general state of the patient's health, but is usually be between 10 and 100 mg of intact human lactoferrin per kilogram of body weight.
  • the dosage is at least 20, 30, 40, 50, or 60 mg/kg for intact lactoferrin. Fragments or variants having different molecular weights than intact lactoferrin can be administered in equimolar ratio to the above dosages or can be administered in higher dosages up to the mg/kg dosage given for intact lactoferrin. Dosages of 10, 20, 30, 40, 50, 60 and 100 mg/kg intact hLF are equal to 130, 260, 390, 520, 650, 780 and 1300 nmol kg respectively (hLF Mr 77,000).
  • a dosage of 0.19 mg/kg is in equimolar ratio to a dosage of 10 mg/kg intact human lactoferrin.
  • concentration of the polypeptide in the pharmaceutical composition can vary widely, i.e., from less than about 0.1% by weight, usually being at least about 1% by weight, to as much as 20% by weight or more.
  • intact lactoferrin, fragments or variants thereof, or pharmaceutical compositions containing the same are administered to a patient susceptible to or otherwise at risk of a particular disease or infection.
  • Such an amount is defined to be a "prophylactically effective" amount or dose.
  • the precise amounts again depends on the patient's state of health and weight.
  • the dose is between 10 and 100 mg of intact human lactoferrin per kilogram of body weight.
  • the dosage of intact human lactoferrin is at least 20, 30, 40, 50, or 60 mg/kg. Dosages for fragments and variants can be adjusted to be in equimolar ratio with dosages specified for intact human lactoferrin as described above. Alternatively, fragments and variants can be administered at dosages up to the mg/kg dosage indicated for intact human lactoferrin.
  • lactoferrin, fragments and variants thereof can be administered as a single dosage or as a series of dosages over time.
  • a dosage of amount described above is administered at least daily for a period of a week, a month or a year.
  • a dosage of the above amount is administered at least twice weekly or weekly for a period of a month, a year, the duration of a disease or for the life of the patient.
  • Compositions prepared for intravenous administration typically contain 100 to 500 ml of sterile 0.9% NaCl or 5% glucose optionally supplemented with a 20% albumin solution and 100 to 500 mg of intact lactoferrin. Sterile Ringer's solution can also be used.
  • a typical pharmaceutical composition for intramuscular injection would be made up to contain, for example, 1 ml of sterile buffered water and 10 to 100 mg of intact lactoferrin
  • Methods for preparing parenterally administrable compositions among others are well- known in the art and described in more detail in various sources, including, for example, Remington's Pharmaceutical Science, Mack Publishing, Philadelphia, PA, 17th ed., (1985) and Langer, Science 249:1527-1533 (1990) (both incorporated by reference in their entirety for all purposes).
  • compositions can also include, depending on the formulation desired, pharmaceutically-acceptable, non-toxic carriers of diluents, which are defined as vehicles commonly used to formulate pharmaceutical compositions for animal or human administration.
  • diluents are defined as vehicles commonly used to formulate pharmaceutical compositions for animal or human administration.
  • the diluent is selected so as not to affect the biological activity of the combination.
  • the hLF, or hLF polypeptide fragments or variants are administered along with a pharmaceutical excipient or carrier comprising any compatible, non-toxic substance suitable to deliver the polypeptides to the patient.
  • compositions can also include other pharmaceutically acceptable carriers, adjuvants, or non-toxic, non-therapeutic, non-immunogenic stabilizers, excipients, buffering agents, dispersing agents, and the like.
  • the compositions can also include additional substances to approximate physiological conditions, such as pH adjusting and buffering agents, toxicity adjusting agents, wetting agents, detergents and the like.
  • the concentration of the polypeptide in the pharmaceutical composition can vary widely, i.e., from less than about 0.1% by weight, usually being at least about 1% by weight to as much as 20% by weight or more.
  • the composition can also include any of a variety of stabilizing agents, such as an antioxidant for example.
