WO2000047219A2 - Methods and reagents for treating glucose metabolic disorders - Google Patents

Methods and reagents for treating glucose metabolic disorders Download PDF

Info

Publication number
WO2000047219A2
WO2000047219A2 PCT/US2000/003391 US0003391W WO0047219A2 WO 2000047219 A2 WO2000047219 A2 WO 2000047219A2 US 0003391 W US0003391 W US 0003391W WO 0047219 A2 WO0047219 A2 WO 0047219A2
Authority
WO
WIPO (PCT)
Prior art keywords
pyy
cells
glucose
cell
pancreatic
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2000/003391
Other languages
English (en)
French (fr)
Other versions
WO2000047219A3 (en
Inventor
Kevin Pang
Huang-Hui Lu
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Ontogeny Inc
Original Assignee
Ontogeny Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Family has litigation
First worldwide family litigation filed litigation Critical https://patents.darts-ip.com/?family=22385149&utm_source=google_patent&utm_medium=platform_link&utm_campaign=public_patent_search&patent=WO2000047219(A2) "Global patent litigation dataset” by Darts-ip is licensed under a Creative Commons Attribution 4.0 International License.
Priority to CA2360324A priority Critical patent/CA2360324C/en
Priority to IL144703A priority patent/IL144703A/en
Priority to DK00913417.2T priority patent/DK1189629T3/da
Priority to AU34868/00A priority patent/AU779745C/en
Priority to AT00913417T priority patent/ATE482717T1/de
Priority to EP00913417A priority patent/EP1189629B1/en
Priority to JP2000598171A priority patent/JP2003518914A/ja
Priority to DE60045030T priority patent/DE60045030D1/de
Priority to HK02106949.7A priority patent/HK1045267A1/zh
Application filed by Ontogeny Inc filed Critical Ontogeny Inc
Publication of WO2000047219A2 publication Critical patent/WO2000047219A2/en
Anticipated expiration legal-status Critical
Publication of WO2000047219A3 publication Critical patent/WO2000047219A3/en
Priority to AU2005200685A priority patent/AU2005200685A1/en
Priority to IL199988A priority patent/IL199988A/en
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/22Hormones
    • AHUMAN NECESSITIES
    • A01AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01KANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K67/00Rearing or breeding animals, not otherwise provided for; New or modified breeds of animals
    • A01K67/027New or modified breeds of vertebrates
    • A01K67/0275Genetically modified vertebrates, e.g. transgenic
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/22Hormones
    • A61K38/26Glucagons
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/22Hormones
    • A61K38/28Insulins
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/18Drugs for disorders of the alimentary tract or the digestive system for pancreatic disorders, e.g. pancreatic enzymes
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/04Anorexiants; Antiobesity agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/06Antihyperlipidemics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/08Drugs for disorders of the metabolism for glucose homeostasis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/08Drugs for disorders of the metabolism for glucose homeostasis
    • A61P3/10Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P5/00Drugs for disorders of the endocrine system
    • A61P5/48Drugs for disorders of the endocrine system of the pancreatic hormones
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P5/00Drugs for disorders of the endocrine system
    • A61P5/48Drugs for disorders of the endocrine system of the pancreatic hormones
    • A61P5/50Drugs for disorders of the endocrine system of the pancreatic hormones for increasing or potentiating the activity of insulin
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/5005Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells
    • G01N33/5008Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells for testing or evaluating the effect of chemical or biological compounds, e.g. drugs, cosmetics
    • G01N33/5044Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells for testing or evaluating the effect of chemical or biological compounds, e.g. drugs, cosmetics involving specific cell types
    • G01N33/507Pancreatic cells
    • AHUMAN NECESSITIES
    • A01AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01KANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K2217/00Genetically modified animals
    • A01K2217/05Animals comprising random inserted nucleic acids (transgenic)
    • A01K2217/054Animals comprising random inserted nucleic acids (transgenic) inducing loss of function

Definitions

  • the invention relates to therapies for treating glucose metabolic disorders (e.g., glucose intolerance, insulin resistance, hyperglycemia, hyperinsulinemia and Type II diabetes mellitus).
  • glucose metabolic disorders e.g., glucose intolerance, insulin resistance, hyperglycemia, hyperinsulinemia and Type II diabetes mellitus.
  • the therapies are based on the discovery that PYY induces glucose responsiveness in fetal and adult pancreatic islets.
  • Diabetes is one of the most prevalent chronic diseases in the United States, and a leading cause of death, afflicting over 400 million diabetics in the world today.
  • NHIS National Health Interview Survey
  • the total cost of diabetes in the United States has been estimated at $92 billion annually, including expenditures on medical products, hospitalization and the value of lost work. Substantial costs to both society and its citizens are incurred not only for direct costs of medical care for diabetes, but also for indirect costs, including lost productivity resulting from diabetes-related morbidity and premature mortality. Persons with diabetes are at risk for major complications, including diabetic ketoacidosis, end-stage renal disease, diabetic retinopathy and amputation. There are also a host of less directly related conditions, such as hypertension, heart disease, peripheral vascular disease and infections, for which persons with diabetes are at substantially increased risk.
  • Diabetes mellitus is a heterogeneous group of metabolic diseases which lead to chronic elevation of glucose in the blood (hyperglycemia). Diabetes is characterized by pancreatic islet destruction or dysfunction leading to loss of glucose regulation.
  • Type I also known as “insulin-dependent diabetes” (“LDDM”) or “juvenile-onset diabetes'”
  • Type II also known as “non-insulin dependent” (“NIDDM”) or “maturity-onset diabetes”.
  • IDDM results from an autoimmune-mediated destruction of pancreatic ⁇ cells with consequent loss of insulin production, which results in hyperglycemia.
  • Type I diabetics require insulin replacement therapy to ensure survival. While medications such as injectable insulin and oral hypoglycemics allow diabetics to live longer, diabetes remains the third major killer, after heart disease and cancer. However, these medications do not control blood sugar levels well enough to prevent swinging between high and low blood sugar levels, with resulting damage to the kidneys, eyes, and blood vessels.
  • DCCT Diabetes Control and Complications Trial
  • Intensive therapy in the DCCT included multiple injection of insulin three or more times per day or continuous subcutaneous insulin infusion (CSII) by external pump.
  • Insulin pumps are one of a variety of alternative approaches to subcutaneous multiple daily injections (MDI) for approximating physiological replacement of insulin.
  • Type II diabetes is characterized by hyperglycemia in the presence of higher-than- normal levels of plasma insulin (hyperinsulinemia) and represents over 90% of all cases and occurs most often in overweight adults over 40 years of age. Progression of Type II diabetes is associated with increasing concentrations of blood glucose, coupled with a relative decrease in the rate of glucose-induced insulin secretion. In Type II diabetes, tissue processes which control carbohydrate metabolism are believed to have decreased sensitivity to insulin and therefore occurs not from a lack of insulin production, but a decreased sensitivity to increased glucose levels in the blood and an inability to respond by producing insulin. Alternatively, diabetes may result from various defects in the molecular machinery that mediate the action of insulin on its target cells, such as a lack of insulin receptors on their cell surfaces.
  • Type II diabetes therefore frequently does not require administration of insulin but may be based on diet and lifestyle changes, augmented by therapy with oral hypoglycemic agents such as, for example, sulfonylurea.
  • oral hypoglycemic agents such as, for example, sulfonylurea.
  • the endocrine portion of the pancreas is composed of the islets of Langerhans, which appear as rounded clusters of islet cells embedded within the exocrine pancreas.
  • islet cells compose the endocrine portion of the pancreas: (1) alpha ( ) cells, constituting 20% of islet cells, which secret glucagon, a hormone which raises blood sugar levels; (2) beta ( ⁇ ) cells, which secrete insulin, a hormone which lowers blood sugar levels; (3) delta ( ⁇ ) cells, which secrete growth hormone inhibiting hormone (GHIH) or somatostatin, a hormone which inhibits the secretion of insulin and glucagon; and (4) ⁇ cells, or pancreatic polypeptide (PP) cells, which synthesize pancreatic polypeptide.
  • alpha ( ) cells constituting 20% of islet cells, which secret glucagon, a hormone which raises blood sugar levels
  • beta ( ⁇ ) cells which secrete insulin, a hormone which lowers blood sugar levels
  • delta ( ⁇ ) cells which secrete growth hormone inhibiting hormone (GHIH) or somatostatin, a hormone which inhibits the secretion of insulin and glucagon
  • ⁇ cells or pancreatic poly
  • Glucagon acts on several tissues to make energy available in the intervals between eating.
  • glucagon causes breakdown of glycogen and promotes gluconeogenesis from amino acid precursors.
  • Pancreatic polypeptide inhibits pancreatic exocrine secretion of bicarbonate and enzymes, causes relaxation of the gallbladder, and decreases bile secretion.
  • Insulin is known to cause the storage of excess nutrients arising during and shortly after eating.
  • the major target organs for insulin are the liver, muscle and fat-organs specialized for storage of energy.
  • the ⁇ cells of the human fetal pancreas are different from adult pancreatic ⁇ cells in that they release little or no insulin in response to glucose.
  • This has been observed in both humans and rodents, and resembles the delayed insulin response to glucose observed in patients with Type II diabetes or malignant insulinoma. (Hellerstr ⁇ m and Swenne (1991) Diabetes 40(2): 89-93; Tuch et al., supra).
  • fetal ⁇ cells The inability of fetal ⁇ cells to produce insulin in response to glucose is not believed to be due to an inability to process insulin precursors.
  • Adult human ⁇ cells synthesize preproinsulin and convert this into proinsulin (hPI) in the endoplasmic reticulum. Thereafter, hPI is split into insulin and C-peptide via a regulated pathway in the secretory granules.
  • the rate of conversion of hPI in the adult ⁇ cell is high, resulting in a low hPLinsulin ratio both as regards to content and secretion (Gold, et al. (1981) Diabetes 30:77-82). This is also observed for fetal ⁇ cells, suggesting that ⁇ cell immaturity is not due to differences in the storage and release of proinsulin.
  • pancreatic development occurs in discrete stages and is regulated by endocrine hormones produced by pancreatic cells themselves or by other tissues.
  • pancreatic strom forms at embryonic (“e") day 10.5 (“el 0.5") by fusion of the dorsal and ventral pancreatic primordial buds that arise as protrusions from the duodenal endoderm.
  • Islet hormones appear sequentially in the developing pancreas: for example, glucagon appears at elO in mouse and el 1 in rat, insulin producing cells appear in el2, somatostatin producing cells appear at el 7.
  • pancreatic islet cells differentiate in response to endocrine signals from a common precursor cell in the pancreatic ducts.
  • fetal ⁇ cells acquire the ability to secrete insulin in response to glucose.
  • the insulin response at this age is monophasic and is not blocked by Ca 2+ antagonists.
  • a clear biphasic pattern of insulin secretion in response to glucose is detected only 3 days after birth.
  • the instant invention is based on the discovery that a factor, "peptide yY” or “PYY”, triggers gain of function in glucose non-responsive fetal and adult islets which leads to glucose responsivity, and therefore provides therapies for diseases affecting glucose metabolism such as Type II diabetes.
  • the present invention relates to the discovery that PYY can induce and maintain glucose responsivity in fetal and adult pancreatic islets. For example, we show that treatment of glucose non-responsive e21 islets from fetal rat pancreas for five days with PYY in vitro induced maturation of the islets, which then responded to glucose by releasing insulin. We also show that glucose sensing can be recovered in adult islets by treatment with PYY, and that glucose sensing can be maintained for longer in adult islets treated with PYY. Prior to the present invention, trophic or growth factors that are capable of stimulating islet maturation have not previously been identified in the art.
  • the invention comprises a method for altering the differentiated state of pancreatic islet cells, comprising administering to the pancreatic islets or isolated ⁇ cells, a PYY peptide or PYY agonist of (e.g., which mimics or enhances) PYY activity, collectively referred to herein "PYY Therapeutic".
  • a PYY Therapeutic causes the islets or cells to become glucose responsive. The glucose responsive islets or cells are thereby stimulated to produce insulin when exposed to glucose.
  • the invention comprises methods for inducing islets to express markers indicative of mature islets, or for ⁇ cells to express markers indicative of mature ⁇ cells by contacting the islets or ⁇ cells with a PYY Therapeutic.
  • the islets or cells are human pancreatic islets or ⁇ cells.
  • the invention further provides methods for preparing glucose responsive pancreatic islets or ⁇ cells, comprising administering to glucose non-responsive pancreatic islets or ⁇ cells an effective amount of a composition comprising a PYY Therapeutic.
  • the invention provides a method for modifying glucose metabolism in an animal, comprising administering to the animal a pharmaceutically effective amount of a composition comprising a PYY Therapeutic and a pharmaceutically acceptable carrier, in order to enhance the glucose responsiveness of pancreatic ⁇ cells thereby.
  • the invention provides a method for treating a disease associated with altered glucose metabolism, comprising administering to an animal a pharmaceutically effective amount of a composition comprising a PYY Therapeutic and a pharmaceutically acceptable carrier, in an amount sufficient to increase the glucose responsiveness of pancreatic ⁇ cells.
  • the invention provides differentiated islets and ⁇ cells generated by contacting undifferentiated islets or cells from a vertebrate organism with a PYY Therapeutic.
  • the invention provides pancreatic islets or ⁇ cells that secrete insulin in response to glucose and a pharmaceutically acceptable carrier suitable for pharmaceutical administration to an animal, wherein the cellular composition can secrete insulin in vivo in response to glucose.
  • the invention provides a method for treating a disease associated with altered glucose metabolism, comprising administering to an animal a pharmaceutically effective amount of a composition comprising pancreatic islets or ⁇ cells which have gained glucose-responsiveness by treatment with a PYY Therapeutic according to the invention.
  • the glucose-responsive islets or cells obtained by treating pancreatic islets or ⁇ cells with a PYY Therapeutic are administered to an animal in a composition containing a pharmaceutically acceptable carrier in an amount sufficient to increase the glucose responsiveness of the animal.
  • the composition of a PYY treated glucose-responsive cells comprises additional agents, such as a PYY Therapeutic.
  • the cell composition may be conjointly administered either simultaneously, sequentially or separately with a PYY Therapeutic.
  • the method may be used for treating a disease that is associated with a condition such as insulin resistance, glucose intolerance or glucose non-responsiveness, hyperglycemia, obesity, hyperlipidemia and hyperlipoproteinemia in an animal.
  • a condition such as insulin resistance, glucose intolerance or glucose non-responsiveness, hyperglycemia, obesity, hyperlipidemia and hyperlipoproteinemia in an animal.
  • the instant invention is used to treat Type II diabetes mellitus.
  • Preferred PYY peptides include polypeptides which correspond to a mature PYY protein, or to a biologically active fragment thereof.
  • the PYY peptide is preferably a mammalian PYY, e.g., e.g., encoded by a mammalian PYY gene, and even more preferably a human PYY protein, e.g., such as represented in SEQ ID NO:2.
  • the PYY peptide will be at least 70 percent identical with an amino acid sequence of SEQ ID NO:2, and more preferably at least 80, 85, 90 or 95 percent identical.
  • the PYY peptide can be encoded by a nucleic acid that hybridizes to SEQ ID
  • NO:l preferably under stringency conditions including a wash step of 2.0 x SSC at 65 ° C, and even more preferably under stringency conditions including a wash step of 0.2 x SSC at 65°.
  • PYY agonists which can be used as PYY Therapeutics include any compound having the effect of inducing the activity of PYY.
  • Preferred agonists comprise compounds capable of inhibiting dipeptidylpeptidase, preferably dipeptidylpeptidase IV (DPIV).
  • the PYY Therapeutic, PYY Therapeutic-treated islets and/or PYY Therapeutic-treated cells are administered to an animal with an agent capable of inhibiting the degradation of the PYY Therapeutic either simultaneously, sequentially or separately with the PYY Therapeutic.
  • the agent is co-administered with the PYY Therapeutic.
  • Preferred inhibitors are dipeptidylpeptidase inhibitors.
  • the agent is administered with pancreatic islets or cells that had been made glucose-responsive by treatment with a PYY Therapeutic according to the invention.
  • the agent is administered with PYY and pancreatic islets or cells that had been made glucose-responsive by treatment with a PYY Therapeutic according to the invention.
  • the PYY Therapeutic is a compound that binds to a PYY receptor such as the PYY Yl receptor, and mimics (agonist) or inhibits (as an antagonist) the activity for PYY.
  • PYY Yl receptor such as the PYY Yl receptor
  • such agents are small organic molecules, e.g., having a molecular weight less than 7000 amu, and more preferably less than 5000 amu, 1000 amu, or even 500 amu.
  • Agonists can be used to induce and/or maintain glucose sensing. Agonists can be used to inhibit or otherwise suppress glucose sensing, e.g., to treat hyperinsulinomid or hyperglycemia.
  • the invention provides a method for maintaining normal pancreatic islet function (i.e., glucose responsiveness) in islet or cell transplants, comprising administering to ex vivo pancreatic islets or cells a PYY Therapeutic.
  • pancreatic islet function i.e., glucose responsiveness
  • the pancreatic islet cells may be autologous failed ⁇ cells of the host which are treated with a PYY Therapeutic to enrich for glucose responsive cells or to revive their glucose responsiveness prior to reimplantation into the animal.
  • the invention provides a method for identifying a PYYY
  • the PYY Therapeutic comprising administering to fetal pancreatic islets or cells, or adult pancreatic cells that are non-responsive to glucose, an effective amount of an agent and comparing the cellular response to the agent with the cellular response to PYY.
  • the PYY Therapeutic induces glucose responsiveness in an unresponsive pancreatic islet or cell.
  • the PYY Therapeutic enhances glucose responsiveness in a partially glucose intolerant or low insulin expressing pancreatic islet or ⁇ cell.
  • the PYY Therapeutic recovers glucose responsiveness in failed pancreatic islets or cells.
  • the invention provides a method for identifying antagonists (i.e., inhibitors) of PYY.
  • antagonists may provide a means by which glucose responsiveness in pancreatic cells (e.g., in progenitor cells or insulinoma cells) can be prevented or inhibited.
  • a PYY antagonist can inhibit the effect of native PYY, either directly or indirectly, on pancreatic progenitor cells.
  • a PYY antagonist can inhibit the effect of PYY, either directly or indirectly, on insulin levels when administered to patients suffering hyperinsulinemia (e.g., such as that resulting from insulinoma).
  • the identification of PYY antagonists can then be used to identify inhibitors of PYY antagonists ("PYY antagonist inhibitors").
  • the invention provides a method for screening a DNA library for the presence of a gene encoding a PYY agonist, a PYY antagonist, PYY inhibitor or a PYY antagonist inhibitor.
  • a variegated library of PYY homo logs or agonists is generated by combinatorial mutagenesis at the nucleic acid level, and is encoded by a variegated gene library.
  • a mixture of synthetic oligonucleotides can be enzymatically ligated into gene sequences such that the degenerate set of potential PYY sequences are expressible as individual polypeptides, or alternatively, as a set of larger fusion proteins (e.g., for phage display) containing the set of PYY sequences therein.
  • the present invention provides a diagnostic assay for assessing whether or not a patient suspected of having a glucose metabolic disorder has a defect in his/her PYY functions.
  • the assay can detect levels of PYY in serum or other bodily fluid.
  • the assay can detect mutations to the PYY gene, e.g., which effect secretion, serum half-life or potency of the encoded protein.
  • the subject method can be used to ascertain if a patient has a PYY gene that carries a mutation in the secretion signal sequence that decreases the level of secretion of the protein.
  • the invention provides a transgenic non-human vertebrate animal in which PYY inductive pathways are inhibited in one or more tissues of said animal by one of either expression of an antagonistic PYY polypeptide or disruption of a gene encoding PYY or a PYY agonist.
  • Figure 1 Effect of IBMX on insulin release in e21/P0 pancreas.
  • FIG. 1 IBMX stimulated calcium influx in e21 islets.
  • Figure 3 A and 3B PYY induces the maturation of fetal islets.
  • Figure 4 The effect of PYY on e21 islets is time dependent.
  • Figure 6 PYY effect on adult islets.
  • Figure 7 The effect of PYY on gain of glucose responsivity requires activation of gene transcription.
  • Figure 8 The effect of actinomycin D is not mediated by lowering of islet insulin content.
  • Figure 9 The presence of PYY does not affect basal secretion rate.
  • Figure 10 Effect of PYY on restoring glucose response in rat adult islets.
  • pancreatic islet development proceeds through stages during fetal gestation which are punctuated by discrete transitions.
  • the initial period is a protodifferentiated state which is characterized by the commitment of pluripotent stem cells to the islet cell lineage, as manifested by the expression of insulin and glucagon.
  • the invention relates to the discovery that treatment of fetal islets with Peptide YY
  • PYY in vitro caused maturation of the glucose-unresponsive islets into mature islets that responded to glucose by releasing insulin.
  • PYY has also been shown to restore glucose-responsiveness to adult pancreatic islets that have otherwise lost the ability to secrete insulin in response to glucose (Figure 6).
  • Figure 6 These findings indicate that PYY agonists can be used to induce the formation of glucose-responsive pancreatic tissue, both ex vivo and in vivo from progenitor cell populations.
  • the perfect findings demonstrate that PYY agonists can be used to maintain or otherwise extend the time that ⁇ cells are glucose responsive, as well as to restore glucose responsiveness to ⁇ cells.
  • the present discovery provides reagents and methods for generating glucose-responsive cells from pancreatic progenitor cells.
  • the subject method can be used to restore or maintain glucose responsiveness in cultured pancreatic islets or other pancreatic cells, in particular pancreatic islets or cells that are being prepared for transplantation into an animal, preferably a human.
  • the subject method can be used to prevent loss of glucose-responsive pancreatic cells in vivo.
  • the invention relates to methods for regulating (inducing or maintaining) glucose-responsive pancreatic islets or isolated ⁇ cells, through the use of a PYY peptide, an analog or derivative of PYY, or an agonist thereof (hereinafter "PYY agonist").
  • PYY Therapeutic both classes of agents are collectively referred to herein as "PYY Therapeutic".
  • Administration of a PYY Therapeutic by the subject method can cause the treated pancreatic cells to acquire glucose responsiveness, thereby enriching an islet or population of ⁇ cells for glucose-responsive ⁇ cells, or will induce islets or cells which have lost the ability to respond to glucose to regain glucose responsiveness.
  • a PYY Therapeutic may be administered in vivo to a subject in a pharmacologically acceptable composition or may be administered ex vivo to cultured islets or cell lines.
  • transplant material i.e., PYY treated pancreatic islet or ⁇ cells
  • the cells may be administered to an animal with the PYY Therapeutic, alone or in combination with other agonists that are capable of enhancing the effect of a PYY Therapeutic.
  • the animal or pancreatic islets or cells thereof may be treated with factors that may induce or enhance the production by the islet cells themselves of other factors which may enhance PYY-induced glucose responsiveness.
  • the insulin gene contains multiple cis-acting elements (i.e., glucose responsive enhancer and repressor elements) that contribute to the basal activity, tissue specificity and metabolic response of the insulin promoter.
  • cis-acting elements i.e., glucose responsive enhancer and repressor elements
  • pancreatic islets or cells may be treated with factors that may cause or enhance the production by other cell types of other factors which may enhance PYY induced glucose responsiveness.
  • ⁇ , ⁇ or PP cells may be stimulated by PYY to produce factors that may alter gene expression or glucose metabolism in an animal.
  • Agonists of the PYY receptors may also be identified using the instant invention.
  • PYY belongs to the family of peptides termed the "PP family", other members of which include NPY and PP.
  • PP family Several PP-family receptor subtypes have been cloned. These all contain several transmembrane domains and belong to the G-protein coupled superfamily of receptors.
  • the PP receptor family includes Yl-R, Y2-R, Y3-R, Y4-R, Y5-R and Y6-R, each receptor differing in binding properties and tissue distribution and sequence identity.
  • factors capable of increasing PYY receptor expression in pancreatic cells may also be administered to a subject or to islets or cells ex vivo to enhance the glucose responsiveneness effect of PYY.
  • Increased PYY receptor levels would further enhance the effect of a PYY Therapeutic on pancreatic ⁇ cells.
  • PYY receptor number in pancreatic ⁇ cells may be increased by introduction of recombinant vectors comprising DNA sequences encoding a PYY receptor. Though the P2 and P5 receptors are preferred, PI, P3, P4 and P6 or other PYY specific receptor may be induced or introduced.
  • agents capable of enhancing glucose transport or phosphorylation may be administered in conjunction with the PYY Therapeutic.
  • PYY Therapeutic See, e.g., Schuit, F. C. (1996) Horm. Res. 46:99-106.
  • the expression level of the glucose transporter GLUT2 has been found to be reduced in animal models of diabetes, and transfection of GLUT2 into cell lines can confer glucose sensitivity on the cells, or transgenic mice with downregulated GLUT2 in ⁇ cells or diabetic rats.
  • pancreatic islet cells Prior to transplantation, donor pancreatic islet cells are cultured, which results in the loss of their ability to secrete insulin in response to glucose.
  • the methods provided herein provide means for maintaining cultured pancreatic cells as functionally mature glucose responsive ⁇ cells that continue to produce insulin. Alternatively, cultures of pancreatic cells that have lost their glucose responsiveness can be restored to glucose-responsive cells by the instant invention.
  • the invention provides methods for treating diseases associated with altered or faulty glucose metabolism, for example, in diseases which are characterized by an inability to respond to increased or decreased levels of glucose or its byproducts in the blood.
  • diseases associated with altered or faulty glucose metabolism for example, in diseases which are characterized by an inability to respond to increased or decreased levels of glucose or its byproducts in the blood.
  • PYY potentiates or restores glucose responsiveness provides numerous strategies for restoring or augmenting insulin production in an animal, preferably in humans.
  • PYY analogs, agonists or antagonists may be identified by the methods of the invention by comparison of treatment of glucose- nonresponsive cells (e.g., fetal islets or ⁇ cells or non-responsive adult islets or ⁇ cells with test factors and comparing their effects to the effects elicited with PYY.
  • glucose- nonresponsive cells e.g., fetal islets or ⁇ cells or non-responsive adult islets or ⁇ cells with test factors and comparing their effects to the effects elicited with PYY.
  • the invention provides methods for screening protein, peptide or DNA libraries for the presence of a gene encoding a PYY analogs, agonist or PYY antagonist, according to art-known methods.
  • the invention provides a method for identifying antagonists of PYY and the genes that encode them.
  • the antagonist may be a naturally occurring gene product or variants thereof or a synthetic molecule of some sort, such as, for example, an antisense, a ribozyme molecule and a small organic molecule.
  • the invention also provides methods for identifying naturally-occurring or synthetic antagonists, which inhibit or antagonize a PYY antagonist.
  • Such "antagonists to antagonists" of PYY (or "PYY antagonist inhibitors”) can be identified to provide strategies for inhibiting the PYY antagonists in order to enhance the response of cells to PYY.
  • diseases associated with altered glucose metabolism can be treated by administering a pharmaceutically effective amount of PYY treated pancreatic ⁇ cells (which have gained glucose-responsiveness).
  • the glucose-responsive cells are administered to an animal in a composition containing a pharmaceutically acceptable carrier.
  • the composition of glucose- responsive cells further comprises other factors that may augment insulin secretion, such as a PYY Therapeutic.
  • the composition may be conjointly administered either simultaneously, sequentially or separately with a protease inhibitor which prolongs the serum half-life of a PYY Therapeutic, e.g., such as a dipeptidylpeptidase inhibitor.
  • a PYY Therapeutic e.g., such as a dipeptidylpeptidase inhibitor.
  • the dipeptidylpeptidase inhibitor is a DPIV inhibitor.
  • the cell composition may be administered either simultaneously, sequentially or separately with the additional factors.
  • the method may be used for treating a disease that is associated with a condition such as insulin resistance, glucose intolerance or glucose non-responsiveness, hyperglycemia, obesity, hyperlipidemia and hyperlipoproteinemia in an animal.
  • the PYY Therapeutic induces glucose responsiveness in an unresponsive cell of the pancreatic lineage.
  • the PYY Therapeutic enhances glucose responsiveness by causing maturation of pancreatic progenitor cells.
  • the PYY Therapeutic enhances glucose responsiveness in a partially glucose intolerant or low insulin expressing pancreatic ⁇ cell from a post-partem animal.
  • the PYY Therapeutic recovers glucose responsiveness in failed pancreatic cells from a post-partem animal.
  • the invention provides differentiated ⁇ cells generated in cell culture by contacting an undifferentiated cell from a vertebrate organism with a PYY Therapeutic.
  • the invention provides pancreatic ⁇ cells that secrete insulin in response to glucose for use in transplantation and a pharmaceutically acceptable carrier suitable for pharmaceutical administration to an animal, wherein the cellular composition can secrete insulin in vivo in response to glucose.
  • This invention further contemplates a method for generating sets of combinatorial mutants of PYY proteins, as well as libraries of truncation mutants, and is especially useful for identifying potential variant sequences (e.g., homologs or analogs) that are functional in binding to a receptor for PP proteins and which alters the glucose-responsiveness of pancreatic islets or cells.
  • potential variant sequences e.g., homologs or analogs
  • the purpose of screening such combinatorial libraries is to generate, for example, novel PYY homologs or analogs which are either agonists or antagonist, or alternatively, possess novel activities altogether.
  • PYY homologs or analogs can be engineered by the present method to provide more efficient binding to a cognate receptor, yet still retain at least a portion of an activity associated with
  • PYY combinatorially-derived homologs can be easily generated to have an increased potency relative to a naturally occurring form of the protein.
  • PYY homologs or analogs can be generated by the present combinatorial approach to act as antagonists, in that they are able to mimic, for example, binding to other extracellular matrix components (such as receptors), yet not induce any biological response, thereby inhibiting the action of authentic PYY Therapeutics.
  • manipulation of certain domains of PYY by the present method can provide domains more suitable for use in fusion proteins, such as one that incorporates portions of other proteins which are derived from the extracellular matrix and/or which bind extracellular matrix components.
  • the amino acid sequences for a population of PYY homologs, analogs or other related proteins are aligned, preferably to promote the highest homology possible.
  • a population of variants can include, for example, PYY homologs from one or more species that are capable of inducing glucose-responsiveness.
  • Amino acids which appear at each position of the aligned sequences are selected to create a degenerate set of combinatorial sequences.
  • the variegated library of PYY variants is generated by combinatorial mutagenesis at the nucleic acid level, and is encoded by a variegated gene library.
  • a mixture of synthetic oligonucleotides can be enzymatically ligated into gene sequences such that the degenerate set of potential PYY sequences are expressible as individual polypeptides, or alternatively, as a set of larger fusion proteins (e.g., for phage display) containing the set of PYY sequences therein.
  • the invention provides a transgenic non-human vertebrate animal in which PYY inductive pathways are inhibited in one or more tissues of said animal by one of either expression of an antagonistic PYY polypeptide or disruption of a gene encoding a PYY Therapeutic.
  • the progenitor cells are inducible to differentiate into pancreatic ⁇ cells.
  • the subject pancreatic ⁇ cells are stimulated to be glucose responsive and to produce insulin in response to glucose.
  • the subject pancreatic ⁇ cells can also be characterized on the basis of specific antigenic markers or other markers that may be expressed on the cell surface, e.g., integrins, lectins, gangliosides, or transporters, or on the basis of specific cellular morphology. All of these techniques are known and available to the one skilled in the art.
  • pancreatic ⁇ cells may be characterized in certain circumstances by the expression of one or more of: homeodomain type transcription factors such as STF-1; PAX gene(s) such as PAX6; PTF-1; hXBP-1; HNF genes(s); villin; tyrosine hydroxylase; insulin; glucagon; and/or Neuropeptide Y.
  • homeodomain type transcription factors such as STF-1
  • PAX gene(s) such as PAX6
  • PTF-1 hXBP-1
  • HNF genes(s) hXBP-1
  • villin tyrosine hydroxylase
  • insulin glucagon
  • Neuropeptide Y neuropeptide Y
  • the subject animal of the invention is a mammal, preferably a human.
  • agonist is meant to refer to an agent that upregulates (e-g-, mimics potentiates or enhances) at least one PYY bioactivity.
  • An PYY agonist can be a wild-type PYY protein or derivative thereof having at least one bioactivity of a wild- type PYY protein or peptidomimetic of PYY which functions as an agonist of (e.g., mimics) PYY activity.
  • a PYY agonist can also be a compound that upregulates expression of a PYY gene or which increases at least one bioactivity of an PYY protein.
  • a PYY agonist therefore includes those agents that upregulate the production and/or secretion of insulin in response to glucose.
  • An agonist can also be a compound which increases the interaction of a PYY polypeptide with another molecule, e.g., a PP family receptor, or which mimics the binding to and distortion of a PYY receptor by native PYY.
  • Another illustrative agonist is a compound which enhances binding of a PYY or PYY receptor transcription factor to the upstream region of a PYY or PYY receptor gene, or of an insulin gene transcription factor to the upstream region of an insulin gene, thereby enhancing the synthesis of the insulin protein.
  • An agonist can also be a compound that upregulates expression of a PYY or insulin gene or which increases the amount of PYY or insulin protein present, e.g., by increasing protein synthesis or decreasing protein turnover.
  • a PYY agonist can be a PYY antagonist inhibitor.
  • ⁇ cells are found in the islets of Langerhans in the pancreas. Alpha cells secrete glucagon, a hormone that has effects opposite to those of insulin (it raises blood glucose levels).
  • blood glucose level refers to the concentration of glucose in blood.
  • the normal blood glucose level euglycemia
  • the term "animal” refers to vertebrates, preferably mammals, and most preferably humans.
  • a "patient” or “subject” to be treated by the method of the invention can mean either a human or non-human animal.
  • a PYY antagonist can be a compound which inhibits or decreases the interaction between a PYY protein and another molecule, e.g., a PYY receptor.
  • a preferred antagonist is a compound which inhibits or decreases binding of a PYY or PYY receptor transcription factor to the upstream region of a PYY or PYY receptor gene, or of an insulin gene transcription factor to the upstream region of an insulin gene, thereby blocking the synthesis of the insulin protein.