  • the polypeptides can be complexed with various well- known compounds that enhance the in vivo stability of the polypeptide, or otherwise enhance its pharmacological properties (e.g., increase the half-life of the polypeptide, reduce its toxicity, enhance solubility or uptake).
  • polypeptides of the composition can also be complexed with molecules that enhance their in vivo attributes.
  • a list of such molecules includes carbohydrates, polyandries, amino acids, other peptides, ions (e.g., sodium, potassium, calcium, magnesium, manganese), and lipids.
  • the active ingredient can be administered in solid dosage forms, such as capsules, tablets, and powders, or in liquid dosage forms, such as elixirs, syrups, and suspensions.
  • the active components can be encapsulated in gelatin capsules together with inactive ingredients and powdered carriers, such as glucose, lactose, sucrose, mannitol, starch, cellulose or cellulose derivatives, magnesium stearate, stearic acid, sodium saccharin, talcum, magnesium carbonate and the like.
  • inactive ingredients and powdered carriers such as glucose, lactose, sucrose, mannitol, starch, cellulose or cellulose derivatives, magnesium stearate, stearic acid, sodium saccharin, talcum, magnesium carbonate and the like.
  • additional inactive ingredients that can be added to provide desirable color, taste, stability, buffering capacity, dispersion or other known desirable features are red iron oxide, silica gel, sodium lauryl sulfate, titanium dioxide, and edible white ink. Similar diluents can be used to make compressed tablets. Both tablets and capsules can be manufactured as sustained release products to provide for continuous release of medication over a period of hours.
  • Compressed tablets can be sugar coated or film coated to mask any unpleasant taste and protect the tablet from the atmosphere, or enteric-coated for selective disintegration in the gastrointestinal tract.
  • Liquid dosage forms for oral administration can contain coloring and flavoring to increase patient acceptance.
  • Pharmaceutical compositions can be administered with a foodstuff, typically milk, e.g., bovine milk. This mode of administration have advantages when the LF/ variant is produced by expression in a transgenic animal such as a transgenic bovine, goat, or rabbit. The production of LF in transgenic bovine milk is desirable since it provides a matrix wherein little or no purification is necessary for human consumption.
  • solid or liquid formulations in an enteric-coated or otherwise protected form.
  • the formulation can be mixed or simply coadministered with a Vietnamese, such as a liquid mixture of medium chain triglycerides, or the formulation can be filled into enteric capsules (e.g., of soft or hard gelatin, which are themselves optionally additionally enteric coated).
  • enteric capsules e.g., of soft or hard gelatin, which are themselves optionally additionally enteric coated.
  • solid formulations comprising the polypeptide can be coated with enteric materials to form tablets.
  • the thickness of enteric coating on tablets or capsules can be, for example, from 0.5 to 4 microns in thickness.
  • the enteric coating can comprise any of the enteric materials conventionally utilized in orally administrable pharmaceutical formulations. Suitable enteric coating materials are known, for example, from Remington 's Pharmaceutical Sciences, Mace Publishing Company, Philadelphia, 17th ed. (1985); and Hagars Handbuch der Pharmazeutica Praxie, Springer Verlag, 4 th ed., Vol. 7a (1971), both of which are incorporated herein by reference in their entirety.
  • compositions can enhance the pharmaceutical characteristics of the polypeptide component of the composition.
  • lipid-associated structures e.g., liposomes, or other lipidic complexes
  • the complex containing the composition can subsequently be targeted to specific target cells by the incorporation of appropriate targeting molecules (e.g., specific antibodies or receptors).
  • targeting molecules e.g., specific antibodies or receptors
  • the particular form of the composition varies with the intended mode of administration and therapeutic application. Typically, however, the composition includes polypeptides comprising full-length LF, fragments of LF, and/or variants of LF, and a pharmaceutically acceptable excipient.
  • the polypeptide included in the composition has a defined length, can consist of one or more arginine residues at the N-terminus and have antimicrobial activity (e.g., is effective in killing viruses or bacteria).