  • An antagonist can also be a compound that downregulates expression of a PYY or insulin gene or which reduces the amount of PYY or insulin protein present, e.g., by decreasing protein synthesis or increasing protein turnover.
  • the PYY antagonist can be a dominant negative form of a PYY polypeptide.
  • the PYY antagonist can also be a nucleic acid encoding a dominant negative form of a PYY polypeptide, a PYY antisense nucleic acid, or a ribozyme capable of interacting specifically with a PYY RNA.
  • Yet other PYY antagonists are molecules which bind to a PYY polypeptide or its receptor and inhibit its action. Such molecules include peptides, antibodies and small molecules.
  • ⁇ cell or “pancreatic ⁇ cell” are interchangeable as used herein and refer to cells in the pancreatic islets that are of the lineage of cells that produce insulin in response to glucose, ⁇ cells are found in the islets of Langerhans in the pancreas. Beta cells secrete insulin in a regulated fashion in response to blood glucose levels. In Type I or insulin dependent diabetes mellitus (IDDM) beta cells are destroyed through an auto-immune process. Since the body can no longer produce endogenous insulin, injections of exogenous insulin are required to maintain normal blood glucose levels.
  • IDDM insulin dependent diabetes mellitus
  • Bioactivity or “bioactivity” or “activity” or “biological function”, which are used interchangeably, for the purposes herein means an effector or antigenic function that is directly or indirectly performed by a PYY Therapeutic (whether in its native or denatured conformation), or by any subsequence thereof.
  • Biological activities include binding to a target nucleic acid e.g., an upstream region of a gene, which is regulated by an PYY induced transcription factor.
  • a PYY bioactivity can be modulated by directly affecting a PYY polypeptide.
  • a PYY bioactivity can be modulated by modulating the level of a PYY polypeptide, such as by modulating expression of a PYY gene or by modulating the turnover of the PYY protein.
  • the term "cellular composition” refers to a preparation of cells, which preparation may include, in addition to the cells, non-cellular components such as cell culture media, e.g. proteins, amino acids, nucleic acids, nucleotides, co-enzyme, anti- oxidants, metals and the like. Furthermore, the cellular composition can have components which do not affect the growth or viability of the cellular component, but which are used to provide the cells in a particular format, e.g., as polymeric matrix for encapsulation or a pharmaceutical preparation.
  • non-cellular components such as cell culture media, e.g. proteins, amino acids, nucleic acids, nucleotides, co-enzyme, anti- oxidants, metals and the like.
  • the cellular composition can have components which do not affect the growth or viability of the cellular component, but which are used to provide the cells in a particular format, e.g., as polymeric matrix for encapsulation or a pharmaceutical preparation.
  • tissue culture refers to the maintenance or growth of tissue, e.g., explants of organ primordia or of an adult organ ex vivo so as to preserve its architecture and function.
  • a "cell culture” refers to a growth of cells ex vivo or in vitro; although the cells proliferate they do not organize into tissue er se.
  • Tissue and cell culture preparations of the subject micro-organ explants and amplified progenitor or ⁇ cell populations can take on a variety of formats.
  • a "suspension culture” refers to a culture in which cells multiply while suspended in a suitable medium.
  • continuous flow culture refers to the cultivation of cells or ductal explants in a continuous flow of fresh medium to maintain cell growth, e.g., viability.
  • conditioned media refers to the supernatant, e.g., free of the cultured cells/tissue, resulting after a period of time in contact with the cultured cells such that the media has been altered to include certain paracrine and/or autocrine factors produced by the cells and secreted into the culture.
  • protease inhibitors preferably serine protease inhibitors, such as peptidyl boronic acids (boroProline), peptidyl aldehydes, peptidyl chloromethyl halides and the like.
  • enhancing differentiation of a cell is meant the act of increasing the extent of the acquisition or possession of one or more characteristics or functions which differ from that of the original cell (i.e., cell specialization). This can be detected by screening for a change in the phenotype of the cell (e.g., identifying morphological changes in the cell and/or surface markers on the cell).
  • enhancing survival or maintenance of a cell encompasses the step of increasing the extent of the possession of one or more characteristics or functions which are the same as that of the original cell (i.e., cell phenotype maintenance).
  • the term "explant” refers to a portion of an organ taken from the body and grown in an artificial medium.
  • the condition of "hyperglycemia” is a condition in which the blood glucose level is too high.
  • hyperglycemia occurs when the blood glucose level rises above 180 mg/dl. Symptoms of hyperglycemia include frequent urination, excessive thirst and, over a longer time span, weight loss.
  • hypoglycemia low blood sugar
  • hypoglycemia occurs when the blood glucose level falls below 70 mg/dl.
  • Symptoms of hypoglycemia include moodiness, numbness of the extremities (especially in the hands and arms), confusion, shakiness or dizziness. Since this condition arises when there is an excess of insulin over the amount of available glucose it is sometimes referred to as an insulin reaction.
  • impaired glucose tolerance is used to describe a person who, when given a glucose tolerance test, has a blood glucose level that falls between normal and hyperglycemic. Such a person is at a higher risk of developing diabetes although they are not considered to have diabetes.
  • the term “gene” or “recombinant gene” refers to a nucleic acid comprising an open reading frame encoding a polypeptide of the present invention, including both exon and (optionally) intron sequences.
  • a “recombinant gene” refers to nucleic acid encoding such regulatory polypeptides, which may optionally include intron sequences which are either derived from a chromosomal DNA.
  • glucose non-responsive or “glucose non-responsiveness” as used herein describe both the complete inability of cells, islets or animals to respond to treatment with or administration of glucose, as well as decreased responsiveness to glucose (e.g., by cells that do not produce sufficient levels of insulin in response to glucose or that require significantly higher levels of glucose to respond at normal levels).
  • heterologous DNA or “heterologous nucleic acid” include DNA that does not occur naturally as part of the genome in which it is present or which is found in a location or locations in the genome that differs from that in which it occurs in nature.
  • Heterologous DNA is not endogenous to the cell into which it is introduced, but has been obtained from another cell. Generally, although not necessarily, such DNA encodes RNA and proteins that are not normally produced by the cell in which it is expressed. Heterologous DNA may also be referred to as foreign DNA. Any DNA that one of skill in the art would recognize or consider as heterologous or foreign to the cell in which is expressed is herein encompassed by heterologous DNA.
  • nucleic acid refers to polynucleotides such as deoxyribonucleic acid (DNA), and, where appropriate, ribonucleic acid (RNA).
  • DNA deoxyribonucleic acid
  • RNA ribonucleic acid
  • the term should also be understood to include, as equivalents, analogs of either RNA or DNA made from nucleotide analogs, and, as applicable to the embodiment being described, single- stranded (such as sense or antisense) and double-stranded polynucleotides.
  • organ refers to two or more adjacent layers of tissue, which layers of tissue maintain some form of cell-cell and/or cell-matrix interaction to form a microarchitecture.
  • pancreas is art recognized, and refers generally to a large, elongated, racemose gland situated transversely behind the stomach, between the spleen and duodenum.
  • the pancreatic exocrine function e.g., external secretion, provides a source of digestive enzymes.
  • pancreatin refers to a substance from the pancreas containing enzymes, principally amylase, protease, and lipase, which substance is used as a digestive aid.
  • the exocrine portion is composed of several serous cells surrounding a lumen. These cells synthesize and secrete digestive enzymes such as trypsinogen, chymotrypsinogen, carboxypeptidase, ribonuclease, deoxyribonuclease, triacylglycerol lipase, phospholipase A2, elastase, and amylase.
  • digestive enzymes such as trypsinogen, chymotrypsinogen, carboxypeptidase, ribonuclease, deoxyribonuclease, triacylglycerol lipase, phospholipase A2, elastase, and amylase.
  • pancreatic cell refers to a cell which can produce a hormone or enzyme normally produced by a pancreatic cell, e.g., an at least partially differentiated ⁇ , ⁇ , ⁇ , or PP cell, and a cell, e.g., a pancreatic precursor cell, which can develop into a cell which can produce a hormone or enzyme normally produced by a pancreatic cell.
  • the pancreatic cells are characterized by the ability to produce glucagon and/or somatostatin.
  • the pancreatic cells of the invention can also be cultured prior to administration to a subject under conditions which promote cell proliferation and differentiation.
  • pancreatic endocrine cell refers to pancreatic cells (e.g., ⁇ , ⁇ , ⁇ , or PP cells) that secrete pancreatic hormone(s).
  • a pancreatic endocrine cell of the invention may be a fetal ⁇ cell or a post-partem ⁇ cell which has been treated with PYY to produce insulin in response to glucose.
  • pancreatic progenitor cell refers to a cell which can differentiate into a cell of pancreatic lineage, e.g., a cell which can produce a hormone or enzyme normally produced by a pancreatic cell.
  • a pancreatic progenitor cell may be caused to differentiate, at least partially, into ⁇ , ⁇ , ⁇ , or ⁇ cell, or a cell of exocrine fate.
  • Pancreatic progenitor cells can also be cultured prior to administration to a subject under conditions which promote cell proliferation and differentiation.
  • DNA synthesis has been determined using a radioactive label ( 3 H-thymidine) or labeled nucleotide analogues (BrdU) for detection by immuno fluorescence.
  • a radioactive label 3 H-thymidine
  • BrdU labeled nucleotide analogues
  • insulin secretion can be, and preferably will be, relied on as the basis for characterizing responsive fetal or progenitor cell populations.
  • the progenitor cells are characterized by an ability for self-regeneration in a culture medium and differentiation to pancreatic lineages.
  • the progenitor cells can be isolated from pancreatic intralobular duct explants, e.g., isolated by biopsy, or are the cell culture progeny of such cells.
  • the progenitor cells are inducible to differentiate into pancreatic islet cells, e.g., ⁇ islet cells, ⁇ islet cells, ⁇ islet cells, or ⁇ islet cells.
  • pancreatic progenitor cells may be characterized in certain circumstances by the expression of one or more of: homeodomain type transcription factors such as STF-1; PAX gene(s) such as PAX6; PTF-1 ; hXBP-1; HNF genes(s); villin; tyrosine hydroxylase; insulin; glucagon; and/or neuropeptide Y.
  • Preferred progenitor cells will be of mammalian origin, e.g., cells isolated from a primate such as a human, from a miniature swine, or from a transgenic mammal, or are the cell culture progeny of such cells.
  • Pancreatic ductal tissue may be isolated from a patient and subjected to the present method in order to provide a resulting culture of pancreatic progenitor cells (or differentiated cells derived therefrom).
  • Gene replacement or other gene therapy is carried out ex vivo, and the isolated cells are transplanted back into the initial donor patient or into a second host patient.
  • pancreatic ductal epithelium is obtained, e.g., by explant or enzymatic digestion, and cultured to confluence.
  • the confluent cell population is contacted with an agent, e.g., a trophic agent such as a growth factor, which causes differentiation of progenitor cells in the cultured population.
  • progenitor cells from the explant that proliferate in response to the agent are isolated, such as by direct mechanical separation of newly emerging buds from the rest of the explant or by dissolution of all or a portion of the explant and subsequent isolation of the progenitor cell population.
  • the agent may be Forskolin, Di-butyrl cAMP, Na-Butyrate, dexamethasone or cholera toxin or may be a growth factor such as IGF. TGF, FGF, EGF, HGF. hedgehog or VEGF or other member of the TGF ⁇ superfamily, preferably of the DVR (dpp and vgl related) family, e.g., BMP2 and/or BMP7.
  • another aspect of the present invention pertains to the progeny of the subject progenitor cells, e.g., those cells which have been derived from the cells of the initial explant culture.
  • Such progeny can include subsequent generations of progenitor cells, as well as lineage committed cells generated by inducing differentiation of the subject progenitor cells after their isolation from the explant, e.g., induced in vitro.
  • Exemplary viable progenitor cells, and methods for isolating such cells from pancreatic ductal tissues are provided in the U.S. provisional patent application attorney docket number ONN-060.60, which is incorporated herein by reference.
  • small ducts from rat pancreas are isolated after enzymatic digestion in collagenase A or collagenase H (Boehringer-Mannheim), washed and resuspended in HBSS (Ca/Mg free) and poured through a 500u mesh to remove large particles and washed again.
  • HBSS collagenase A or collagenase H
  • HBSS HBSS
  • the floating duct fragments are isolated manually with a pipette.
  • pancreas from 2 week rat pups can be separated on Percoll (Pharmacia).
  • the digested pancreas from are overlaid on a 40%> Percoll solution and centrifuged at 1900rpm/10min.
  • the duct fragments are located at the interface of buffer and Percoll at the top of the tube. This material is washed and placed in a 100mm dish. Contaminating islets (very few) are removed manually.
  • the fragments (including single cells) are washed again and plated for culture.
  • Duct fragments are preferentially cultured in Iscoves modified DMEM with 5% FBS and penicillin/streptomycin. Ideally the cells are cultured for 5 days to achieve a confluent monolayer that can then be induced to differentiate.
  • Confluence of the entire monolayer is not essential, differentiation can take place on any patch of confluent cells.
  • the monolayer can be grown in the presence of EGF (lOng/ml) or TGF- ⁇ (lOng/ml) to enhance growth.
  • Induction of differentiation is believed to be cAMP dependent. Agents which induce an increase in intracellular cAMP levels are anticipated to induce differentiation. Dexamethasone, cholera toxin, forskolin, dibutyrl cAMP and ⁇ a-Butyrate have all been tested and found to induce differentiation. Induction of differentiation is preferentially done in a single treatment for 48hr. Progenitor cells appear over the course of the 48hr treatment.
  • Treatment can also be done for 24 hr resulting in progenitor cells.
  • percent identical refers to sequence identity between two amino acid sequences or between two nucleotide sequences. Identity can each be determined by comparing a position in each sequence which may be aligned for purposes of comparison. When an equivalent position in the compared sequences is occupied by the same base or amino acid, then the molecules are identical at that position; when the equivalent site occupied by the same or a similar amino acid residue (e.g., similar in steric and/or electronic nature), then the molecules can be referred to as homologous (similar) at that position.
  • FASTA FASTA
  • BLAST BLAST
  • ENTREZ is available through the National Center for Biotechnology Information, National Library of Medicine, National Institutes of Health, Bethesda, Md.
  • the percent identity of two sequences can be determined by the GCG program with a gap weight of 1, e.g., each amino acid gap is weighted as if it were a single amino acid or nucleotide mismatch between the two sequences.
  • phenotype refers to the entire physical, biochemical, and physiological makeup of a cell, e.g., having any one trait or any group of traits.
  • progenitor cell refers to an undifferentiated cell which is capable of proliferation and giving rise to more progenitor cells having the ability to generate a large number of mother cells that can in turn give rise to differentiated, or differentiable daughter cells.
  • progenitor cell is also intended to encompass a cell which is sometimes referred to in the art as a "stem cell”.
  • progenitor cell refers to a generalized mother cell whose descendants (progeny) specialize, often in different directions, by differentiation, e.g., by acquiring completely individual characters, as occurs in progressive diversification of embryonic cells and tissues.
  • the term “subject” is intended to include mammals, particularly humans, susceptible to diseases characterized by insufficient insulin activity.
  • the term “substantially pure”, with respect to progenitor cells refers to a population of progenitor cells that is at least about 75%, preferably at least about 85%, more preferably at least about 90%, and most preferably at least about 95 % pure, with respect to progenitor cells making up a total cell population.
  • the term “substantially pure” refers to a population of progenitor cell of the present invention that contain fewer than about 20%, more preferably fewer than about 10%, most preferably fewer than about 5%, of lineage committed cells in the original unamplified and isolated population prior to subsequent culturing and amplification.
  • tissue refers to a group or layer of similarly specialized cells which together perform certain special functions.
  • transcriptional regulatory sequence is a generic term used throughout the specification to refer to DNA sequences, such as initiation signals, enhancers, and promoters, which induce or control transcription of protein coding sequences with which they are operably linked.
  • transcription of a recombinant gene is under the control of a promoter sequence (or other transcriptional regulatory sequence) which controls the expression of the recombinant gene in a cell-type in which expression is intended. It will also be understood that the recombinant gene can be under the control of transcriptional regulatory sequences which are the same or which are different from those sequences which control transcription of the naturally-occurring form of the protein.
  • vector refers to a nucleic acid molecule capable of transporting another nucleic acid to which it has been linked.
  • One type of preferred vector is an episome, i.e., a nucleic acid capable of extra-chromosomal replication.
  • Preferred vectors are those capable of autonomous replication and/expression of nucleic acids to which they are linked.
  • Vectors capable of directing the expression of genes to which they are operatively linked are referred to herein as "expression vectors”.
  • expression vectors of utility in recombinant DNA techniques are often in the form of "plasmids" which refer to circular double stranded DNA loops which, in their vector form are not bound to the chromosome.
  • plasmid and "vector” are used interchangeably as the plasmid is the most commonly used form of vector.
  • vector is intended to include such other forms of expression vectors which serve equivalent functions and which become known in the art subsequently hereto.
  • PYY is the predominant hormone of the pancreatic polypeptide family in developing mouse and rat pancreas. It is a member of the PP family of proteins, which also includes neuropeptide Y (NPY) and pancreatic polypeptide (PP).
  • NPY neuropeptide Y
  • PP pancreatic polypeptide
  • the sequence for human PYY is given by YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY (SEQ ID No: 1).
  • PYY inhibits intestinal motility and mesenteric blood flow to the gastrointestinal tract and pancreas, mediates gastric, pancreatic and intestinal exocrine secretion and stimulates net absorption
  • PYY has also been shown to inhibit the release of CCK, insulin, and glucagon in various animals (Lluis, F. et al. (1988) Gastroenterology 94:137-44; Guo, Y.S. et al. (1988) Pancreas 3:128-34; B ⁇ tteher, G. et al. (1989) Pancreas 4:282-88; Guo, Y.S. et al. (1989) Gastroenterology 96:690-94; Greeley et al. (1988) Am.
  • Peptide tyrosine tyrosine or peptide YY (“PYY”) is a 36 amino acid residue peptide amide isolated originally from porcine intestine and primarily localized in the mucosal endocrine cells of the distal intestine, and also produced in the proximal intestine and the pancreas.
  • Homologs and analogs of PYY can be generated by mutagenesis, such as by discrete point mutation(s), or by truncation. For instance, mutation can give rise to homologs which retain substantially the same, or merely a subset, of the biological activity of PYY.
  • antagonistic forms of the protein can be generated which are able to inhibit the function of the naturally occurring form of PYY, such as by competitively binding to a cognate receptor of PYY, thus blocking signal transduction.
  • agonistic forms of PYY may be generated which are constitutively active.
  • PYY and homologs thereof may be either positive or negative regulators of glucose responsivity in pancreatic islets or ⁇ cells.
  • PYY and fragments thereof can be purchased commercially (Bachem California 1993-1994 Catalogue, Torrance, Calif; Sigma peptides and amino acids 1994 Catalogue, St. Louis, Miss.). PYY analogs and mimetics may also be synthesized by many techniques that are known to those skilled in the peptide art. A summary of the many techniques available may be found in Solid Phase Peptide Synthesis 2 nd ed. (Stewart, J.M. and Young, J.D., Pierce Chemical Company, Rockford, II.. 1984). Other PYY analogs can be prepared by making appropriate modifications, within the ability of a person of ordinary skill in the art.
  • polypeptides referred to herein as having an activity (e.g., are "bioactive") of PYY are defined as polypeptides which include an amino acid sequence corresponding (e.g., identical or homologous) to all or a portion of the amino acid sequence of PYY and which mimic or antagonize all or a portion of the biological/biochemical activities of a naturally occurring PYY protein.
  • Such biological activity includes the induction or enhancement of glucose responsivity as demonstrated by induced or increased insulin production and other indicia of ⁇ cell differentiation, such as, for example, homeodomain type transcription factors such as STF-1 ; PAX gene(s) such as PAX6; PTF-1 ; hXBP-1; HNF genes(s); villin; tyrosine hydroxylase; insulin; glucagon; and/or Neuropeptide Y.
  • homeodomain type transcription factors such as STF-1 ; PAX gene(s) such as PAX6; PTF-1 ; hXBP-1; HNF genes(s); villin; tyrosine hydroxylase; insulin; glucagon; and/or Neuropeptide Y.
  • the bioactivity of a PYY analog may also include the ability to alter the transcriptional rate of a gene as, for example, a downstream component of a signal transduction cascade initiated by the interaction of a PYY analog with its cognate receptor.
  • a PYY polypeptide which represents a portion of the full-length polypeptide can be either an agonist (e.g., mimics or enhances), or alternatively, an antagonist of a biological activity of a naturally occurring form of the protein, e.g., the polypeptide is able to modulate differentiation and/or glucose responsiveness to authentic PYY proteins.
  • Homologs of the subject PYY proteins include versions of the protein which are resistant to proteolytic cleavage, as for example, due to mutations which alter potential cleavage sequences or which inactivate an enzymatic activity associated with the protein.
  • the PYY polypeptides of the present invention which represent portions of the full- length polypeptides, can be glycosylated, or conversely, by choice of the expression system or by modification of the protein sequence to preclude glycosylation, reduced carbohydrate analogs can also be provided.
  • Glycosylated forms include derivatization with glycosaminoglycan chains.
  • the subject proteins can also be provided as chimeric molecules, such as in the form of fusion proteins.
  • the PYY protein can be provided as a recombinant fusion protein which includes a second polypeptide portion, e.g., a second polypeptide having an amino acid sequence unrelated to PYY, e.g., the second polypeptide portion is glutathione-
  • the second polypeptide portion is an enzymatic activity such as alkaline phosphatase, e.g., the second polypeptide portion is an epitope tag.
  • the present invention provides therapeutic methods involving the use of the pancreatic cell cultures of the present invention.
  • the present invention provides a method of altering blood sugar levels comprising administering to an animal a cell culture of pancreatic endocrine cells which have been generated by the present method.
  • the cell culture used for altering blood sugar levels may be a primary cell culture of pancreatic endocrine cells, or a serially passaged culture thereof.
  • the cultured pancreatic endocrine cells of the present invention include ⁇ cells that secrete insulin in response to glucose concentration.
  • the subject method utilizes an isolated population of pancreatic cells obtained from an embryo (preferably of a non-human mammal that has been "humanized") at a developmental stage of about the equivalent of day e21 of gestation.
  • Pancreatic cells obtained from embryos can be cultured, e.g., as a monolayer of adherent non-insulin secreting cells in the presence of a PYY therapeutic. When these cells are allowed to reach confluence, they form islet-like aggregates or clusters and begin to secrete pancreatic hormones, such as insulin, glucagon, and somatostatin, and enzymes. At this point, such aggregates can be isolated, pooled, and administered to a recipient subject wherein they secrete insulin.
  • pancreatic hormones such as insulin, glucagon, and somatostatin, and enzymes.
  • about 100,000 to 500,000 aggregates each of which contains about 300 to 500 cells, can be used to treat one human.
  • 6-12 week fetuses do not respond to glucose but can be induced to produce insulin in a monophasic manner between 17 and 20 weeks but that this response is weak (1.6 fold).
  • Biphasic secretion of insulin is achieved after birth, between 26 and 44 weeks. (Otonkoski T, et al. Diabetes 1988 Mar 37(3):286-91). This suggests that the human fetal pancreas is already responsive to glucose during the first half of gestation, but the biphasic insulin release does not start to mature until the postnatal phase.
  • the method of altering blood sugar levels can also be accomplished using cultured pancreatic endocrine cells in a tissue-like form.
  • Such cultured pancreatic endocrine cells can form coherent aggregates spontaneously or by culturing techniques known in the art.
  • coherent aggregates are termed "pseudoislets" herein.
  • pseudoislets are embedded in a suitable biocompatable matrix, such as collagen, using methods known in the art.
  • the cultured pancreatic endocrine cells also may be formed into coherent aggregates by co-incubation with a suitable biocompatable material, such as collagen, whereby the cells are in the form of free suspensions prior to the co-incubation.
  • Pseudotissues form a biologically compatible graft that can be implanted into a mammal, and therein function to alter blood sugar levels.
  • the method involves grafting pancreatic endocrine cells as a pseudotissue, for example, into a mammal where the pseudotissue becomes vascularized and responds to the blood glucose levels in the host mammal by secreting insulin when the blood glucose levels attain a sufficiently high level.
  • Vascularization of the pseudotissue appears to be important in that in those experiments where the pseudotissue did not become vascularized, blood sugar levels were not regulated. Similarly, delayed vascularization of a pseudotissue appeared to impair the ability of the pseudotissue to regulate blood sugar levels.
  • the present invention is directed to a method of providing a glucose-responsive insulin-secreting capability to a mammal in need of such capability.
  • the method includes generally implanting engineered cells which secrete insulin in response to glucose into such a mammal. It is proposed by the inventor that techniques presently in use for the implantation of islets will be applicable to implantation of cells engineered in accordance with the present invention.
  • One method involves the encapsulation of engineered cells in a biocompatable coating. In this approach, cells are entrapped in a capsular coating that protects the encapsulated cells from immunological responses, and also serves to prevent uncontrolled proliferation of clonal engineered cells.
  • a preferred encapsulation technique involves encapsulation with alginate-polylysine-alginate. Capsules made employing this technique generally contain several hundred cells and have a diameter of approximately 1 mm.
  • the cells After successful encapsulation or fiber seeding, the cells, generally approximately 1,000-10,000, may be implanted intraperitoneally, usually by injection into the peritoneal cavity through a large gauge needle (23 gauge).
  • Further important embodiments concern methods of using the engineered cells of the present invention in the production of insulin, and particularly, in the production of human insulin which can be used in the treatment of IDDM.
  • the engineered artificial ⁇ cells are grown in culture and then contacted with a buffer containing glucose, thus stimulating the cells to produce and secrete insulin which can be collected and purified from the surrounding media.
  • CTG-6 engineered cells are contemplated to be of particular use, but any cell prepared to secrete insulin in response to glucose may be employed.
  • Still further aspects of the invention include methods of treating diseases or other disorders characterized by insufficient insulin activity in a subject, particularly a human subject.
  • These methods include administering to a subject, a PYY pharmaceutical and an isolated population of pancreatic cells including insulin-producing cells (e.g., ⁇ cells) or having the ability to differentiate to form insulin-secreting cells after administration to the subject.
  • insulin-producing cells e.g., ⁇ cells
  • transplantation are used interchangeably herein to refer to delivery of cells to a subject by a method or route which delivers the cells to a desired location.
  • treating includes reducing or alleviating at least one adverse effect or symptom, e.g., absolute or relative insulin deficiency, fasting hyperglycemia, glycosuria, development of atherosclerosis, microangiopathy, nephropathy, and neuropathy, of diseases characterized by insufficient insulin activity.
  • abnormal insulin function includes any abnormality or impairment in insulin production, e.g., expression and/or transport through cellular organelles, such as insulin deficiency resulting from, for example, loss of cells as in IDDM (Type I diabetes), secretion, such as impairment of insulin secretory responses as in NIDDM (Type II diabetes), form of the insulin molecule itself, e.g., primary, secondary or tertiary structure, effects of insulin on target cells, e.g., insulin-resistance in bodily tissues, e.g., peripheral tissues, and responses of target cells to insulin.
  • IDDM Type I diabetes
  • secretion such as impairment of insulin secretory responses as in NIDDM (Type II diabetes)
  • form of the insulin molecule itself e.g., primary, secondary or tertiary structure
  • effects of insulin on target cells e.g., insulin-resistance in bodily tissues, e.g., peripheral tissues, and responses of target cells to insulin.
  • target cells e.g., insulin
  • Sulphonylureas Sulphonylureas, biguanides (metformin), alpha-glucosidase inhibitors (acarbose) and insulin.
  • Insulin therapy may be required, especially in the later stages of the disease, to produce control of hyperglycemia in an attempt to minimize complications of the disease.
  • the most effective treatment of type II diabetes has been the alpha-glucosidase inhibitor, acarbose, which reduces postprandial glucose levels by retarding digestion of complex carbohydrates in the gut.
  • Other metabolically active drugs have proven too toxic.
  • sulphonylureas lower hyperglycaemia by increasing insulin secretion and potentiating insulin action on the liver and peripheral tissues.
  • Drugs such as the thiazolidine-diones (e.g., troglitazone, pioglitazone, darglitazone and YM268) enhance insulin action (i.e., are "insulin- sensitizing").
  • pancreatic cells are administered to the subject by any appropriate route which results in delivery of the cells to a desired location in the subject where the cells can proliferate and secrete a pancreatic hormone, e.g., insulin, or enzyme.
  • Preferred locations for pancreatic cell administration include those which rapidly vascularize.
  • Common methods of administering pancreatic cells to subjects, particularly human subjects include implantation of cells in a pouch of omentum (Yoneda, K. et al. (1989) Diabetes 38 (Suppl. 1):213-216), intraperitoneal injection of the cells, (Wahoff, D. C et al. (1994) Transplant. Proc. 26:804), implantation of the cells under the kidney capsule of the subject (See, e.g.,
  • the cells can be embedded in a plasma clot prepared from, e.g., plasma from the recipient subject (Simeonovic, D. J. et al. (1982) Aust. J. Exp. Biol. Med. Sci. 60:383) or a collagen matrix.
  • Cells can be administered in a pharmaceutically acceptable carrier or diluent.
  • PYY or a PYY agonist or antagonist or cellular compositions While it is possible for PYY or a PYY agonist or antagonist or cellular compositions to be administered as pure or substantially pure compounds/compositions, it is preferable that they be administered as pharmaceutical formulations or preparations.
  • the formulations to be used in the present invention, for both humans and animals, include PYY, PYY agonist or antagonist or cellular compositions, together with one or more pharmaceutically acceptable carriers therefor, and optionally other therapeutic ingredients.
  • the carrier must be "acceptable” in the sense of being compatible with the active ingredient(s) of the formulation (and preferably, capable of stabilizing peptides) and not deleterious to the subject to be treated.
  • formulations may conveniently be presented in unit dosage form and may be prepared by any of the methods well known in the art of pharmacy. All methods include the step of bringing the active ingredient(s) into association with the carrier which constitutes one or more accessory ingredients.
  • the present invention relates to pharmaceutical compositions of PYY Therapeutics or cellular compositions, and their uses in treating and/or preventing disorders which can be improved by altering the homeostasis of peptide hormones.
  • the inhibitors have hypoglycemic and anti-diabetic activities, and can be used in the treatment of disorders marked by aberrant glucose metabolism, including glucose storage.
  • the compositions of the subject methods are useful as insulinotropic agents, or to potentiate the insulinotropic effects of such molecules as GLP-1.
  • the present method can be useful for the treatment and/or prophylaxis of a variety of disorders, including one or more of: hyperlipemia, hyperglycemia, obesity, glucose tolerance insufficiency, insulin resistance and diabetic complications.
  • PYY Therapeutics or cellular compositions can be administered in various forms, depending on the disorder to be treated and the age, condition and body weight of the patient, as is well known in the art.
  • the compounds may be formulated as tablets, capsules, granules, powders or syrups; or for parenteral administration, they may be formulated as injections (intravenous, intramuscular or subcutaneous), drop infusion preparations or suppositories.
  • injections intravenous, intramuscular or subcutaneous
  • drop infusion preparations or suppositories For application by the ophthalmic mucous membrane route, they may be formulated as eye drops or eye ointments.
  • formulations can be prepared by conventional means, and, if desired, the active ingredient may be mixed with any conventional additive, such as an excipient, a binder, a disintegrating agent, a lubricant, a corrigent, a solubilizing agent, a suspension aid, an emulsifying agent or a coating agent.
  • an excipient such as an excipient, a binder, a disintegrating agent, a lubricant, a corrigent, a solubilizing agent, a suspension aid, an emulsifying agent or a coating agent.
  • a daily dosage of from 0.01 to 2000 mg of the compound is recommended for an adult human patient, and this may be administered in a single dose or in divided doses.
  • Glucose metabolism can be altered, and symptoms associated with type II diabetes can be decreased or eliminated, in accordance with a "timed" administration of a PYY Therapeutic wherein one or more appropriate indices for glucose metabolism and/or type
  • diabetes can be used to assess effectiveness of the treatment (including dosage and/or timing): e.g., glucose tolerance, glucose level, insulin level, insulin sensitivity or glycosylated hemoglobin.
  • An effective time for administering a PYY Therapeutic needs to be identified. This can be accomplished by routine experiment as described below, using one or more groups of animals (preferably at least 5 animals per group). In animals, insulinotropic activity by
  • PYY treatment can be assessed by administering a PYY Therapeutic at a particular time of day and measuring the effect of the administration (if any) by measuring one or more indices associated with glucose metabolism, preferably insulin release, and comparing the post-treatment values of these indices to the values of the same indices prior to treatment, or to control treatments.
  • the precise time of administration and/or amount of a PYY Therapeutic that will yield the most effective results in terms of efficacy of treatment in a given patient will depend upon the activity, pharmacokinetics, and bioavailability of a particular compound, physiological condition of the patient (including age, sex, disease type and stage, general physical condition, responsiveness to a given dosage and type of medication), route of administration, etc.
  • physiological condition of the patient including age, sex, disease type and stage, general physical condition, responsiveness to a given dosage and type of medication
  • route of administration etc.
  • the above guidelines can be used as the basis for fine-tuning the treatment, e.g., determining the optimum time and/or amount of administration, which will require no more than routine experimentation consisting of monitoring the subject and adjusting the dosage and/or timing.
  • glucose metabolism is monitored by measuring one or more of the relevant indices at predetermined times during a 24-hour period. Treatment (amounts, times of administration and type of medication) may be adjusted (optimized) according to the results of such monitoring.
  • the patient is periodically re- evaluated to determine extent of improvement by measuring the same parameters, the first such re-evaluation typically occurring at the end of four weeks from the onset of therapy, and subsequent re-evaluations occurring every 4 to 8 weeks during therapy and then every 3 months thereafter. Therapy may continue for several months or even years with six months being a typical length of therapy for humans.
  • Adjustments to the amount(s) of drug(s) administered and possibly to the time of administration may be made based on these re-evaluations. For example, if after 4 weeks of treatment one of the metabolic indices has not improved but at least one other one has, the dose could be increased by 1/3 without changing the time of administration. Treatment can be initiated with smaller dosages which are less than the optimum dose of the compound. Thereafter, the dosage should be increased by small increments until the optimum effect under the circumstances is reached. For convenience, the total daily dosage may be divided and administered in portions during the day if desired.
  • terapéuticaally-effective amount means that amount of, e.g., a PYY Therapeutic, which is effective for producing some desired therapeutic effect by enhancing, for example, the glucose responsiveness of pancreatic ⁇ cells at a reasonable benefit/risk ratio applicable to any medical treatment.
  • phrases "pharmaceutically acceptable” is employed herein to refer to those PYY, materials, compositions, and/or dosage forms which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of human beings and animals without excessive toxicity, irritation, allergic response, or other problem or complication, commensurate with a reasonable benefit/risk ratio.
  • pharmaceutically-acceptable carrier means a pharmaceutically-acceptable material, composition or vehicle, such as a liquid or solid filler, diluent, excipient, solvent or encapsulating material, involved in carrying or transporting the subject chemical from one organ, or portion of the body, to another organ, or portion of the body.
  • a pharmaceutically-acceptable material such as a liquid or solid filler, diluent, excipient, solvent or encapsulating material, involved in carrying or transporting the subject chemical from one organ, or portion of the body, to another organ, or portion of the body.
  • Each carrier must be “acceptable” in the sense of being compatible with the other ingredients of the formulation and not injurious to the patient.
  • materials which can serve as pharmaceutically-acceptable carriers include: (1) sugars, such as lactose, glucose and sucrose; (2) starches, such as corn starch and potato starch; (3) cellulose, and its derivatives, such as sodium carboxymethyl cellulose, ethyl cellulose and cellulose acetate; (4) powdered tragacanth; (5) malt; (6) gelatin; (7) talc; (8) excipients, such as cocoa butter and suppository waxes; (9) oils, such as peanut oil, cottonseed oil, safflower oil, sesame oil, olive oil, corn oil and soybean oil; (10) glycols, such as propylene glycol; (11) polyols, such as glycerin, sorbitol, mannitol and polyethylene glycol; (12) esters, such as ethyl oleate and ethyl laurate; (13) agar; (14) buffering agents, such as magnesium hydroxide and aluminum hydrox
  • pharmaceutically-acceptable salts refers to the relatively non-toxic, inorganic and organic acid addition salts of a PYY Therapeutic. These salts can be prepared in situ during the final isolation and purification of the PYY Therapeutic, or by separately reacting a purified PYY Therapeutic in its free base form with a suitable organic or inorganic acid, and isolating the salt thus formed.
  • Representative salts include the hydrobromide, hydrochloride, sulfate, bisulfate, phosphate, nitrate, acetate, valerate, oleate, palmitate, stearate, laurate, benzoate, lactate, phosphate, tosylate, citrate, maleate, fumarate, succinate, tartrate, napthylate, mesylate, glucoheptonate, lactobionate, and laurylsulphonate salts and the like.
  • sulfate bisulfate
  • phosphate nitrate
  • acetate valerate
  • oleate palmitate
  • stearate laurate
  • benzoate lactate
  • phosphate tosylate
  • citrate maleate
  • fumarate succinate
  • tartrate tartrate
  • napthylate mesylate
  • mesylate glucoheptonate
  • lactobionate lactobionate
  • the PYY useful in the methods of the present invention may contain one or more acidic functional groups and, thus, are capable of forming pharmaceutically- acceptable salts with pharmaceutically-acceptable bases.
  • pharmaceutically- acceptable salts in these instances refers to the relatively non-toxic, inorganic and organic base addition salts of a PYY Therapeutic.
  • salts can likewise be prepared in situ during the final isolation and purification of the PYY Therapeutic, or by separately reacting the purified PYY Therapeutic in its free acid form with a suitable base, such as the hydroxide, carbonate or bicarbonate of a pharmaceutically-acceptable metal cation, with ammonia, or with a pharmaceutically-acceptable organic primary, secondary or tertiary amine.
  • a suitable base such as the hydroxide, carbonate or bicarbonate of a pharmaceutically-acceptable metal cation, with ammonia, or with a pharmaceutically-acceptable organic primary, secondary or tertiary amine.
  • alkali or alkaline earth salts include the lithium, sodium, potassium, calcium, magnesium, and aluminum salts and the like.
  • Organic amines useful for the formation of base addition salts include ethylamine, diethylamine, ethylenediamine, ethanolamine, diethanolamine, piperazine and the like (see, e.g., Berge et al., supra).
  • wetting agents such as sodium lauryl sulfate and magnesium stearate, as well as coloring agents, release agents, coating agents, sweetening, flavoring and perfuming agents, preservatives and antioxidants can also be present in the compositions.
  • antioxidants examples include: (1) water soluble antioxidants, such as ascorbic acid, cysteine hydrochloride, sodium bisulfate, sodium metabisulfite, sodium sulfite and the like; (2) oil-soluble antioxidants, such as ascorbyl palmitate, butylated hydroxyanisole (BHA), butylated hydroxytoluene (BHT), lecithin, propyl gallate, alpha-tocopherol, and the like; and (3) metal chelating agents, such as citric acid, ethylenediamine tetraacetic acid (EDTA), sorbitol, tartaric acid, phosphoric acid, and the like.
  • water soluble antioxidants such as ascorbic acid, cysteine hydrochloride, sodium bisulfate, sodium metabisulfite, sodium sulfite and the like
  • oil-soluble antioxidants such as ascorbyl palmitate, butylated hydroxyanisole (BHA), butylated hydroxytoluene (BHT), le
  • Formulations useful in the methods of the present invention include those suitable for oral, nasal, topical (including buccal and sublingual), rectal, vaginal, aerosol and/or parenteral administration.
  • the formulations may conveniently be presented in unit dosage form and may be prepared by any methods well known in the art of pharmacy.
  • the amount of active ingredient which can be combined with a carrier material to produce a single dosage form will vary depending upon the host being treated, the particular mode of administration.
  • the amount of active ingredient which can be combined with a carrier material to produce a single dosage form will generally be that amount of the compound which produces a therapeutic effect.
  • compositions include the step of bringing into association a PYY Therapeutic with the carrier and, optionally, one or more accessory ingredients.
  • the formulations are prepared by uniformly and intimately bringing into association a PYY Therapeutic with liquid carriers, or finely divided solid carriers, or both, and then, if necessary, shaping the product.
  • Formulations suitable for oral administration may be in the form of capsules, cachets, pills, tablets, lozenges (using a flavored basis, usually sucrose and acacia or tragacanth), powders, granules, or as a solution or a suspension in an aqueous or non- aqueous liquid, or as an oil-in-water or water-in-oil liquid emulsion, or as an elixir or syrup, or as pastilles (using an inert base, such as gelatin and glycerin, or sucrose and acacia) and/or as mouth washes and the like, each containing a predetermined amount of a PYY
  • a compound may also be administered as a bolus, electuary or paste.
  • the active ingredient is mixed with one or more pharmaceutically-acceptable carriers, such as sodium citrate or dicalcium phosphate, and/or any of the following: (1) fillers or extenders, such as starches, lactose, sucrose, glucose, mannitol, and/or silicic acid; (2) binders, such as, for example, carboxymethylcellulose, alginates, gelatin, polyvinyl pyrrolidone, sucrose and/or acacia; (3) humectants, such as glycerol; (4) disintegrating agents, such as agar-agar, calcium carbonate, potato or tapioca starch, alginic acid, certain silicates, and sodium carbonate; (5) solution retarding agents, such as paraffin; (6) absorption accelerators, such as quaternary ammonium compounds; (7) wetting agents, such as, for example
  • compositions may also comprise buffering agents.
  • Solid compositions of a similar type may also be employed as fillers in soft and hard-filled gelatin capsules using such excipients as lactose or milk sugars, as well as high molecular weight polyethylene glycols and the like.
  • a tablet may be made by compression or molding, optionally with one or more accessory ingredients.
  • Compressed tablets may be prepared using binder (for example, gelatin or hydroxypropylmethyl cellulose), lubricant, inert diluent, preservative, disintegrant (for example, sodium starch glycolate or cross-linked sodium carboxymethyl cellulose), surface-active or dispersing agent.
  • Molded tablets may be made by molding in a suitable machine a mixture of the powdered peptide or peptidomimetic moistened with an inert liquid diluent.
  • Tablets, and other solid dosage forms may optionally be scored or prepared with coatings and shells, such as enteric coatings and other coatings well known in the pharmaceutical-formulating art. They may also be formulated so as to provide slow or controlled release of the active ingredient therein using, for example, hydroxypropylmethyl cellulose in varying proportions to provide the desired release profile, other polymer matrices, liposomes and/or microspheres. They may be sterilized by, for example, filtration through a bacteria-retaining filter, or by incorporating sterilizing agents in the form of sterile solid compositions which can be dissolved in sterile water, or some other sterile injectable medium immediately before use.
  • compositions may also optionally contain opacifying agents and may be of a composition that they release the active ingredient(s) only, or preferentially, in a certain portion of the gastrointestinal tract, optionally, in a delayed manner.
  • opacifying agents include polymeric substances and waxes.
  • the active ingredient can also be in micro-encapsulated form, if appropriate, with one or more of the above-described excipients.
  • Liquid dosage forms for oral administration include pharmaceutically acceptable emulsions, microemulsions, solutions, suspensions, syrups and elixirs.
  • the liquid dosage forms may contain inert diluents commonly used in the art, such as, for example, water or other solvents, solubilizing agents and emulsifiers, such as ethyl alcohol, isopropyl alcohol, ethyl carbonate, ethyl acetate, benzyl alcohol, benzyl benzoate, propylene glycol, 1,3-butylene glycol, oils (in particular, cottonseed, groundnut, corn, germ, olive, castor and sesame oils), glycerol, tetrahydrofuryl alcohol, polyethylene glycols and fatty acid esters of sorbitan, and mixtures thereof.
  • inert diluents commonly used in the art, such as, for example, water or other solvents, solubilizing agents and emulsifiers
  • the oral compositions can also include adjuvants such as wetting agents, emulsifying and suspending agents, sweetening, flavoring, coloring, perfuming and preservative agents.
  • adjuvants such as wetting agents, emulsifying and suspending agents, sweetening, flavoring, coloring, perfuming and preservative agents.
  • Suspensions in addition to the active PYY Therapeutics or cellular compositions may contain suspending agents as, for example, ethoxylated isostearyl alcohols, polyoxyethylene sorbitol and sorbitan esters, microcrystalline cellulose, aluminum metahydroxide, bentonite, agar-agar and tragacanth, and mixtures thereof.
  • suspending agents as, for example, ethoxylated isostearyl alcohols, polyoxyethylene sorbitol and sorbitan esters, microcrystalline cellulose, aluminum metahydroxide, bentonite, agar-agar and tragacanth, and mixtures thereof.
  • Formulations for rectal or vaginal administration may be presented as a suppository, which may be prepared by mixing one or more PYY Therapeutics with one or more suitable nonirritating excipients or carriers comprising, for example, cocoa butter, polyethylene glycol, a suppository wax or a salicylate, and which is solid at room temperature, but liquid at body temperature and, therefore, will melt in the rectum or vaginal cavity and release the active agent.
  • suitable nonirritating excipients or carriers comprising, for example, cocoa butter, polyethylene glycol, a suppository wax or a salicylate, and which is solid at room temperature, but liquid at body temperature and, therefore, will melt in the rectum or vaginal cavity and release the active agent.
  • Formulations which are suitable for vaginal administration also include pessaries, tampons, creams, gels, pastes, foams or spray formulations containing such carriers as are known in the art to be appropriate.
  • Dosage forms for the topical or transdermal administration of a PYY Therapeutic include powders, sprays, ointments, pastes, creams, lotions, gels, solutions, patches and inhalants.
  • the active component may be mixed under sterile conditions with a pharmaceutically-acceptable carrier, and with any preservatives, buffers, or propellants which may be required.
  • the ointments, pastes, creams and gels may contain, in addition to PYY Therapeutic, excipients, such as animal and vegetable fats, oils, waxes, paraffins, starch, tragacanth, cellulose derivatives, polyethylene glycols, silicones, bentonites, silicic acid, talc and zinc oxide, or mixtures thereof.
  • Powders and sprays can contain, in addition to a PYY Therapeutic, excipients such as lactose, talc, silicic acid, aluminum hydroxide, calcium silicates and polyamide powder, or mixtures of these substances.
  • Sprays can additionally contain customary propellants, such as chlorofluorohydrocarbons and volatile unsubstituted hydrocarbons, such as butane and propane.
  • PYY Therapeutics can be alternatively administered by aerosol. This is accomplished by preparing an aqueous aerosol, liposomal preparation or solid particles containing the compound. A nonaqueous (e.g., fluorocarbon propellant) suspension could be used.
  • Sonic nebulizers are preferred because they minimize exposing the agent to shear, which can result in degradation of the compound.
  • an aqueous aerosol is made by formulating an aqueous solution or suspension of the agent together with conventional pharmaceutically acceptable carriers and stabilizers.
  • the carriers and stabilizers vary with the requirements of the particular compound, but typically include nonionic surfactants (T weens, Pluronics, or polyethylene glycol), innocuous proteins like serum albumin, sorbitan esters, oleic acid, lecithin, amino acids such as glycine, buffers, salts, sugars or sugar alcohols. Aerosols generally are prepared from isotonic solutions.
  • Transdermal patches have the added advantage of providing controlled delivery of a PYY Therapeutic to the body.
  • dosage forms can be made by dissolving or dispersing the agent in the proper medium.
  • Absorption enhancers can also be used to increase the flux of the peptidomimetic across the skin. The rate of such flux can be controlled by either providing a rate controlling membrane or dispersing the peptidomimetic in a polymer matrix or gel.
  • compositions of this invention suitable for parenteral administration comprise a PYY Therapeutic in combination with one or more pharmaceutically-acceptable sterile isotonic aqueous or nonaqueous solutions, dispersions, suspensions or emulsions, or sterile powders which may be reconstituted into sterile injectable solutions or dispersions just prior to use, which may contain antioxidants, buffers, bacteriostats, solutes which render the formulation isotonic with the blood of the intended recipient or suspending or thickening agents.
  • aqueous and nonaqueous carriers examples include water, ethanol, polyols (e.g., such as glycerol, propylene glycol, polyethylene glycol, and the like), and suitable mixtures thereof, vegetable oils, such as olive oil, and injectable organic esters, such as ethyl oleate.
  • polyols e.g., such as glycerol, propylene glycol, polyethylene glycol, and the like
  • vegetable oils such as olive oil
  • injectable organic esters such as ethyl oleate.
  • Proper fluidity can be maintained, for example, by the use of coating materials, such as lecithin, by the maintenance of the required particle size in the case of dispersions, and by the use of surfactants.
  • compositions may also contain adjuvants such as preservatives, wetting agents, emulsifying agents and dispersing agents. Prevention of the action of microorganisms may be ensured by the inclusion of various antibacterial and antifungal agents, for example, paraben, chlorobutanol, phenol sorbic acid, and the like. It may also be desirable to include isotonic agents, such as sugars, sodium chloride, and the like into the compositions. In addition, prolonged absorption of the injectable pharmaceutical form may be brought about by the inclusion of agents which delay absorption such as aluminum monostearate and gelatin. In some cases, in order to prolong the effect of a drug, it is desirable to slow the absorption of the drug from subcutaneous or intramuscular injection.
  • adjuvants such as preservatives, wetting agents, emulsifying agents and dispersing agents.
  • Prevention of the action of microorganisms may be ensured by the inclusion of various antibacterial and antifungal agents, for example, paraben, chlorobutan
  • Injectable depot forms are made by forming microencapsule matrices of a PYY Therapeutic or in biodegradable polymers such as polylactide-polyglycolide. Depending on the ratio of drug to polymer, and the nature of the particular polymer employed, the rate of drug release can be controlled. Examples of other biodegradable polymers include poly(orthoesters) and poly(anhydrides). Depot injectable formulations are also prepared by entrapping the drug in liposomes or microemulsions which are compatible with body tissue.
  • a PYY Therapeutic or cellular compositions When a PYY Therapeutic or cellular compositions is administered as a pharmaceutical, to humans and animals, it can be given per se or as a pharmaceutical composition containing, for example, 0.1 to 99.5%) (more preferably, 0.5 to 90%) of active ingredient in combination with a pharmaceutically acceptable carrier.
  • a pharmaceutical composition containing, for example, 0.1 to 99.5%) (more preferably, 0.5 to 90%) of active ingredient in combination with a pharmaceutically acceptable carrier.
  • the preparations of agents may be given orally, parenterally, topically, or rectally.
  • parenteral administration and “administered parenterally” as used herein means modes of administration other than enteral and topical administration, usually by injection, and includes, without limitation, intravenous, intramuscular, intraarterial, intrathecal, intracapsular, infraorbital, intra cardiac, intradermal, intraperitoneal, transtracheal, subcutaneous, subcuticular, intraarticular, subcapsular, subarachnoid, intraspinal and intrasternal injection and infusion.
  • systemic administration means the administration of a PYY Therapeutic, drug or other material other than directly into the central nervous system, such that it enters the patient's system and, thus, is subject to metabolism and other like processes, for example, subcutaneous administration.
  • a PYY Therapeutic may be administered to humans and other animals for therapy by any suitable route of administration, including orally, nasally, as by, for example, a spray, rectally, intravaginally, parenterally, intracisternally and topically, as by powders, ointments or drops, including buccally and sublingually.
  • a PYY Therapeutic which may be used in a suitable hydrated form, and/or the pharmaceutical compositions of the present invention, are formulated into pharmaceutically-acceptable dosage forms by conventional methods known to those of skill in the art.
  • Another aspect of the invention provides a conjoint therapy wherein one or more other therapeutic agents are administered with a PYY Therapeutic or cellular compositions.
  • Such conjoint treatment may be achieved by way of the simultaneous, sequential or separate dosing of the individual components of the treatment.
  • a PYY Therapeutic or cellular compositions may be administered alone or in combination with other agents that augments the biological activity of PYY, the biological effect of PYY or to lessen any possible side-effects.
  • WO 9511689 describes the use of dipeptidylpeptidase inhibitors, such as inhibitors of dipeptidylpeptidase IV (DPIV) enzyme, which are able to inhibit the proteo lysis of PYY, thereby increasing PYY's plasma half-life.
  • DPIV dipeptidylpeptidase IV
  • a PYY Therapeutic may be conjointly administered with a dipeptidylpeptidase inhibitor.
  • a PYY Therapeutic or cellular compositions can be conjointly administered with a an Ml receptor antagonist.
  • Cholinergic agents are potent modulators of insulin release that act via muscarinic receptors. Moreover, the use of such agents can have the added benefit of decreasing cholesterol levels, while increasing HDL levels.
  • Suitable muscarinic receptor antagonists include substances that directly or indirectly block activation of muscarinic cholinergic receptors. Preferably, such substances are selective (or are used in amounts that promote such selectivity) for the Ml receptor.
  • Nonlimiting examples include quaternary amines (e.g., methantheline, ipratropium, and propantheline), tertiary amines (e.g., as dicyclomine, scopolamine) and tricyclic amines (e.g., telenzepine). Pirenzepine and methyl scopolamine are preferred.
  • Other suitable muscarinic receptor antagonists include benztropine (commercially available as
  • HHSID hydrochloride disclosed in Lambrecht, et al. (1989) Trends in Pharmacol Sci. 10(Suppl):60; ( +/- )-3- quinuclidinyl xanthene-9-carboxylate hemioxalate (QNX-hemioxalate; Birdsall, et al. (1983) Trends in Pharmacol. Sci. 4:459; telenzepine dihydrochloride (Coruzzi, et al. (1989) Arch. Int. Pharmacodyn. Ther. 302:232; and Kawashima, et al. (1990) Gen. Pharmacol.
  • muscarinic receptor antagonists will be generally subject to optimization as outlined above. In the case of lipid metabolism disorders, dosage optimization may be necessary independently of whether administration is timed by reference to the lipid metabolism responsiveness window or not.
  • a PYY Therapeutic or cellular compositions may also act synergistically with prolactin inhibitors such as d2 dopamine agonists (e.g., bromocriptine).
  • prolactin inhibitors such as d2 dopamine agonists (e.g., bromocriptine).
  • the subject method can include the conjoint administration of such prolactin inhibitors as prolactin-inhibiting ergo alkaloids and prolactin-inhibiting dopamine agonists.
  • suitable compounds include 2-bromo-alpha-ergocriptine, 6-methyl-8 beta- carbobenzyloxyaminoethyl- 10-alpha-ergoline, 8-acylaminoergo lines, 6-methyl-8-alpha-(N- acyl)amino-9-ergoline, 6-methyl-8-alpha-(N-phenylacetyl)amino-9-ergoline, ergocornine,
  • Agonists such as Ach, cholecystokinin (CCK) or bombesin bind to cell surface receptors that are coupled via the heterotrimeric G protein G q to phospholipase C (PLC).
  • Ach cholecystokinin
  • CCK cholecystokinin
  • PLC phospholipase C
  • Receptor occupancy activates PLC with the consequent generation of IP 3 and DAG by the hydrolysis of PIP 3 .
  • Ca 2+ released from the endoplasmic reticulum by IP 3 may be important for activation of the ⁇ and ⁇ isoforms of PKC and DAG can activate the ⁇ , ⁇ , ⁇ and ⁇ isoforms of PKC.
  • a PYY Therapeutic or cellular compositions used according to the invention can also be used conjointly with agents acting on the ATP-dependent potassium channel of the ⁇ -cells, such as glibenclamide, glipizide, gliclazide and AG-EE 623 ZW.
  • PYY or its analog or mimetic may also advantageously be applied in combination with other oral agents such as metformin and related compounds or glucosidase inhibitors as, for example, acarbose.
  • Another aspect of the present invention relates to diagnostic assays to access the risk of a patient developing diabetes or other glucose metabolic disorder, and to determine the pathology of patients who have already been diagnosed with such disorders.
  • the regulation of PYY is monitored in order to identify patients at risk of developing type II diabetes.
  • the assay may assess a decrease in the level of PYY in the serum or other bodily fluid of the patient. Such decreases may be the result of, inter alia, a decrease in the level of expression or secretion of PYY, or a decrease in the serum half life of the protein.
  • the assay detects mutated PYY proteins, e.g., based on bioactivity or appearance or disappearance of an epitope, which may give rise to decreased activity, e.g., reduced receptor binding or loss or agonist activity.
  • the assay detects abnormalities of the level of the PYY gene, e.g., point mutations such as base pair changes, additions or deletions to the coding sequence or transcriptional regulatory sequences.
  • the present method provides a method for determining if a subject is at risk for a disorder characterized by decreased glucose-sensing.
  • method can be generally characterized as comprising detecting, in a sample of cells from the subject, the presence or absence of a genetic lesion characterized by at least one of (i) an alteration affecting the integrity of a gene encoding a PYY protein, (ii) the mis- expression of the PYY gene, or (iii) aberrant modification of the PYY gene product.
  • such genetic lesions can be detected by ascertaining the existence of at least one of (i) a deletion of one or more nucleotides from a PYY gene, (ii) an addition of one or more nucleotides to a PYY gene, (iii) a substitution of one or more nucleotides of a PYY gene, (iv) a gross chromosomal rearrangement of a PYY gene, (v) a gross alteration in the level of a messenger RNA transcript of a PYY gene, (vii) aberrant modification of a PYY gene, such as of the methylation pattern of the genomic DNA, (vii) the presence of a non-wild type splicing pattern of a messenger RNA transcript of a PYY gene, (viii) a non-wild type level of a PYY protein, (ix) allelic loss of the PYY gene, and (x) inappropriate post- translational modification of a PYY-protein.
  • the present invention provides a large number of assay techniques for detecting lesions in a PYY gene, and importantly, provides the ability to discern between different molecular causes underlying PYY-dependent aberrant cell growth, proliferation and/or differentiation.
  • the assay is used to detect point mutations to the secretion signal sequence which eliminates the site of secretion of the mature PYY protein. For instance, the assay may detect a base pair change which gives rise to Thr (-17) ⁇ Asn or Thr (-16) ⁇ Pro.
  • Nucleic acid probes can be used to determine the PYY phenotype of cell and tissue samples, e.g., as a part of a diagnostic test kit for identifying cells or tissue which misexpress PYY, such as by measuring a level of a PYY-encoding nucleic acid in a sample of cells from a patient; e.g. detecting PYY mRNA levels or determining whether a genomic sequence
  • PYY gene has been mutated or deleted.
  • nucleotide probes can be generated from the subject PYY genes which facilitate histological screening of intact tissue and tissue samples for the presence (or absence) of PYY-encoding transcripts. Similar to the diagnostic uses of anti-PYY antibodies, infra, the use of probes directed to PYY messages, or to genomic PYY sequences, can be used for both predictive and therapeutic evaluation of allelic mutations which might be manifest in, for example, neoplastic or hyperplastic disorders (e.g. unwanted cell growth) or abnormal differentiation of tissue.
  • the oligonucleotide probes can help facilitate the determination of the molecular basis for a developmental disorder which may involve some abnormality associated with expression (or lack thereof) of a PYY protein. For instance, variation in polypeptide synthesis, post-translational modification, or half-life can be differentiated from a mutation in a coding sequence.