  • the polypeptide includes a contiguous segment of up to 27 amino acids and the N-terminal amino acids of the polypeptide consists of the residues XRR (where X is any amino acid and R is arginine.
  • Some compositions include polypeptide no longer than 26 amino acids and the N-terminal amino acids are RR.
  • Some compositions include a polypeptide no longer than 25 amino acids and the N-terminus is R (i.e., Arg).
  • the polypeptide is shorter, such as 5, 10, 15, 20 or 25 amino acids long, or any length therebetween.
  • the polypeptide is even smaller in other compositions.
  • the polypeptide can simply consist of the N-terminal XRR or RR residues.
  • the polypeptides used in the pharmaceutical compositions can also include any of the polypeptides described above. While the N-terminus of the polypeptide consists of the amino acids XRR, RR or R, the remaining contiguous amino acid sequence of the polypeptide sequence can vary so long as the polypeptide has antimicrobial activity. For example, the remaining contiguous sequence can consist of a contiguous amino acid sequence from hLF, especially the sequence beginning after Arg 3 .
  • the polypeptide can be hLF(l-l 1), hLF(2-l 1) or hLF(3-l 1).
  • the amino acid sequence can include sequences wherein a small number (e.g., one, two or three) amino acids are inserted or removed from the hLF sequence.
  • the polypeptide includes contiguous sequences from hLF, wherein one or more of the amino acids has been chemically modified.
  • the components used to formulate the pharmaceutical compositions are preferably of high purity and are substantially free of potentially harmful contaminants (e.g., at least National Food (NF) grade, generally at least analytical grade, and more typically at least pharmaceutical grade.
  • potentially harmful contaminants e.g., at least National Food (NF) grade, generally at least analytical grade, and more typically at least pharmaceutical grade.
  • NF National Food
  • the resulting product is typically substantially free of any potentially toxic agents, particularly any endotoxins, which may be present during the synthesis or purification process.
  • Compositions for parental administration are also sterile, substantially isotonic and made under GMP conditions.
  • a patient is monitored after administration of lactoferrin, fragments or variants thereof to determine beneficial effects and or side effects responsive to administration of lactoferrin.
  • Monitoring can be for subjective symptoms, such as headache or nausea reported by the patient, physiological characteristics, such as temperature, presence of rash, and blood pressure, or by biochemical analysis of tissue samples from the patients.
  • Side effects are deemed insubstantial if they do not prevent repeated administration of the same drug to the patient.
  • insubstantial side effects resolve spontaneously within 24 hr, and preferably within 12 hr.
  • insubstantial side effects do not recur with greater severity on repeated administration of the drug.
  • CABG coronary artery bypass surgery
  • the products administered as single intravenous doses were recombinant human lactoferrin; heparin; placebo recombinant human lactoferrin; placebo heparin.
  • the study medication was manufactured from transgenic bovine milk under supervision of
  • Human lactoferrin was purified from the milk of transgenic bovine using the following method.
  • Raw milk containing 0.5 - 5.0 g human lactoferrin /l was pooled and processed in batches of 200 1.
  • Raw milk was defatted by centrifugation and skimmed milk was stored at ⁇ -20°C.
  • a thawed 200 1 batch of hLF containing skimmed milk was incubated with 10% (w/v) S Sepharose (Pharmacia) for 12 ⁇ 4 hours at 4°C. Beads were allowed to settle for at least 5 hours and the supernatant was removed.
  • the Sepharose was then washed batchwise with 6 x 1 volume 20 mM Na-phosphate pH 7.5, 0.1 M NaCl, and 7 x with 1 volume 20 mM Na-phosphate pH 7.5, 0.4 M NaCl.
  • a BPG 300 column (Pharmacia) was packed with the S Sepharose containing the bound hLF and washed with 3 volumes of 20 mM Na-phosphate pH 7.5, 0.4 M NaCl, at 42 1/h. The column was eluted with 20 mM Na-phosphate pH 7.5, 1.0 M NaCl, at 42 1/h.
  • the S Sepharose eluate was concentrated to 10 1 and buffer exchanged to 20 mM Na-phosphate pH 7.5, 0.1 M NaCl using Hemoflow (Fresenius, 30kD cut-off).
  • the preparation was filtrated (0.22 ⁇ m M llipore) and subjected to virus inactivation by adjusting to 1% (w/v) Tween 80 and 0.3% (w/v) tri-n-butyl phosphate and incubating for 15 + 3 hours at 25 ⁇ 1°C.