  • a nucleic acid composition comprising a (purified) oligonucleotide probe including a region of nucleotide sequence which is capable of hybridizing to a sense or antisense sequence of a PYY gene, such as represented by SEQ ID No: 1, or naturally occurring mutants thereof, or 5' or 3' flanking sequences or intronic sequences naturally associated with the subject PYY gene or naturally occurring mutants thereof.
  • the nucleic acid of a cell is rendered accessible for hybridization, the probe is exposed to nucleic acid of the sample, and the hybridization of the probe to the sample nucleic acid is detected.
  • Such techniques can be used to detect lesions at either the genomic or mRNA level, including deletions, substitutions, etc., as well as to determine mRNA transcript levels.
  • detection of the lesion comprises utilizing the probe/primer in a polymerase chain reaction (PCR) (see, e.g. U.S. Patent Nos. 4,683,195 and 4,683,202), such as anchor PCR or RACE PCR, or, alternatively, in a ligation chain reaction (LCR) (see, e.g., Landegran et al. (1988) Science 241 :1077-1080; and Nakazawa et al. (1944) PNAS 91:360-364), the later of which can be particularly useful for detecting point mutations in the PYY gene.
  • PCR polymerase chain reaction
  • LCR ligation chain reaction
  • the method includes the steps of (i) collecting a sample of cells from a patient, (ii) isolating nucleic acid (e.g., genomic, mRNA or both) from the cells of the sample, (iii) contacting the nucleic acid sample with one or more primers which specifically hybridize to a PYY gene under conditions such that hybridization and amplification of the PYY gene (if present) occurs, and (iv) detecting the presence or absence of an amplification product, or detecting the size of the amplification product and comparing the length to a control sample.
  • nucleic acid e.g., genomic, mRNA or both
  • mutations in a PYY gene from a sample cell are identified by alterations in restriction enzyme cleavage patterns.
  • sample and control DNA is isolated, amplified (optionally), digested with one or more restriction endonucleases, and fragment length sizes are determined by gel electrophoresis.
  • sequence specific ribozymes see, for example, U.S. Patent No. 5,498,531 can be used to score for the presence of specific mutations by development or loss of a ribozyme cleavage site.
  • any of a variety of sequencing reactions known in the art can be used to directly sequence the PYY gene and detect mutations by comparing the sequence of the sample PYY with the corresponding wild-type (control) sequence.
  • Exemplary sequencing reactions include those based on techniques developed by Maxim and Gilbert (Proc. Natl Acad Sci USA (1977) 74:560) or Sanger (Sanger et al (1977) Proc. Nat. Acad. Sci 74:5463). It is also contemplated that any of a variety of automated sequencing procedures may be utilized when performing the subject assays (Biotechniques (1995) 19:448), including by sequencing by mass spectrometry (see, for example PCT publication WO 94/16101 ; Cohen et al. (1996) Adv Chromatogr 36:127-162; and Griffin et al. (1993) Appl Biochem Biotechnol 38: 147-159).
  • the occurence of only one, two or three of the nucleic acid bases need be determined in the sequencing reaction.
  • A-tract or the like e.g., where only one nucleic acid is detected, can be carried out.
  • protection from cleavage agents can be used to detect mismatched bases in RNA RNA or RNA/DNA heteroduplexes (Myers, et al. (1985) Science 230:1242).
  • cleavage agents such as a nuclease, hydroxylamine or osmium tetroxide and with piperidine
  • cleavage agents such as a nuclease, hydroxylamine or osmium tetroxide and with piperidine
  • mismatched bases in RNA RNA or RNA/DNA heteroduplexes Myers, et al. (1985) Science 230:1242).
  • mismatch cleavage starts by providing heteroduplexes formed by hybridizing (labelled) RNA or DNA containing the wild-type PYY sequence with potentially mutant RNA or DNA obtained from a tissue sample.
  • RNA/DNA duplexes can be treated with RNase and DNA/DNA hybrids treated with SI nuclease to enzymatically digesting the mismatched regions.
  • either DNA DNA or RNA/DNA duplexes can be treated with hydroxylamine or osmium tetroxide and with piperidine in order to digest mismatched regions. After digestion of the mismatched regions, the resulting material is then separated by size on denaturing polyacrylamide gels to determine the site of mutation. See, for example, Cotton et al (1988) Proc. Natl Acad Sci USA 85:4397; Saleeba et al (1992) Methods Enzymod.
  • control DNA or RNA can be labeled for detection.
  • the mismatch cleavage reaction employs one or more proteins that recognize mismatched base pairs in double-stranded DNA (so called "DNA mismatch repair" enzymes) in defined systems for detecting and mapping point mutations in PYY cDNAs obtained from samples of cells.
  • DNA mismatch repair enzymes
  • the mutY enzyme of E. coli cleaves A at G/A mismatches and the thymidine DNA glycoslase from HeLa cells cleaves T at G/T mismatches (Hsu et al. (1994) Carcinogenesis 15:1657-1662).
  • a probe based on a PYY sequence e.g., a wild-type PYY sequence
  • a cDNA or other DNA product from a test cell(s).
  • the duplex is treated with a DNA mismatch repair enzyme, and the cleavage products, if any, can be detected from electrophoresis protocols or the like. See, for example, U.S. Patent No. 5,459,039.
  • alterations in electrophoretic mobility will be used to identify mutations in PYY genes.
  • single strand conformation polymorphism SSCP
  • SSCP single strand conformation polymorphism
  • Single- stranded DNA fragments of sample and control PYY nucleic acids will be denatured and allowed to renature.
  • the secondary structure of single-stranded nucleic acids varies according to sequence, the resulting alteration in electrophoretic mobility enables the detection of even a single base change.
  • the DNA fragments may be labelled or detected with labelled probes.
  • the sensitivity of the assay may be enhanced by using RNA (rather than DNA), in which the secondary structure is more sensitive to a change in sequence.
  • the subject method utilizes heteroduplex analysis to separate double stranded heteroduplex molecules on the basis of changes in electrophoretic mobility
  • the movement of mutant or wild-type fragments in polyacrylamide gels containing a gradient of denaturant is assayed using denaturing gradient gel electrophoresis (DGG ⁇ ) (Myers et al (1985) Nature 313:495).
  • DGG ⁇ denaturing gradient gel electrophoresis
  • DNA will be modified to insure that it does not completely denature, for example by adding a GC clamp of approximately 40 bp of high- melting GC-rich DNA by PCR.
  • a temperature gradient is used in place of a denaturing agent gradient to identify differences in the mobility of control and sample DNA (Rosenbaum and Reissner (1987) Biophys Chem 265:12753).
  • oligonucleotide primers may be prepared in which the known mutation is placed centrally and then hybridized to target DNA under conditions which permit hybridization only if a perfect match is found (Saiki et al. (1986) Nature 324:163); Saiki et al (1989) Proc. Natl Acad. Sci USA 86:6230).
  • Such allele speicific oligonucleotide hybridization techniques may be used to test one mutation per reaction when oligonucleotides are hybridized to PCR amplified target DNA or a number of different mutations when the oligonucleotides are attached to the hybridizing membrane and hybridized with labelled target DNA.
  • PCR amplification may be used in conjunction with the instant invention.
  • Oligonucleotides used as primers for specific amplification may carry the mutation of interest in the center of the molecule (so that amplification depends on differential hybridization) (Gibbs et al (1989) Nucleic Acids Res. 17:2437-2448) or at the extreme 3' end of one primer where, under appropriate conditions, mismatch can prevent, or reduce polymerase extension
  • amplification may also be performed using Taq ligase for amplification (Barany (1991) Proc. Natl. Acad. Sci USA 88:189). In such cases, ligation will occur only if there is a perfect match at the 3' end of the 5' sequence making it possible to detect the presence of a known mutation at a specific site by looking for the presence or absence of amplification.
  • aberrant methylation patterns of a PYY gene can be detected by digesting genomic DNA from a patient sample with one or more restriction endonucleases that are sensitive to methylation and for which recognition sites exist in the PYY gene (including in the flanking and intronic sequences). See, for example, Buiting et al. (1994) Human Mol Genet 3:893-895. Digested DNA is separated by gel electrophoresis, and hybridized with probes derived from, for example, genomic or cDNA sequences. The methylation status of the PYY gene can be determined by comparison of the restriction pattern generated from the sample DNA with that for a standard of known methylation.
  • the level of a PYY protein can be detected by immunoassay.
  • the serum samples can be obtained, and the level of a PYY protein present in the sample can be quantitated by standard immunoassay techniques.
  • the subject assay can be designed to detect aberrant post- translational modification of the PYY protein, such as aberrant phosphorylation, prenylation, lipid modification, ubiquitination, and/or degradation.
  • the assay can also be used to assess tissue localization of PYY.
  • alterations of the wild-type PYY locus which result in loss-of- function of PYY are detected.
  • the method can be performed by detecting the wild-type PYY locus and confirming the lack of a predisposition to diabetes at the PYY locus.
  • “Alteration of a wild- type gene” encompasses all forms of mutations including deletions, insertions and point mutations in the coding and noncoding regions. Deletions may be of the entire gene or of only a portion of the gene. Point mutations may result in stop codons, frameshift mutations or amino acid substitutions. Somatic mutations are those which occur only in certain tissues and are not inherited in the germline. The finding of PYY mutations can thus provide both diagnostic and prognostic information. A PYY allele which is not deleted (e.g., found on the sister chromosome to a chromosome carrying a PYY deletion) can be screened for other mutations, such as insertions, small deletions, and point mutations.
  • Point mutational events may occur in regulatory regions, such as in the promoter of the gene, leading to loss or diminution of expression of the mRNA. Point mutations may also abolish proper RNA processing, leading to loss of expression of the PYY gene product, or to a decrease in mRNA stability or translation efficiency.
  • useful diagnostic techniques include, but are not limited to fluorescent in situ hybridization (FISH), direct DNA sequencing, PFGE analysis, Southern blot analysis, single stranded conformation analysis (SSCA), RNase protection assay, allele-specific oligonucleotide (ASO), dot blot analysis LCR, and PCR -SSCP.
  • Direct DNA sequencing either manual sequencing or automated fluorescent sequencing can detect sequence variation.
  • manual sequencing is not necessarily labor-intensive, and under optimal conditions, mutations in the coding sequence of a gene will rarely be missed.
  • Another approach is the single-stranded conformation polymorphism assay (SSCA). This method does not detect all sequence changes, especially if the DNA fragment size is greater than 200 bp, but can be optimized to detect most DNA sequence variation.
  • SSCA single-stranded conformation polymorphism assay
  • the fragments which have shifted mobility on SSCA gels are then sequenced to determine the exact nature of the DNA sequence variation.
  • Other approaches based on the detection of mismatches between the two complementary DNA strands include clamped denaturing gel electrophoresis (CDGE), heteroduplex analysis (HA), and chemical mismatch cleavage (CMC). None of the methods described above will detect large deletions, duplications or insertions, nor will they detect a regulatory mutation which affects transcription or translation of the protein. Other methods which might detect these classes of mutations such as a protein truncation assay or the asymmetric assay, detect only specific types of mutations and would not detect missense mutations. Once a mutation is known, an allele specific detection approach such as allele specific oligonucleotide (ASO) hybridization can be utilized to rapidly screen large numbers of other samples for that same mutation.
  • ASO allele specific oligonucleotide
  • a rapid preliminary analysis to detect polymorphisms in DNA sequences can be performed by looking at a series of Southern blots of DNA cut with one or more restriction enzymes, preferably with a large number of restriction enzymes. Each blot contains a series of normal individuals and a series of cancer cases, tumors, or both. Southern blots displaying hybridizing fragments (differing in length from control DNA when probed with sequences near or including the PYY locus) indicate a possible mutation. If restriction enzymes which produce very large restriction fragments are used, then pulsed field gel electrophoresis (PFGE) is employed.
  • PFGE pulsed field gel electrophoresis
  • Detection of point mutations may be accomplished by molecular cloning of the PYY allele(s) and sequencing the allele(s) using techniques well known in the art.
  • the gene sequences can be amplified directly from a genomic DNA preparation using known techniques. The DNA sequence of the amplified sequences can then be determined.
  • Amplification Refractory Mutation System can also be used, as disclosed in European Patent Application Publication No. 0332435. Insertions and deletions of genes can also be detected by cloning, sequencing and amplification.
  • RFLP restriction fragment length polymorphism
  • RFLP restriction fragment length polymorphism
  • Such a method is particularly useful for screening relatives of an affected individual for the presence of the PYY mutation found in that individual.
  • Other techniques for detecting insertions and deletions as known in the art can be used.
  • SSCA detects a band which migrates differentially because the sequence change causes a difference in single-strand, intramolecular base pairing.
  • RNase protection involves cleavage of the mutant polynucleotide into two or more smaller fragments.
  • DGGE detects differences in migration rates of mutant sequences compared to wild-type sequences, using a denaturing gradient gel.
  • an oligonucleotide is designed which detects a specific sequence, and the assay is performed by detecting the presence or absence of a hybridization signal.
  • the protein binds only to sequences that contain a nucleotide mismatch in a heteroduplex between mutant and wild-type sequences.
  • Mismatches are hybridized nucleic acid duplexes in which the two strands are not 100% complementary. Lack of total homology may be due to deletions, insertions, inversions or substitutions. Mismatch detection can be used to detect point mutations in the gene or in its mRNA product. While these techniques are less sensitive than sequencing, they are simpler to perform on a large number of tumor samples.
  • mismatch cleavage technique is the RNase protection method.
  • the method involves the use of a labeled riboprobe which is complementary to the human wild-type PYY gene coding sequence.
  • the riboprobe and either mRNA or DNA isolated from the tumor tissue are annealed (hybridized) together and subsequently digested with the enzyme RNase A which is able to detect some mismatches in a duplex RNA structure. If a mismatch is detected by RNase A, it cleaves at the site of the mismatch.
  • RNA product when the annealed RNA preparation is separated on an electrophoretic gel matrix, if a mismatch has been detected and cleaved by RNase A, an RNA product will be seen which is smaller than the full length duplex RNA for the riboprobe and the mRNA or DNA.
  • the riboprobe need not be the full length of the PYY mRNA or gene but can be a segment of either. If the riboprobe comprises only a segment of the PYY mRNA or gene, it will be desirable to use a number of these probes to screen the whole mRNA sequence for mismatches.
  • DNA probes can be used to detect mismatches, through enzymatic or chemical cleavage.
  • mismatches can be detected by shifts in the electrophoretic mobility of mismatched duplexes relative to matched duplexes.
  • riboprobes or DNA probes the cellular mRNA or DNA which might contain a mutation can be amplified using PCR (see below) before hybridization. Changes in DNA of the PYY gene can also be detected using Southern hybridization, especially if the changes are gross rearrangements, such as deletions and insertions. DNA sequences of the PYY gene which have been amplified by use of PCR may also be screened using allele-specific probes.
  • probes are nucleic acid oligomers, each of which contains a region of the PYY gene sequence harboring a known mutation.
  • one oligomer may be about 30 nucleotides in length, corresponding to a portion of the PYY gene sequence.
  • PCR amplification products can be screened to identify the presence of a previously identified mutation in the PYY gene.
  • Hybridization of allele-specific probes with amplified PYYsequences can be performed, for example, on a nylon filter. Hybridization to a particular probe under stringent hybridization conditions indicates the presence of the same mutation in the tumor tissue as in the allele-specific probe.
  • the most definitive test for mutations in a candidate locus is to directly compare genomic PYY sequences from diabetic patients with those from a control population.
  • Mutations from diabetic patients falling outside the coding region of PYY can be detected by examining the non-coding regions, such as introns and regulatory sequences near or within the PYY gene.
  • An early indication that mutations in noncoding regions are important may come from Northern blot experiments that reveal messenger RNA molecules of abnormal size or abundance in diabetic patients as compared to control individuals. Alteration of PYY mRNA expression can be detected by any techniques known in the art.
  • Any means for detecting an altered PYY protein can be used to detect alteration of wild-type PYY genes.
  • Functional assays such as protein binding determinations, can be used.
  • assays can be used which detect PYY biochemical function. Finding a mutant PYY gene product indicates alteration of a wild-type PYY gene.
  • Mutant PYY genes or gene products can also be detected in other human body samples, such as serum, stool, urine and sputum.
  • the same techniques discussed above for detection of mutant PYY genes or gene products in tissues can be applied to other body samples. Cancer cells are sloughed off from tumors and appear in such body samples. By screening such body samples, a simple early diagnosis can be achieved for many types of glucose metabolic disorders involving loss of pancreatic glucose sensing. In addition, the progress of chemotherapy or radiotherapy can be monitored more easily by testing such body samples for mutant PYY genes or gene products.
  • the primer pairs of the present invention are useful for determination of the nucleotide sequence of a particular PYY allele using PCR.
  • the pairs of single-stranded DNA primers can be annealed to sequences within or surrounding the PYY gene on the chromosome in order to prime amplifying DNA synthesis of the PYY gene itself.
  • a complete set of these primers allows synthesis of all of the nucleotides of the PYY gene coding sequences, i.e., the exons.
  • the set of primers preferably allows synthesis of both intron and exon sequences. Allele-specific primers can also be used.
  • primers anneal only to particular PYY mutant alleles, and thus will only amplify a product in the presence of the mutant allele as a template.
  • primers may have restriction enzyme site sequences appended to their 5' ends.
  • all nucleotides of the primers are derived from PYYsequences or sequences adjacent to PYY, except for the few nucleotides necessary to form a restriction enzyme site.
  • enzymes and sites are well known in the art.
  • the primers themselves can be synthesized using techniques which are well known in the art. Generally, the primers can be made using oligonucleotide synthesizing machines which are commercially available. Given the sequence of the PYY open reading frame shown in SEQ ID NO:l, design of particular primers, in addition to those disclosed below, is well within the skill of the art.
  • a biological sample such as a blood sample or biopsy, is prepared and analyzed for the presence or absence of susceptibility alleles of PYY.
  • a biological sample is prepared and analyzed for the presence or absence of mutant alleles of PYY.
  • Results of these tests and interpretive information are returned to the health care provider for communication to the tested individual.
  • diagnoses may be performed by diagnostic laboratories, or, alternatively, diagnostic kits are manufactured and sold to health care providers or to private individuals for self-diagnosis.
  • the screening method can involve amplification of the relevant
  • the screening method involves a non-PCR based strategy for amplification, such as strand-displacement amplification (SDA) and the like.
  • SDA strand-displacement amplification
  • Such screening methods may include two-step label amplification methodologies that are well known in the art. Both PCR and non-PCR based screening strategies can detect target sequences with a high level of sensitivity.
  • the most popular method used today is target amplification.
  • the target nucleic acid sequence is amplified with polymerases.
  • One particularly preferred method using polymerase- driven amplification is the polymerase chain reaction (PCR) .
  • the polymerase chain reaction and other polymerase-driven amplification assays can achieve over a million- fold increase in copy number through the use of polymerase-driven amplification cycles.
  • the resulting nucleic acid can be sequenced or used as a substrate for DNA probes.
  • the biological sample to be analyzed such as blood or serum
  • the biological sample to be analyzed may be treated, if desired, to extract the nucleic acids.
  • the sample nucleic acid may be prepared in various ways to facilitate detection of the target sequence; e.g. denaturation, restriction digestion, electrophoresis or dot blotting.
  • the targeted region of the analyte nucleic acid usually must be at least partially single-stranded to form hybrids with the targeting sequence of the probe. If the sequence is naturally single-stranded, denaturation will not be required. However, if the sequence is double-stranded, the sequence will probably need to be denatured. Denaturation can be carried out by various techniques known in the art.
  • Analyte nucleic acid and probe are incubated under conditions which promote stable hybrid formation of the target sequence in the probe with the putative targeted sequence in the analyte.
  • the region of the probes which is used to bind to the analyte can be made completely complementary to the targeted region of the human chromosome including the
  • high stringency conditions are desirable in order to prevent false positives.
  • conditions of high stringency are used only if the probes are complementary to regions of the chromosome which are unique in the genome.
  • the stringency of hybridization is determined by a number of factors during hybridization and during the washing procedure, including temperature, ionic strength, base composition, probe length, and concentration of formamide. These factors are outlined in, for example, Maniatis et al., supra and Sambrook et al., supra. Under certain circumstances, the formation of higher order hybrids, such as triplexes, quadraplexes, etc., may be desired to provide the means of detecting target sequences.
  • Detection, if any, of the resulting hybrid is usually accomplished by the use of labeled probes.
  • the probe may be unlabeled, but may be detectable by specific binding with a ligand which is labeled, either directly or indirectly.
  • Suitable labels, and methods for labeling probes and ligands arc known in the art, and include, for example, radioactive labels which may be incorporated by known methods (e.g., nick translation, random priming or kinasing), biotin, fluorescent groups, chemiluminescent groups (e.g., dioxetanes, particularly triggered dioxetanes), enzymes, antibodies and the like. Variations of this basic scheme are known in the art, and include those variations that facilitate separation of the hybrids to be detected from extraneous materials and/or that amplify the signal from the labeled moiety.
  • non-PCR based screening assays are also contemplated in this invention.
  • This probe may have an enzyme covalently linked to the probe, such that the covalent linkage does not interfere with the specificity of the hybridization.
  • This enzyme-probe-conjugate-target nucleic acid complex can then be isolated away from the free probe enzyme conjugate and a substrate is added for enzyme detection. Enzymatic activity is observed as a change in color development or luminescent output resulting in a 10 3 -10 6 increase in sensitivity.
  • Two-step label amplification methodologies are known in the art. These assays work on the principle that a small ligand (such as digoxigenin, biotin, or the like) is attached to a nucleic acid probe capable of specifically binding PYY. Exemplary probes can be developed on the basis of the sequence set forth in SEQ ID NO:l. Allele-specific probes are also contemplated within the scope of this example, and exemplary allele specific probes include probes encompassing the predisposing mutations resulting in loss of PYY secretions of a decrease in serum half life. In one example, the small ligand attached to the nucleic acid probe is specifically recognized by an antibody-enzyme conjugate.
  • digoxigenin is attached to the nucleic acid probe. Hybridization is detected by an antibody- alkaline phosphatase conjugate which turns over a chemiluminescent substrate.
  • the small ligand is recognized by a second ligand-enzyme conjugate that is capable of specifically complexing to the first ligand.
  • a well known embodiment of this example is the biotin-avidin type of interactions.
  • nucleic acid probe assays of this invention can employ a cocktail of nucleic acid probes capable of detecting
  • PYY sequences are provided.
  • more than one probe complementary to PYY is employed and in particular the number of different probes is alternatively 2, 3, or 5 different nucleic acid probe sequences.
  • more than one probe complementary to PYY is employed where the cocktail includes probes capable of binding to the allele-specific mutations identified in populations of patients with alterations in PYY.
  • any number of probes can be used, and will preferably include probes corresponding to the major gene mutations identified as predisposing an individual to, e.g., a particular cancer.
  • Example 1 Islet Isolation and Culture Intestine-derived hormone peptides including PP, NPY, NPK, PYY, secretin, GLP- 1 and Bombesin were purchased from Sigma. Collagenase type XI was obtained from Sigma. RPMI 1640 culture medium and fetal bovine serum were obtained from Gibco. A radioimmunoassay kit containing anti-insulin antibody ([ 125 I]-RIA kit) was purchased from Linco, St Louis. Post-partem rat islets were obtained from PO-2 year old rats. Adult rat islets were obtained from 6-8 week old rats. Fetal rat islets were obtained as follows. Pregnant female rats were sacrificed on pregnancy day e21. Fetuses were removed from the uterus.
  • pancreata 10-14 pancreata were dissected from each litter and washed twice in Hanks buffer.
  • the pancreas were pooled, suspended in 6 ml lmg/ml collagenase (Type XI, Sigma) and incubated at 37°C for 8-10 minutes with constant shaking. The digestion was stopped by adding 10 volumes of ice-cold Hanks buffer followed by three washes with Hanks buffer.
  • the islets were then purified by Ficoll gradient and cultured in 10%> fetal bovine serum (FBS)/RPMI medium with or without addition of 1 ⁇ M IBMX. At the end of five days, 20 islets were hand picked into each tube and assayed for static insulin release.
  • FBS fetal bovine serum
  • islets were first washed with KRP buffer and then incubated with 1ml of KRP buffer containing 3mM (low) glucose for 30 minutes at 37 ° C with constant shaking. After collecting the supernatant, the islets were then incubated with 17 mM (high) glucose for one hour at 37°C. The insulin released from low or high glucose stimulation were assayed by radioimmunoassay (RIA) using the [ 125 I]-RIA kit (see Figure 1).
  • RIA radioimmunoassay
  • Example 2 IBMX stimulated calcium influx in e21 islets.
  • E21 islet were isolated and cultured according to Example 1. Islets were then treated with 17mM glucose or 1 ⁇ M IBMX in 3mM (low) glucose ( Figure 2). Non-glucose responsive e21 islets did not experience a rise in intracellular calcium influx upon the addition of high glucose. The addition of IBMX induced a calcium influx, suggesting that the mechanism of IBMX that stimulated insulin release in e21 islets also utilizes activation of calcium channels. This further suggests that the gain of glucose responsivity observed in P0 islets occurs upstream of the calcium channel.
  • Example 3 PYY induces the maturation of fetal islets.
  • Fetal rat islets were isolated as in Example 1.
  • E21 fetal islets were cultured for 5 days in the presence of 200ng/ml PYY, PPP, CCK, NPK, NPY, Secretin, GLP-1 or Bombesin.
  • Glucose-stimulated insulin release was then measured in each culture group ( Figure 3 A and 3B).
  • PYY significantly stimulated the ability of the islets to respond to glucose by secreting insulin.
  • Related peptides such as PPP and NPY, which share approximately 70% amino acid homology, did not stimulate gain of glucose responsivity.
  • Example 5 The effect of PYY on e21 islets is time dependent.
  • Fetal rat islets were isolated as in Example 1. E21 islets were then cultured for 2, 5 or 7 days with 200ng/ml PYY. Glucose-stimulated insulin release was then measured in each culture group ( Figure 4). The control group showed a slight gain of glucose responsivity after 5 days in culture compared to the time 0 and 2 day time points (triangles), as measured by insulin release. The addition of PYY for 5 days almost doubled the amount of insulin released in response to glucose in comparison to the control. This effect was maintained at the 7 day time point. Note that there was no effect of PYY on gain of glucose responsivity after 2 days of PYY incubation.
  • Example 5 The dose response of PYY shows the optimal dose to be 200 ng/ml.
  • Fetal rat islets were isolated as in Example 1. PYY was added to e21 islets at 50,
  • Example 6 PYY Effect on adult islets.
  • Adult rat islets were isolate as in Example 1 and treated over a period of 16 days with control medium or with medium containing 200ng/ml PYY. Glucose-stimulated insulin release was then measured on the indicated days ( Figure 6).
  • Adult islets lost glucose stimulated insulin secretion within 2 days in culture in standard 10% FBS containing medium.
  • PYY was able to rescue responsiveness even after 10 days in culture and longer.
  • Example 7 Effect of PYY on gain of glucose responsivity requires activation of gene transcription.
  • Fetal rat islets were isolate as in Example 1 and treated with 200 ng/ml PYY for 5 days, with the addition of actinomycin D at 0.1 ⁇ g/ml for the last 16 hours, with and without the addition of l ⁇ M IBMX. Glucose-stimulated insulin release was then measured in each culture group ( Figure 7). Actinomycin D could completely inhibit the gain of function induced by PYY as measured by insulin release. This is not due to non-specific toxicity of the drug to the islets, since IBMX can still induce insulin exocytosis in islets treated with actinomycin D.
  • Example 8 Effect of Actinomycin D is not mediated by lowering of islet insulin content.
  • Fetal rat islets were isolated as in Example 1 and treated with 200 ng/ml PYY for 5 days, with the addition of actinomycin D at 0.1, 0.2, 0.5 and 1.0 ⁇ g/ml for the last 16 hours. Insulin content was then measured in each culture group (Figure 8). The table shows that increasing the amount of actinomycin D did not significantly decrease overall islet insulin content.
  • Example 9 PYY does not affect basal secretion rate.
  • E21 and P 14 rat islets were isolated as in Example 1 and treated with 200ng/ml PYY. Islets were then washed and assayed for glucose responsivity, as measured by insulin release. PYY was then added to the assay buffer (Kreb's-Ringer Phosphate) to determine if the presence of PYY acutely affected either the basal or stimulated insulin secretion rates. Glucose-stimulated insulin release was then measured in each culture group ( Figure 8). The effect of PYY addition into the assay buffer was negligible, indicating that the primary effect of PYY is exerted during the culture period in which it is present. Freshly isolated P14 islets were included as a positive control.
  • Example 10 Effect of PYY on restoring glucose response in adult rat islets.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • General Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Veterinary Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Public Health (AREA)
  • Immunology (AREA)
  • Diabetes (AREA)
  • Endocrinology (AREA)
  • Hematology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Organic Chemistry (AREA)
  • Zoology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Epidemiology (AREA)
  • Cell Biology (AREA)
  • Biomedical Technology (AREA)
  • Environmental Sciences (AREA)
  • Biotechnology (AREA)
  • Obesity (AREA)
  • Molecular Biology (AREA)
  • Urology & Nephrology (AREA)
  • Physics & Mathematics (AREA)
  • Microbiology (AREA)
  • Pathology (AREA)
  • Animal Husbandry (AREA)
  • Biodiversity & Conservation Biology (AREA)
  • Biochemistry (AREA)
  • Analytical Chemistry (AREA)
  • Tropical Medicine & Parasitology (AREA)
  • Food Science & Technology (AREA)
  • General Physics & Mathematics (AREA)
PCT/US2000/003391 1999-02-10 2000-02-10 Methods and reagents for treating glucose metabolic disorders Ceased WO2000047219A2 (en)

Priority Applications (11)

Application Number Priority Date Filing Date Title
IL144703A IL144703A (en) 1999-02-10 2000-02-10 Use of peptide yy for the preparation of a pharmaceutical composition for enhancing pancreatic cell differentiation
JP2000598171A JP2003518914A (ja) 1999-02-10 2000-02-10 グルコース代謝障害を治療する方法および試薬
DK00913417.2T DK1189629T3 (da) 1999-02-10 2000-02-10 Peptid YY (PYY) til behandling af glucosestofskiftesygdomme
AU34868/00A AU779745C (en) 1999-02-10 2000-02-10 Methods and reagents for treating glucose metabolic disorders
AT00913417T ATE482717T1 (de) 1999-02-10 2000-02-10 Peptid yy (pyy) zur behandlung von glukose stoffwechselkrankheiten
EP00913417A EP1189629B1 (en) 1999-02-10 2000-02-10 Peptide yy (pyy) for treating glucose metabolic disorders
DE60045030T DE60045030D1 (de) 1999-02-10 2000-02-10 Peptid yy (pyy) zur behandlung von glukose stoffwechselkrankheiten
CA2360324A CA2360324C (en) 1999-02-10 2000-02-10 Peptide yy (pyy) for inducing glucose responsiveness in pancreatic islets
HK02106949.7A HK1045267A1 (zh) 1999-02-10 2000-02-10 供治疗葡萄糖代谢失调的方法及试剂
AU2005200685A AU2005200685A1 (en) 1999-02-10 2005-02-15 Methods and reagents for treating glucose metabolic disorders
IL199988A IL199988A (en) 1999-02-10 2009-07-21 Use of PYY therapies to prepare a drug for the treatment of glucose metabolic diseases