  • the virus inactivated sample was loaded at 421 h onto a Q Sepharose column (Pharmacia), 180 x 80, serially connected to a Macroprep High S Support (MPHS, Biorad) 300 x 15.
  • Both columns were equilibrated in 20 mM Na-phosphate pH 7.5, 0.1 M NaCl.
  • the columns were washed with 10 litres of 20 mM Na-phosphate pH 7.5, 0.1 M NaCl at 42 1/h.
  • the Q Sepharose column was disconnected and the MPHS column was washed with 40 volumes of 20 mM Na-phosphate pH 7.5, at 126 1/h.
  • the MPHS column was stepwise eluted with first 8 volumes of of 20 mM Na-phosphate pH 7.5, 0.4 M NaCl, at 42 1/h, and then 3 volumes of of 20 mM Na-phosphate pH 7.5, 0.5 M NaCl, at 42 1/h.
  • Group I four subjects received 2.5 mg/kg rhLF.
  • Group II-IV subjects were randomized to either the previous rhLF dose following heparin infusion, the next rhLF dose following placebo heparin or to heparin followed by placebo rhLF.
  • Subject numbers and medication see Table 9.4.1-1.
  • AUCQ- OO total AUC after extrapolation from time x to time infinity (AUC ⁇ -t + c/ ⁇ z ), where c is the approximated concentration at t ⁇ as _ using the regression results of ⁇ z .
  • ELISA enzyme-linked immunosorbent assay
  • the heparin-induced increase in APTT is diminished by 30 mg/kg rhLF.
  • Administration of rhLF after placebo-heparin treatment did not affect APTT values throughout the study period. Heparin administration seemed not to have an effect on the platelet aggregation.
  • Heparin administration did not affect the concentrations of transferrin and total iron. However, groups treated with rhLF (2.5, 10 and 30 mg/kg) and heparin showed higher total iron values as compared to the group treated with heparin alone, although this elevation is in the range of individual differences. Administration of rhLF did not affect transferrin concentrations. Administration of rhLF after placebo-heparin did neither affect transferrin nor total iron throughout the study period. Descriptive statistics are presented in Section 14.2.1-5 and 14.2.1-6.
  • heparin-induced increments in blood coagulation time, as measured by APTT, in healthy volunteers could shortly and partially be returned to levels of 2.5 times baseline values after administration of rhLF, but only at the dose of 30 mg/kg rhLF. This effect occurred at 10 minutes post dose. All other doses of rhLF, i.e. 2.5 and 10 mg/kg did not show any effect upon APTT values. In all four treatment groups with heparin, the APTT values returned to baseline values at 8 h post dose. Other dynamic parameters such as platelet aggregation, plasma transferrin and total iron concentration, after heparin treatment, were not significantly affected by rhLF administration.
  • RhLF administration at a dose of 30 mg/kg was able to partially block the effect of heparin on blood coagulation, resulting in a sharp decrease in APTT immediately after rhLF administration to approximately 2.5 times baseline values (approximately 75 seconds).
  • baseline values approximately 75 seconds.
  • Animal studies revealed total clearance of 25 mg/kg rhLF from the blood within 3 hours, and a half-life time of 45 minutes (a comparison with pharmacokinetic data derived from the present study is required, but these data are not available at this moment).
  • a complete reversal of the anti-coagulating action of heparin by rhLF can be achieved by administration of a higher single dose of rhLF or by administration of rhLF as a maintenance dose. If rhLF forms irreversible complexes with heparin, it is preferable to increase the dose of a single rhLF bolus infusion. However, if rhLF forms reversible complexes with heparin, a maintenance dose of rhLF infusion is preferred. Other dynamic parameters such as platelet aggregation and plasma iron concentration measured after heparin treatment, were not significantly affected by rhLF administration.
  • Glycosylated and unglycosylated human lactoferrins can both bind iron and have identical affinities towards human lysozyme and bacterial lipopolysaccharide, but differ in their susceptibility towards tryptic proteolysis.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Veterinary Medicine (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Organic Chemistry (AREA)
  • Epidemiology (AREA)
  • Rheumatology (AREA)
  • Pain & Pain Management (AREA)
  • Zoology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Immunology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Oncology (AREA)
  • Communicable Diseases (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Peptides Or Proteins (AREA)