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US11957799P 1999-02-10 1999-02-10
US60/119,577 1999-02-10

Publications (2)

Publication Number Publication Date
WO2000047219A2 true WO2000047219A2 (en) 2000-08-17
WO2000047219A3 WO2000047219A3 (en) 2002-01-31

Family

ID=22385149

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2000/003391 Ceased WO2000047219A2 (en) 1999-02-10 2000-02-10 Methods and reagents for treating glucose metabolic disorders

Country Status (12)

Country Link
US (1) US7396809B1 (https=)
EP (1) EP1189629B1 (https=)
JP (3) JP2003518914A (https=)
AT (1) ATE482717T1 (https=)
AU (2) AU779745C (https=)
CA (1) CA2360324C (https=)
DE (1) DE60045030D1 (https=)
DK (1) DK1189629T3 (https=)
ES (1) ES2353728T3 (https=)
HK (1) HK1045267A1 (https=)
IL (2) IL144703A (https=)
WO (1) WO2000047219A2 (https=)

Cited By (49)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2002047712A3 (en) * 2000-12-14 2002-09-06 Amylin Pharmaceuticals Inc Peptide yy and peptide yy agonists for treatment of metabolic disorders
WO2002083109A1 (en) * 2001-04-11 2002-10-24 Ferring Bv Treatment of type 2 diabetes with inhibitors of dipeptidyl peptidase iv
JP2002355097A (ja) * 2001-06-01 2002-12-10 Kyowa Medex Co Ltd α−アミラーゼ活性測定用試薬と測定方法
WO2003057235A2 (en) 2002-01-10 2003-07-17 Imperial College Innovations Ltd Modification of feeding behavior
WO2003097862A1 (en) * 2002-05-17 2003-11-27 Kyowa Hakko Kogyo Co., Ltd. Method of searching substane having antidiabetic activity
EP1499277A4 (en) * 2001-09-24 2005-08-31 Imp College Innovations Ltd MODIFICATION OF FOOD BEHAVIOR
JP2006515351A (ja) * 2003-01-10 2006-05-25 インペリアル カレッジ イノベーションズ リミテッド 摂食行動の修正
WO2006108234A1 (en) * 2005-04-13 2006-10-19 Garvan Institute Of Medical Research Modified animal lacking functional pyy gene, monoclonal antibodies that bind pyy isoforms and uses therefor
US7157426B2 (en) 2002-12-17 2007-01-02 Nastech Pharmaceutical Company Inc. Compositions and methods for enhanced mucosal delivery of Y2 receptor-binding peptides and methods for treating and preventing obesity
US7186692B2 (en) 2002-12-17 2007-03-06 Nastech Pharmaceutical Company Inc. Compositions and methods for enhanced mucosal delivery and non-infused administration of Y2 receptor-binding peptides and methods for treating and preventing obesity
US7229966B2 (en) 2002-12-17 2007-06-12 Nastech Pharmaceutical Company Inc. Compositions and methods for enhanced mucosal delivery of Y2 receptor-binding peptides and methods for treating and preventing obesity
US7244412B2 (en) 2000-04-10 2007-07-17 Cedars-Sinai Medical Center Methods for manipulating upper gastrointestinal transit, blood flow, and satiety, and for treating visceral hyperalgesia
EP1789440A4 (en) * 2004-02-11 2008-03-12 Amylin Pharmaceuticals Inc REASONS FOR THE FAMILY OF PANCREATIC POLYPEPTIDES AND POLYPEPTIDES CONTAINING THEM
US7396809B1 (en) 1999-02-10 2008-07-08 Curis, Inc. Methods and reagents for treating glucose metabolic disorders
US7576050B2 (en) 2001-07-31 2009-08-18 The United States Of America As Represented By The Department Of Health And Human Services GLP-1 exendin-4 peptide analogs and uses thereof
AU2007200224B2 (en) * 2000-12-14 2009-10-01 Amylin Pharmaceuticals, Llc Peptide YY and peptide YY agonists for treatment of metabolic disorders
US7745216B2 (en) 1999-02-10 2010-06-29 Curis, Inc. Methods and reagents for treating glucose metabolic disorders
AU2006235216B2 (en) * 2005-04-13 2011-09-22 Garvan Institute Of Medical Research Modified animal lacking functional PYY gene, monoclonal antibodies that bind PYY isoforms and uses therefor
US8084605B2 (en) 2006-11-29 2011-12-27 Kelly Ron C Polymorphs of succinate salt of 2-[6-(3-amino-piperidin-1-yl)-3-methyl-2,4-dioxo-3,4-dihydro-2H-pyrimidin-1-ylmethy]-4-fluor-benzonitrile and methods of use therefor
US8093236B2 (en) 2007-03-13 2012-01-10 Takeda Pharmaceuticals Company Limited Weekly administration of dipeptidyl peptidase inhibitors
US8101576B2 (en) 2006-12-13 2012-01-24 Imperial Innovations Limited Compounds and their effects on feeding behaviour
US20120040893A1 (en) * 2002-01-10 2012-02-16 Michael Cowley Modification of feeding behaviour
EP2422806A3 (en) * 2004-02-11 2012-06-13 Amylin Pharmaceuticals Inc. Hybrid polypeptides with selectable properties
US8222411B2 (en) 2005-09-16 2012-07-17 Takeda Pharmaceutical Company Limited Dipeptidyl peptidase inhibitors
US8324383B2 (en) 2006-09-13 2012-12-04 Takeda Pharmaceutical Company Limited Methods of making polymorphs of benzoate salt of 2-[[6-[(3R)-3-amino-1-piperidinyl]-3,4-dihydro-3-methyl-2,4-dioxo-1(2H)-pyrimidinyl]methyl]-benzonitrile
US8906901B2 (en) 2005-09-14 2014-12-09 Takeda Pharmaceutical Company Limited Administration of dipeptidyl peptidase inhibitors
GB2573145A (en) * 2018-04-26 2019-10-30 Univ Ulster Peptides for metabolic disease
CN111886252A (zh) * 2018-01-03 2020-11-03 阿戈马布治疗有限公司 促进胰岛细胞生长的方法
US10864254B2 (en) 2010-12-23 2020-12-15 Rani Therapeutics, Llc Method of delivering gonadotropin releasing hormone or an analogue thereof into a lumen of the intestinal tract using a swallowable drug delivery device
US10874840B2 (en) 2010-12-23 2020-12-29 Rani Therapeutics, Llc Preparation comprising exanatide for delivery into a lumen of the intestinal tract
US10888517B2 (en) 2010-12-23 2021-01-12 Rani Therapeutics, Llc Therapeutic agent preparations for delivery into a lumen of the intestinal tract using a swallowable drug delivery device
US10926073B2 (en) 2010-12-23 2021-02-23 Rani Therapeutics, Llc Therapeutic agent preparations for delivery into a lumen of the intestinal tract using a swallowable drug delivery device
US10953077B2 (en) 2010-12-23 2021-03-23 Rani Therapeutics, Llc Method of delivering a somatostatin compound into a lumen of the intestinal tract using a swallowable drug delivery device
US10967050B2 (en) 2010-12-23 2021-04-06 Rani Therapeutics, Llc Therapeutic agent preparations for delivery into a lumen of the intestinal tract using a swallowable drug delivery device
US10980749B2 (en) 2010-12-23 2021-04-20 Rani Therapeutics, Llc Therapeutic preparation comprising insulin for delivery into a lumen of the intestinal tract using a swallowable drug delivery device
EP3658162A4 (en) * 2017-07-25 2021-04-21 Purdue Research Foundation COLLAGEN ENCAPSULATION OF INSULIN PRODUCING CELLS
US10987499B2 (en) 2009-12-24 2021-04-27 Rani Therapeutics, Llc Swallowable drug delivery device and method of delivery
US11229684B2 (en) 2010-12-23 2022-01-25 Rani Therapeutics, Llc Therapeutic agent preparations for delivery into a lumen of the intestinal tract using a swallowable drug delivery device
US11304895B2 (en) 2010-12-23 2022-04-19 Rani Therapeutics, Llc Therapeutic agent preparations for delivery into a lumen of the intestinal tract using a swallowable drug delivery device
US11419812B2 (en) 2010-12-23 2022-08-23 Rani Therapeutics, Llc Methods for delivering etanercept preparations into a lumen of the intestinal tract using a swallowable drug delivery device
US11478574B2 (en) 2013-10-16 2022-10-25 Purdue Research Foundation Collagen compositions and methods of use
US11555068B2 (en) 2010-12-23 2023-01-17 Rani Therapeutics, Llc Therapeutic agent preparations for delivery into a lumen of the intestinal tract using a swallowable drug delivery device
US11739291B2 (en) 2017-04-25 2023-08-29 Purdue Research Foundation 3-dimensional (3D) tissue-engineered muscle for tissue restoration
US11806504B2 (en) 2010-12-23 2023-11-07 Rani Therapeutics, Llc Device, system and methods for the oral delivery of therapeutic compounds
US11814427B2 (en) 2010-12-23 2023-11-14 Rani Therapeutics, Llc Therapeutic agent preparations for delivery into a lumen of the intestinal tract using a swallowable drug delivery device
US11919941B2 (en) 2015-04-21 2024-03-05 Purdue Research Foundation Cell-collagen-silica composites and methods of making and using the same
US12274808B2 (en) 2014-08-27 2025-04-15 Purdue Research Foundation Collagen-based therapeutic delivery systems
US12280176B2 (en) 2017-01-31 2025-04-22 Geniphys, Inc. Methods and compositions for matrix preparation
US12343450B2 (en) 2020-01-27 2025-07-01 Geniphys, Inc. Biologic filler for restoring and regenerating tissue

Families Citing this family (11)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
GB0121709D0 (en) * 2001-09-07 2001-10-31 Imp College Innovations Ltd Food inhibition agent
US7166575B2 (en) * 2002-12-17 2007-01-23 Nastech Pharmaceutical Company Inc. Compositions and methods for enhanced mucosal delivery of peptide YY and methods for treating and preventing obesity
CA2518465A1 (en) 2003-03-25 2004-10-14 Takeda San Diego, Inc. Dipeptidyl peptidase inhibitors
KR20060041309A (ko) 2003-08-13 2006-05-11 다케다 야쿠힌 고교 가부시키가이샤 4-피리미돈 유도체 및 펩티딜 펩티다제 저해제로서의 그의용도
PA8660701A1 (es) * 2005-02-04 2006-09-22 Pfizer Prod Inc Agonistas de pyy y sus usos
GB0511986D0 (en) * 2005-06-13 2005-07-20 Imp College Innovations Ltd Novel compounds and their effects on feeding behaviour
MX2013004364A (es) 2010-10-19 2013-07-02 Elcelyx Therapeutics Inc Terapias a base de ligando del receptor quimiosensorial.
US9617517B2 (en) 2011-05-02 2017-04-11 National University Corporation Kumamoto University Small chemical compound which promotes induction of differentiation of stem cells into insulin-producing cells and method for inducing differentiation of stem cells into insulin-producing cells using said small chemical compound
CN103981147B (zh) * 2013-02-08 2017-11-10 中国科学院上海生命科学研究院 一种新的制备肝实质细胞的方法
CA2993215C (en) * 2015-07-02 2023-10-31 Rani Therapeutics, Llc Therapeutic agent preparations for delivery into a lumen of the intestinal tract using a swallowable drug delivery device
US10767164B2 (en) 2017-03-30 2020-09-08 The Research Foundation For The State University Of New York Microenvironments for self-assembly of islet organoids from stem cells differentiation

Citations (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4683195A (en) 1986-01-30 1987-07-28 Cetus Corporation Process for amplifying, detecting, and/or-cloning nucleic acid sequences
WO1990002580A1 (en) 1988-09-06 1990-03-22 Brown University Research Foundation Implantable delivery system for biological factors
WO1990015637A2 (en) 1989-06-21 1990-12-27 Brown University Research Foundation Neurological therapy system
WO1991010425A1 (en) 1990-01-08 1991-07-25 Brown University Research Foundation Cell capsule extrusion systems
WO1991010470A1 (en) 1990-01-08 1991-07-25 Brown University Research Foundation Devices and methods for enhanced delivery of active factors
WO1995011689A1 (en) 1993-10-29 1995-05-04 Trustees Of Tufts College Use of inhibitors of dipeptidyl-aminopeptidase to block entry of hiv into cells

Family Cites Families (29)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4891357A (en) 1985-02-11 1990-01-02 University Of Florida Methods and compositions for stimulation of appetite
US4683202A (en) 1985-03-28 1987-07-28 Cetus Corporation Process for amplifying nucleic acid sequences
US4839343A (en) 1987-03-13 1989-06-13 Debiopharm, S.A. Preparation containing hexatriacontapeptides and methods of use
WO1989001967A1 (en) 1987-09-03 1989-03-09 Brown University Research Foundation Blood purification with cultured renal cells
US4892538A (en) 1987-11-17 1990-01-09 Brown University Research Foundation In vivo delivery of neurotransmitters by implanted, encapsulated cells
US5459039A (en) 1989-05-12 1995-10-17 Duke University Methods for mapping genetic mutations
US6391343B1 (en) 1991-01-15 2002-05-21 Hemosphere, Inc. Fibrinogen-coated particles for therapeutic use
DE69433811T2 (de) 1993-01-07 2005-06-23 Sequenom, Inc., San Diego Dns - sequenzierung durch massenspektronomie
KR960701653A (ko) 1993-03-29 1996-03-28 발라수브라마니암 엠비카이파칸 펩타이드 yy의 유사체 및 그의 용도
US5498531A (en) 1993-09-10 1996-03-12 President And Fellows Of Harvard College Intron-mediated recombinant techniques and reagents
US5696093A (en) 1994-10-28 1997-12-09 Crc For Biopharmaceutical Research Pty Limited Method of treating nasal congestion using neuropeptide Y Y2 agonist peptides
US5574010A (en) 1994-11-14 1996-11-12 The Regents Of The University Of California Treatment of pancreatic tumors with peptide YY and analogs thereof
US5602024A (en) 1994-12-02 1997-02-11 Synaptic Pharmaceutical Corporation DNA encoding a hypothalamic atypical neuropeptide Y/peptide YY receptor (Y5) and uses thereof
US5912227A (en) 1995-01-27 1999-06-15 North Carolina State University Method of enhancing nutrient uptake
US6558708B1 (en) 1995-05-17 2003-05-06 Cedars-Sinai Medical Center Methods for manipulating upper gastrointestinal transit, blood flow, and satiety, and for treating visceral hyperalgesia
US20020094346A1 (en) 1995-05-17 2002-07-18 M. D. Henry C. Lin Method and compositions for improving digestion and absorption in the small intestine
US5980945A (en) 1996-01-16 1999-11-09 Societe De Conseils De Recherches Et D'applications Scientifique S.A. Sustained release drug formulations
CA2271788A1 (en) * 1996-11-13 1998-05-22 University Of Cincinnati Analogs of peptide yy and uses thereof
WO1998035957A1 (en) 1997-02-14 1998-08-20 Bayer Corporation Amide derivatives as selective neuropeptide y receptor antagonists
DE69812096T2 (de) 1997-04-23 2003-10-30 Banyu Pharmaceutical Co., Ltd. Neuropeptid y rezeptorantagonisten
AU9185598A (en) 1997-09-25 1999-04-12 Banyu Pharmaceutical Co., Ltd. Novel neuropeptide y receptor antagonists
US6013622A (en) 1998-04-15 2000-01-11 Nutriceutical Technology Corporation Method of regulating appetite and metabolism
ATE251465T1 (de) 1998-07-31 2003-10-15 Novo Nordisk As In-vitro stimulation von beta zellen vermehrung
US7745216B2 (en) 1999-02-10 2010-06-29 Curis, Inc. Methods and reagents for treating glucose metabolic disorders
US7396809B1 (en) 1999-02-10 2008-07-08 Curis, Inc. Methods and reagents for treating glucose metabolic disorders
HK1041263A1 (zh) 1999-05-05 2002-07-05 Ortho-Mcneil Pharmaceutical, Inc. 可用於治疗肥胖和其他疾病的3a,4,5,9b-四氢-1h-苯并[e]吲-2-基胺衍生的神经肽y受体配体
US6569832B1 (en) 1999-11-12 2003-05-27 Novo Nordisk A/S Inhibition of beta cell degeneration
US6531478B2 (en) 2000-02-24 2003-03-11 Cheryl P. Kordik Amino pyrazole derivatives useful for the treatment of obesity and other disorders
CN100350968C (zh) 2001-09-24 2007-11-28 皇家创新有限公司 饮食行为的改进

Patent Citations (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4683195A (en) 1986-01-30 1987-07-28 Cetus Corporation Process for amplifying, detecting, and/or-cloning nucleic acid sequences
US4683195B1 (https=) 1986-01-30 1990-11-27 Cetus Corp
WO1990002580A1 (en) 1988-09-06 1990-03-22 Brown University Research Foundation Implantable delivery system for biological factors
US5011472A (en) 1988-09-06 1991-04-30 Brown University Research Foundation Implantable delivery system for biological factors
WO1990015637A2 (en) 1989-06-21 1990-12-27 Brown University Research Foundation Neurological therapy system
WO1991010425A1 (en) 1990-01-08 1991-07-25 Brown University Research Foundation Cell capsule extrusion systems
WO1991010470A1 (en) 1990-01-08 1991-07-25 Brown University Research Foundation Devices and methods for enhanced delivery of active factors
WO1995011689A1 (en) 1993-10-29 1995-05-04 Trustees Of Tufts College Use of inhibitors of dipeptidyl-aminopeptidase to block entry of hiv into cells

Non-Patent Citations (9)

* Cited by examiner, † Cited by third party
Title
B. PERBAL, A PRACTICAL GUIDE TO MOLECULAR CLONING, 1984
FERBER, S. ET AL., J. BIOL. CHEM., vol. 269, no. 15, 1994, pages 11523 - 29
HUGHES, S. D. ET AL., PROC. NATL. ACAD. SCI. USA, vol. 89, 1992, pages 688 - 92
JOHNSON, D. ET AL., SCIENCE, vol. 250, 1990, pages 546 - 49
LACY ET AL., SCIENCE, vol. 254, 1991, pages 1782 - 84
SCHUIT, F. C., NORM. RES., vol. 46, 1996, pages 99 - 106
SULLIVAN ET AL., SCIENCE, vol. 252, 1991, pages 718 - 21
THORENS, B. ET AL., PROC. ACAD. SCI. USA, vol. 87, 1990, pages 6492 - 96
VALERA ET AL., J BIOL. CHEM., vol. 269, 1994, pages 28543 - 46