Abstract

L'invention concerne des méthodes de traitement utilisant de fortes doses de lactoferrine. La lactoferrine peut être administrée à fortes doses par voie parentérale sans effets secondaires importants pour traiter diverses affections, notamment des maladies infectieuses et l'inflammation.
PCT/NL2001/000253 2000-03-27 2001-03-27 Administration parenterale de fortes doses de lactoferrine WO2001072322A2 (fr)

Priority Applications (1)

Application Number Priority Date Filing Date Title
AU44865/01A AU4486501A (en) 2000-03-27 2001-03-27 High dosage parenteral administration of lactoferrin

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US19335200P 2000-03-27 2000-03-27
EP00201110 2000-03-27
US60/193,352 2000-03-27
EP00201110.4 2000-03-27

Publications (2)

Publication Number Publication Date
WO2001072322A2 true WO2001072322A2 (fr) 2001-10-04
WO2001072322A3 WO2001072322A3 (fr) 2002-03-21

Family

ID=26072048

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/NL2001/000253 WO2001072322A2 (fr) 2000-03-27 2001-03-27 Administration parenterale de fortes doses de lactoferrine

Country Status (2)

Country Link
AU (1) AU4486501A (fr)
WO (1) WO2001072322A2 (fr)

Cited By (12)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2002077239A1 (fr) * 2001-03-27 2002-10-03 Sumitomo Pharmaceuticals Company, Limited Polypeptides se liant au virus hcv
EP1360961A1 (fr) * 2002-05-07 2003-11-12 AM-Pharma B.V. Utilisation de peptides antibiotiques pour potentialiser l'activité des agents antimicrobiens
WO2004089986A1 (fr) * 2003-04-14 2004-10-21 Stichting Voor De Technische Wetenschappen Peptide antimicrobien de la famille des transferrines
US7034126B2 (en) 2003-05-14 2006-04-25 Agennix, Inc. Lactoferrin in the treatment of diabetes mellitus
EP1653987A2 (fr) * 2003-07-16 2006-05-10 The Research Foundation of the State University of New York Facteur x de defense de l'hote (hdfx)
US7183381B2 (en) 2004-10-26 2007-02-27 Agennix, Inc. Composition of lactoferrin related peptides and uses thereof
EP1993592A2 (fr) * 2006-02-21 2008-11-26 Ventria Bioscience Compositions contenant de la lactoferrine et leurs procédés d'utilisation pour favoriser la croissance de cellules cutanées
US7592306B2 (en) 2002-12-10 2009-09-22 Agennix, Inc. Lactoferrin as an agent in the prevention of organ transplant rejection and graft-versus-host-disease
US9050323B2 (en) * 2005-12-09 2015-06-09 Microbo S.R.L. Methods of treating destructive inflammation of the mucous membranes with lactoferrin
WO2017202172A1 (fr) * 2016-05-23 2017-11-30 成都福际生物科技有限公司 Domaine de liaison à l'adn de transferrine modifiée, adn polymérase recombinante et son procédé de préparation
CN112351791A (zh) * 2018-06-26 2021-02-09 S&K生物制药有限公司 糖胺聚糖抑制剂和促进剂
WO2020250209A3 (fr) * 2020-03-09 2021-02-18 Sofar S.P.A. Lactoferrine à usage oral ayant une action antivirale

Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1995030339A1 (fr) * 1994-05-05 1995-11-16 Ferrodynamics, Inc. Clonage, expression et utilisations de la lactoferrine humaine
WO1998033509A2 (fr) * 1997-02-03 1998-08-06 Pharming Intellectual Property Bv Proprietes utiles de la lactoferrine humaine et de variants de celle-ci
WO1999014231A2 (fr) * 1997-09-16 1999-03-25 Forssmann Wolf Georg Peptides bifidigenes
WO2001034641A2 (fr) * 1999-11-11 2001-05-17 Am-Pharma B.V. Activite antimicrobienne du premier groupe cationique de la lactoferrine humaine

Family Cites Families (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JP3645282B2 (ja) * 1994-04-22 2005-05-11 森永乳業株式会社 ヘパリン中和剤
JP3506274B2 (ja) * 1994-09-01 2004-03-15 雪印乳業株式会社 新規ペプチドおよび免疫賦活剤

Patent Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1995030339A1 (fr) * 1994-05-05 1995-11-16 Ferrodynamics, Inc. Clonage, expression et utilisations de la lactoferrine humaine
WO1998033509A2 (fr) * 1997-02-03 1998-08-06 Pharming Intellectual Property Bv Proprietes utiles de la lactoferrine humaine et de variants de celle-ci
WO1999014231A2 (fr) * 1997-09-16 1999-03-25 Forssmann Wolf Georg Peptides bifidigenes
WO2001034641A2 (fr) * 1999-11-11 2001-05-17 Am-Pharma B.V. Activite antimicrobienne du premier groupe cationique de la lactoferrine humaine

Non-Patent Citations (2)

* Cited by examiner, † Cited by third party
Title
DATABASE WPI Section Ch, Week 199602 Derwent Publications Ltd., London, GB; Class B04, AN 1996-017144 XP002178978 & JP 07 291874 A (MORINAGA MILK IND CO LTD), 7 November 1995 (1995-11-07) *
DATABASE WPI Section Ch, Week 199621 Derwent Publications Ltd., London, GB; Class B04, AN 1996-205535 XP002178977 & JP 08 073499 A (SNOW BRAND MILK PROD CO LTD), 19 March 1996 (1996-03-19) *

Cited By (19)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2002077239A1 (fr) * 2001-03-27 2002-10-03 Sumitomo Pharmaceuticals Company, Limited Polypeptides se liant au virus hcv
EP1360961A1 (fr) * 2002-05-07 2003-11-12 AM-Pharma B.V. Utilisation de peptides antibiotiques pour potentialiser l'activité des agents antimicrobiens
US7592306B2 (en) 2002-12-10 2009-09-22 Agennix, Inc. Lactoferrin as an agent in the prevention of organ transplant rejection and graft-versus-host-disease
US8058234B2 (en) 2002-12-10 2011-11-15 Agennix Incorporated Lactoferrin as an agent in the prevention of organ transplant rejection and graft-versus-host-disease
WO2004089986A1 (fr) * 2003-04-14 2004-10-21 Stichting Voor De Technische Wetenschappen Peptide antimicrobien de la famille des transferrines
US7034126B2 (en) 2003-05-14 2006-04-25 Agennix, Inc. Lactoferrin in the treatment of diabetes mellitus
US7262279B2 (en) * 2003-05-14 2007-08-28 Agennix, Inc. Lactoferrin in the treatment of diabetes mellitus
EP1653987A2 (fr) * 2003-07-16 2006-05-10 The Research Foundation of the State University of New York Facteur x de defense de l'hote (hdfx)
EP1653987A4 (fr) * 2003-07-16 2006-08-09 Univ New York State Res Found Facteur x de defense de l'hote (hdfx)
US7420033B2 (en) 2004-10-26 2008-09-02 Agennix, Inc. Composition of lactoferrin related peptides and uses thereof
US7183381B2 (en) 2004-10-26 2007-02-27 Agennix, Inc. Composition of lactoferrin related peptides and uses thereof
US9050323B2 (en) * 2005-12-09 2015-06-09 Microbo S.R.L. Methods of treating destructive inflammation of the mucous membranes with lactoferrin
EP1993592A2 (fr) * 2006-02-21 2008-11-26 Ventria Bioscience Compositions contenant de la lactoferrine et leurs procédés d'utilisation pour favoriser la croissance de cellules cutanées
EP1993592A4 (fr) * 2006-02-21 2011-11-16 Ventria Bioscience Compositions contenant de la lactoferrine et leurs procédés d'utilisation pour favoriser la croissance de cellules cutanées
WO2017202172A1 (fr) * 2016-05-23 2017-11-30 成都福际生物科技有限公司 Domaine de liaison à l'adn de transferrine modifiée, adn polymérase recombinante et son procédé de préparation
US11053479B2 (en) 2016-05-23 2021-07-06 Foregene Company Limited Modified transferrin DNA binding domain, recombinant DNA polymerase and preparation method
CN112351791A (zh) * 2018-06-26 2021-02-09 S&K生物制药有限公司 糖胺聚糖抑制剂和促进剂
WO2020250209A3 (fr) * 2020-03-09 2021-02-18 Sofar S.P.A. Lactoferrine à usage oral ayant une action antivirale
WO2021181276A1 (fr) * 2020-03-09 2021-09-16 Sofar S.P.A. Composition comprenant de la lactoferrine et des souches bactériennes probiotiques pour une utilisation orale avec action antivirale