Cited By (98)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US7807641B2 (en) 1999-02-10 2010-10-05 Curis, Inc. Methods and reagents for treating glucose metabolic disorders
US7745216B2 (en) 1999-02-10 2010-06-29 Curis, Inc. Methods and reagents for treating glucose metabolic disorders
US7396809B1 (en) 1999-02-10 2008-07-08 Curis, Inc. Methods and reagents for treating glucose metabolic disorders
US7244412B2 (en) 2000-04-10 2007-07-17 Cedars-Sinai Medical Center Methods for manipulating upper gastrointestinal transit, blood flow, and satiety, and for treating visceral hyperalgesia
US7615207B2 (en) 2000-04-10 2009-11-10 Cedars-Sinai Medical Center Methods for treating irritable bowel syndrome
US7608245B2 (en) 2000-04-10 2009-10-27 Cedars-Sinai Medical Center Methods for manipulating satiety
AU2002230843B2 (en) * 2000-12-14 2006-10-19 Amylin Pharmaceuticals, Llc Peptide YY and peptide YY agonists for treatment of metabolic disorders
US8273713B2 (en) 2000-12-14 2012-09-25 Amylin Pharmaceuticals, Llc Methods of treating obesity using PYY[3-36]
CN1568195B (zh) * 2000-12-14 2011-03-02 安米林药品公司 用于治疗代谢性疾病的肽yy及肽yy激动剂
WO2002047712A3 (en) * 2000-12-14 2002-09-06 Amylin Pharmaceuticals Inc Peptide yy and peptide yy agonists for treatment of metabolic disorders
AU2002230843B8 (en) * 2000-12-14 2007-05-17 Amylin Pharmaceuticals, Llc Peptide YY and peptide YY agonists for treatment of metabolic disorders
EP2123293A3 (en) * 2000-12-14 2010-09-08 Amylin Pharmaceuticals, Inc. Peptide YY and petide YY agonists for treatment of metabolic disorders
AU2007200224B2 (en) * 2000-12-14 2009-10-01 Amylin Pharmaceuticals, Llc Peptide YY and peptide YY agonists for treatment of metabolic disorders
WO2002083109A1 (en) * 2001-04-11 2002-10-24 Ferring Bv Treatment of type 2 diabetes with inhibitors of dipeptidyl peptidase iv
JP2002355097A (ja) * 2001-06-01 2002-12-10 Kyowa Medex Co Ltd α−アミラーゼ活性測定用試薬と測定方法
US7576050B2 (en) 2001-07-31 2009-08-18 The United States Of America As Represented By The Department Of Health And Human Services GLP-1 exendin-4 peptide analogs and uses thereof
US8278272B2 (en) 2001-07-31 2012-10-02 The United States Of America, As Represented By The Secretary, Department Of Health & Human Services GLP-1, exendin-4, peptide analogs and uses thereof
US8853160B2 (en) 2001-07-31 2014-10-07 The United States Of America, As Represented By The Secretary, Department Of Health & Human Services GLP-1, exendin-4, peptide analogs and uses thereof
US10941187B2 (en) 2001-07-31 2021-03-09 The United States Of America, As Represented By The Secretary, Department Of Health & Human Services GLP-1, exendin-4, peptide analogs and uses thereof
US7459432B2 (en) 2001-09-24 2008-12-02 Imperial College Innovations Ltd. Modification of feeding behavior
JP2010111694A (ja) * 2001-09-24 2010-05-20 Imperial Innovations Ltd 摂食行動の修正
EP1499277A4 (en) * 2001-09-24 2005-08-31 Imp College Innovations Ltd MODIFICATION OF FOOD BEHAVIOR
EP2050460A1 (en) * 2001-09-24 2009-04-22 Imperial Innovations Limited PYY and agonists thereof for modification of feeding behaviour
KR100989647B1 (ko) * 2001-09-24 2010-10-26 오레곤 헬스 앤드 사이언스 유니버시티 식습관의 변화
US8217001B2 (en) 2001-09-24 2012-07-10 Imperial Innovations Limited Modification of feeding behavior
CN100350968C (zh) * 2001-09-24 2007-11-28 皇家创新有限公司 饮食行为的改进
JP2013047275A (ja) * 2001-09-24 2013-03-07 Imperial Innovations Ltd 摂食行動の修正
AU2002332054B2 (en) * 2001-09-24 2007-11-08 Imperial Innovations Limited Modification of feeding behavior
JP2009292835A (ja) * 2002-01-10 2009-12-17 Imperial Innovations Ltd 摂食行動の修正
WO2003057235A3 (en) * 2002-01-10 2003-12-11 Imp College Innovations Ltd Modification of feeding behavior
US20120040893A1 (en) * 2002-01-10 2012-02-16 Michael Cowley Modification of feeding behaviour
WO2003057235A2 (en) 2002-01-10 2003-07-17 Imperial College Innovations Ltd Modification of feeding behavior
JP2005519059A (ja) * 2002-01-10 2005-06-30 インペリアル カレッジ イノベーションズ リミテッド 摂食行動の修正
AU2003201998B2 (en) * 2002-01-10 2009-04-23 Imperial Innovations Limited Modification of feeding behavior
AU2003201998C1 (en) * 2002-01-10 2012-10-25 Imperial Innovations Limited Modification of feeding behavior
JP2011052018A (ja) * 2002-01-10 2011-03-17 Imperial Innovations Ltd 摂食行動の修正
WO2003097862A1 (en) * 2002-05-17 2003-11-27 Kyowa Hakko Kogyo Co., Ltd. Method of searching substane having antidiabetic activity
US7186692B2 (en) 2002-12-17 2007-03-06 Nastech Pharmaceutical Company Inc. Compositions and methods for enhanced mucosal delivery and non-infused administration of Y2 receptor-binding peptides and methods for treating and preventing obesity
US7229966B2 (en) 2002-12-17 2007-06-12 Nastech Pharmaceutical Company Inc. Compositions and methods for enhanced mucosal delivery of Y2 receptor-binding peptides and methods for treating and preventing obesity
US7157426B2 (en) 2002-12-17 2007-01-02 Nastech Pharmaceutical Company Inc. Compositions and methods for enhanced mucosal delivery of Y2 receptor-binding peptides and methods for treating and preventing obesity
US7186691B2 (en) 2002-12-17 2007-03-06 Nastech Pharmaceutical Company Inc. Compositions and methods for enhanced mucosal delivery of Y2 receptor-binding peptides and methods for treating and preventing obesity
JP2006515351A (ja) * 2003-01-10 2006-05-25 インペリアル カレッジ イノベーションズ リミテッド 摂食行動の修正
JP2011042688A (ja) * 2003-01-10 2011-03-03 Imperial Innovations Ltd 摂食行動の修正
AU2005211776B2 (en) * 2004-02-11 2012-02-02 Amylin Pharmaceuticals, Llc Pancreatic polypeptide family motifs and polypeptides comprising the same
US8906849B2 (en) 2004-02-11 2014-12-09 Amylin Pharmaceuticals, Llc Pancreatic polypeptide family motifs, polypeptides and methods comprising the same
US7723471B2 (en) 2004-02-11 2010-05-25 Amylin Pharmaceuticals, Inc. Pancreatic polypeptide family motifs, polypeptides and methods comprising the same
EP2422806A3 (en) * 2004-02-11 2012-06-13 Amylin Pharmaceuticals Inc. Hybrid polypeptides with selectable properties
EP1789440A4 (en) * 2004-02-11 2008-03-12 Amylin Pharmaceuticals Inc REASONS FOR THE FAMILY OF PANCREATIC POLYPEPTIDES AND POLYPEPTIDES CONTAINING THEM
US8426361B2 (en) 2004-02-11 2013-04-23 Amylin Pharmaceuticals, Llc Pancreatic polypeptide family motifs, polypeptides and methods comprising the same
US8603969B2 (en) 2004-02-11 2013-12-10 Amylin Pharmaceuticals, Llc Pancreatic polypeptide family motifs and polypeptides comprising the same
EP2335715A3 (en) * 2004-02-11 2013-12-18 Amylin Pharmaceuticals, LLC Pancreatic polypeptide family motifs and polypeptides comprising the same
EP2335716A3 (en) * 2004-02-11 2011-10-19 Amylin Pharmaceuticals Inc. Pancreatic polypeptide family motifs and polypeptides comprising the same
US8236933B2 (en) * 2005-04-13 2012-08-07 Garvan Institute Of Medical Research Modified animal lacking functional PYY gene, monoclonal antibodies that bind PYY isoforms and uses therefor
AU2006235216B2 (en) * 2005-04-13 2011-09-22 Garvan Institute Of Medical Research Modified animal lacking functional PYY gene, monoclonal antibodies that bind PYY isoforms and uses therefor
WO2006108234A1 (en) * 2005-04-13 2006-10-19 Garvan Institute Of Medical Research Modified animal lacking functional pyy gene, monoclonal antibodies that bind pyy isoforms and uses therefor
AU2006235216C1 (en) * 2005-04-13 2012-01-19 Garvan Institute Of Medical Research Modified animal lacking functional PYY gene, monoclonal antibodies that bind PYY isoforms and uses therefor
US8906901B2 (en) 2005-09-14 2014-12-09 Takeda Pharmaceutical Company Limited Administration of dipeptidyl peptidase inhibitors
US8222411B2 (en) 2005-09-16 2012-07-17 Takeda Pharmaceutical Company Limited Dipeptidyl peptidase inhibitors
US8324383B2 (en) 2006-09-13 2012-12-04 Takeda Pharmaceutical Company Limited Methods of making polymorphs of benzoate salt of 2-[[6-[(3R)-3-amino-1-piperidinyl]-3,4-dihydro-3-methyl-2,4-dioxo-1(2H)-pyrimidinyl]methyl]-benzonitrile
US8084605B2 (en) 2006-11-29 2011-12-27 Kelly Ron C Polymorphs of succinate salt of 2-[6-(3-amino-piperidin-1-yl)-3-methyl-2,4-dioxo-3,4-dihydro-2H-pyrimidin-1-ylmethy]-4-fluor-benzonitrile and methods of use therefor
US8101576B2 (en) 2006-12-13 2012-01-24 Imperial Innovations Limited Compounds and their effects on feeding behaviour
US8093236B2 (en) 2007-03-13 2012-01-10 Takeda Pharmaceuticals Company Limited Weekly administration of dipeptidyl peptidase inhibitors
US12268831B2 (en) 2009-12-24 2025-04-08 Rani Therapeutics, Llc Swallowable drug delivery device and methods of drug delivery
US11376405B2 (en) 2009-12-24 2022-07-05 Rani Therapeutics, Llc Therapeutic agent preparations into a lumen of the intestinal tract using a swallowable drug delivery device
US11338118B2 (en) 2009-12-24 2022-05-24 Rani Therapeutics, Llc Swallowable drug delivery device and methods of drug delivery
US11253686B2 (en) 2009-12-24 2022-02-22 Rani Therapeutics, Llc Swallowable drug delivery device and methods of drug delivery
US10987499B2 (en) 2009-12-24 2021-04-27 Rani Therapeutics, Llc Swallowable drug delivery device and method of delivery
US11304895B2 (en) 2010-12-23 2022-04-19 Rani Therapeutics, Llc Therapeutic agent preparations for delivery into a lumen of the intestinal tract using a swallowable drug delivery device
US11654182B2 (en) 2010-12-23 2023-05-23 Rani Therapeutics, Llc Method of delivering gonadotropin releasing hormone or an analogue thereof into a lumen of the intestinal tract using a swallowable drug delivery device
US10967050B2 (en) 2010-12-23 2021-04-06 Rani Therapeutics, Llc Therapeutic agent preparations for delivery into a lumen of the intestinal tract using a swallowable drug delivery device
US10980749B2 (en) 2010-12-23 2021-04-20 Rani Therapeutics, Llc Therapeutic preparation comprising insulin for delivery into a lumen of the intestinal tract using a swallowable drug delivery device
US12263325B2 (en) 2010-12-23 2025-04-01 Rani Therapeutics, Llc Device, system and methods for the oral delivery of therapeutic compounds
US10926073B2 (en) 2010-12-23 2021-02-23 Rani Therapeutics, Llc Therapeutic agent preparations for delivery into a lumen of the intestinal tract using a swallowable drug delivery device
US11229684B2 (en) 2010-12-23 2022-01-25 Rani Therapeutics, Llc Therapeutic agent preparations for delivery into a lumen of the intestinal tract using a swallowable drug delivery device
US10888517B2 (en) 2010-12-23 2021-01-12 Rani Therapeutics, Llc Therapeutic agent preparations for delivery into a lumen of the intestinal tract using a swallowable drug delivery device
US10874840B2 (en) 2010-12-23 2020-12-29 Rani Therapeutics, Llc Preparation comprising exanatide for delivery into a lumen of the intestinal tract
US10864254B2 (en) 2010-12-23 2020-12-15 Rani Therapeutics, Llc Method of delivering gonadotropin releasing hormone or an analogue thereof into a lumen of the intestinal tract using a swallowable drug delivery device
US11844867B2 (en) 2010-12-23 2023-12-19 Rani Therapeutics, Llc Method of delivering insulin into a lumen of the intestinal tract using a swallowable drug delivery device
US11419812B2 (en) 2010-12-23 2022-08-23 Rani Therapeutics, Llc Methods for delivering etanercept preparations into a lumen of the intestinal tract using a swallowable drug delivery device
US11814427B2 (en) 2010-12-23 2023-11-14 Rani Therapeutics, Llc Therapeutic agent preparations for delivery into a lumen of the intestinal tract using a swallowable drug delivery device
US11555068B2 (en) 2010-12-23 2023-01-17 Rani Therapeutics, Llc Therapeutic agent preparations for delivery into a lumen of the intestinal tract using a swallowable drug delivery device
US11638690B2 (en) 2010-12-23 2023-05-02 Rani Therapeutics, Llc Therapeutic agent preparations for delivery into a lumen of the intestinal tract using a swallowable drug delivery device
US10953077B2 (en) 2010-12-23 2021-03-23 Rani Therapeutics, Llc Method of delivering a somatostatin compound into a lumen of the intestinal tract using a swallowable drug delivery device
US11684761B2 (en) 2010-12-23 2023-06-27 Rani Therapeutics, Llc Preparation comprising exanatide for delivery into a lumen of the intestinal tract
US11813314B2 (en) 2010-12-23 2023-11-14 Rani Therapeutics, Llc Method of delivering a somatostatin compound into a lumen of the intestinal tract using a swallowable drug delivery device
US11771879B2 (en) 2010-12-23 2023-10-03 Rani Therapeutics, Llc Therapeutic agent preparations for delivery into a lumen of the intestinal tract using a swallowable drug delivery device
US11806504B2 (en) 2010-12-23 2023-11-07 Rani Therapeutics, Llc Device, system and methods for the oral delivery of therapeutic compounds
US11478574B2 (en) 2013-10-16 2022-10-25 Purdue Research Foundation Collagen compositions and methods of use
US12274808B2 (en) 2014-08-27 2025-04-15 Purdue Research Foundation Collagen-based therapeutic delivery systems
US11919941B2 (en) 2015-04-21 2024-03-05 Purdue Research Foundation Cell-collagen-silica composites and methods of making and using the same
US12280176B2 (en) 2017-01-31 2025-04-22 Geniphys, Inc. Methods and compositions for matrix preparation
US11739291B2 (en) 2017-04-25 2023-08-29 Purdue Research Foundation 3-dimensional (3D) tissue-engineered muscle for tissue restoration
US12398368B2 (en) 2017-04-25 2025-08-26 Purdue Research Foundation 3-dimensional (3D) tissue-engineered muscle for tissue restoration
EP3658162A4 (en) * 2017-07-25 2021-04-21 Purdue Research Foundation COLLAGEN ENCAPSULATION OF INSULIN PRODUCING CELLS
US12458669B2 (en) 2017-07-25 2025-11-04 Purdue Research Foundation Collagen encapsulation of insulin-producing cells
CN111886252A (zh) * 2018-01-03 2020-11-03 阿戈马布治疗有限公司 促进胰岛细胞生长的方法
GB2573145A (en) * 2018-04-26 2019-10-30 Univ Ulster Peptides for metabolic disease
US12343450B2 (en) 2020-01-27 2025-07-01 Geniphys, Inc. Biologic filler for restoring and regenerating tissue

Also Published As

Publication number Publication date
AU2005200685A1 (en) 2005-03-10
HK1045267A1 (zh) 2002-11-22
DK1189629T3 (da) 2011-01-03
AU779745B2 (en) 2005-02-10
WO2000047219A3 (en) 2002-01-31
ES2353728T3 (es) 2011-03-04
CA2360324A1 (en) 2000-08-17
JP2003518914A (ja) 2003-06-17
IL199988A (en) 2011-11-30
EP1189629A2 (en) 2002-03-27
IL144703A (en) 2010-04-15
DE60045030D1 (de) 2010-11-11
IL144703A0 (en) 2002-06-30
CA2360324C (en) 2016-03-29
AU3486800A (en) 2000-08-29
JP2011000128A (ja) 2011-01-06
JP5766419B2 (ja) 2015-08-19
JP2013188229A (ja) 2013-09-26
ATE482717T1 (de) 2010-10-15
US7396809B1 (en) 2008-07-08
EP1189629B1 (en) 2010-09-29
AU779745C (en) 2005-08-25

Similar Documents

Publication Publication Date Title
AU779745C (en) Methods and reagents for treating glucose metabolic disorders
US7807641B2 (en) Methods and reagents for treating glucose metabolic disorders
Hui et al. Pancreas duodenum homeobox-1 regulates pancreas development during embryogenesis and islet cell function in adulthood
Yamaoka et al. Development of pancreatic islets
McIntosh et al. Noninsulin-dependent animal models of diabetes mellitus
Kieffer et al. The glucagon-like peptides
Stoffers et al. Insulinotropic glucagon-like peptide 1 agonists stimulate expression of homeodomain protein IDX-1 and increase islet size in mouse pancreas.
JP4755133B2 (ja) GLP−1またはExendin−4による、非インスリン産生細胞のインスリン産生細胞への分化、およびその使用
Peters et al. Ontogeny, differentiation and growth of the endocrine pancreas
Madsen et al. Pancreatic development and maturation of the islet B cell: studies of pluripotent islet cultures
US7208572B2 (en) Leptin-related peptides
CN104039357A (zh) 胰腺β-细胞增殖的调节
Winter Molecular and biochemical analysis of the MODY syndromes
US20120053119A1 (en) Therapeutic method for increasing pancreatic beta cell mass
WO2004039832A2 (en) Leptin-related peptides
EP1896605A2 (en) Stimulation of pancreatic b cell proliferation
JP4548335B2 (ja) 腸管細胞のインスリン産生細胞への変換誘導剤、及び糖尿病治療剤
Ramzy et al. Insulin-deficient mouse β-Cells do not fully mature but can be remedied through insulin replacement by islet transplantation
WO2000047721A2 (en) Methods of inducing insulin positive progenitor cells
Patel et al. Production, action, and degradation of somatostatin
Tsigos et al. Monogenic forms of obesity and diabetes mellitus
Ham et al. Role of Pdx-1 in ẞ-Cell Growth
Maida Effects of Enteroendocrine Hormones on Beta-cell Function and Glucose Homeostasis
Legakis The role of Parathyroid hormone-related Protein (PTHRP) in the pathophysiology of diabetes mellitus
Courtade Impaired pro-islet amyloid polypeptide processing promotes beta-cell dysfunction in diabetes and islet transplants

Legal Events

Date Code Title Description
AK Designated states

Kind code of ref document: A2

Designated state(s): AE AL AM AT AU AZ BA BB BG BR BY CA CH CN CR CU CZ DE DK DM EE ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MA MD MG MK MN MW MX NO NZ PL PT RO RU SD SE SG SI SK SL TJ TM TR TT TZ UA UG US UZ VN YU ZA ZW

AL Designated countries for regional patents

Kind code of ref document: A2

Designated state(s): GH GM KE LS MW SD SL SZ TZ UG ZW AM AZ BY KG KZ MD RU TJ TM AT BE CH CY DE DK ES FI FR GB GR IE IT LU MC NL PT SE BF BJ CF CG CI CM GA GN GW ML MR NE SN TD TG

121 Ep: the epo has been informed by wipo that ep was designated in this application
DFPE Request for preliminary examination filed prior to expiration of 19th month from priority date (pct application filed before 20040101)
WWE Wipo information: entry into national phase

Ref document number: 144703

Country of ref document: IL

ENP Entry into the national phase

Ref document number: 2360324

Country of ref document: CA

Ref country code: CA

Ref document number: 2360324

Kind code of ref document: A

Format of ref document f/p: F

ENP Entry into the national phase

Ref country code: JP

Ref document number: 2000 598171

Kind code of ref document: A

Format of ref document f/p: F

WWE Wipo information: entry into national phase

Ref document number: 34868/00

Country of ref document: AU

WWE Wipo information: entry into national phase

Ref document number: 2000913417

Country of ref document: EP

REG Reference to national code

Ref country code: DE

Ref legal event code: 8642

AK Designated states

Kind code of ref document: A3

Designated state(s): AE AL AM AT AU AZ BA BB BG BR BY CA CH CN CR CU CZ DE DK DM EE ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MA MD MG MK MN MW MX NO NZ PL PT RO RU SD SE SG SI SK SL TJ TM TR TT TZ UA UG US UZ VN YU ZA ZW

AL Designated countries for regional patents

Kind code of ref document: A3

Designated state(s): GH GM KE LS MW SD SL SZ TZ UG ZW AM AZ BY KG KZ MD RU TJ TM AT BE CH CY DE DK ES FI FR GB GR IE IT LU MC NL PT SE BF BJ CF CG CI CM GA GN GW ML MR NE SN TD TG

WWP Wipo information: published in national office

Ref document number: 2000913417

Country of ref document: EP

WWG Wipo information: grant in national office

Ref document number: 34868/00

Country of ref document: AU

WWE Wipo information: entry into national phase

Ref document number: 199988

Country of ref document: IL