Also Published As

Publication number Publication date
AU4486501A (en) 2001-10-08
WO2001072322A3 (fr) 2002-03-21

Similar Documents

Publication Publication Date Title
CA2005143C (fr) Formule proteique hydrophobe stabilise de g-csf
Levy Antimicrobial proteins and peptides: anti-infective molecules of mammalian leukocytes
KR101643277B1 (ko) 재조합 ｖｗｆ 제제
US6333311B1 (en) Useful properties of human lactoferrin and variants thereof
EP2030980A1 (fr) Mutants de lactoferrine
WO2001072322A2 (fr) Administration parenterale de fortes doses de lactoferrine
KR20130093508A (ko) 지혈 작용을 가진 조직인자를 함유하는 인지질이 풍부한 소포 및 그의 용도
ES2256070T3 (es) Actividad antimicrobiana de la primera agrupacion cationica de lactoferrina humana.
TW201822792A (zh) 一種治療動脈粥樣硬化及其併發症的方法
Norrby Human apo-lactoferrin enhances angiogenesis mediated by vascular endothelial growth factor A in vivo
JP2020502102A (ja) 骨粗鬆症を予防及び治療するための薬物およびその用途
US20080206226A1 (en) Agent for promoting osteogenesis and/or inhibiting bone resorption
Morris et al. Whey proteins and peptides in human health
JP2021502363A (ja) 早期産児における粘膜抵抗力および腸／肺機能の成熟
JP6404833B2 (ja) 止血組成物
JP4668534B2 (ja) 免疫反応を調節するためのエナメルマトリックスタンパク質組成物
Trybek et al. The biological properties of lactoferrin
JP3634359B2 (ja) Ｔｃｆ−▲ｉｉ▼を有効成分とする血液凝固正常化剤
US7060677B1 (en) Antimicrobial activity of the first cationic cluster of human lactoferrin
JP6518591B2 (ja) シーラント組成物
Russell et al. Innate humoral defense factors
US5849282A (en) Method of treating colon, renal, and lung carcinomas with γ-interferon and Ser71 !-interleukin-1β
WO1993006840A1 (fr) Medicament de prevention et de traitement de la tendance a l'hemorragie
JPH083065A (ja) 肝臓障害に対する治療剤
van Veen Production and characterization of recombinant human lactoferrin

Legal Events

Date Code Title Description
AK Designated states

Kind code of ref document: A2

Designated state(s): AE AG AL AM AT AU AZ BA BB BG BR BY BZ CA CH CN CO CR CU CZ DE DK DM DZ EE ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MA MD MG MK MN MW MX MZ NO NZ PL PT RO RU SD SE SG SI SK SL TJ TM TR TT TZ UA UG US UZ VN YU ZA ZW

AL Designated countries for regional patents

Kind code of ref document: A2

Designated state(s): GH GM KE LS MW MZ SD SL SZ TZ UG ZW AM AZ BY KG KZ MD RU TJ TM AT BE CH CY DE DK ES FI FR GB GR IE IT LU MC NL PT SE TR BF BJ CF CG CI CM GA GN GW ML MR NE SN TD TG

121 Ep: the epo has been informed by wipo that ep was designated in this application
DFPE Request for preliminary examination filed prior to expiration of 19th month from priority date (pct application filed before 20040101)
AK Designated states

Kind code of ref document: A3

Designated state(s): AE AG AL AM AT AU AZ BA BB BG BR BY BZ CA CH CN CO CR CU CZ DE DK DM DZ EE ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MA MD MG MK MN MW MX MZ NO NZ PL PT RO RU SD SE SG SI SK SL TJ TM TR TT TZ UA UG US UZ VN YU ZA ZW

AL Designated countries for regional patents

Kind code of ref document: A3

Designated state(s): GH GM KE LS MW MZ SD SL SZ TZ UG ZW AM AZ BY KG KZ MD RU TJ TM AT BE CH CY DE DK ES FI FR GB GR IE IT LU MC NL PT SE TR BF BJ CF CG CI CM GA GN GW ML MR NE SN TD TG

122 Ep: pct application non-entry in european phase
NENP Non-entry into the national phase in:

Ref country code: JP