WO2000006737A2 - Streptococcus pneumoniae proteins and nucleic acid molecules - Google Patents
Streptococcus pneumoniae proteins and nucleic acid molecules Download PDFInfo
- Publication number
- WO2000006737A2 WO2000006737A2 PCT/GB1999/002451 GB9902451W WO0006737A2 WO 2000006737 A2 WO2000006737 A2 WO 2000006737A2 GB 9902451 W GB9902451 W GB 9902451W WO 0006737 A2 WO0006737 A2 WO 0006737A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- protein
- sequence
- polypeptide
- sequences
- pneumoniae
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/195—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
- C07K14/315—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Streptococcus (G), e.g. Enterococci
- C07K14/3156—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Streptococcus (G), e.g. Enterococci from Streptococcus pneumoniae (Pneumococcus)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P11/00—Drugs for disorders of the respiratory system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/04—Antibacterial agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
Definitions
- the present invention relates to proteins derived from Streptococcus pneumoniae, nucleic acid molecules encoding such proteins, the use of the nucleic acid and/or proteins as antigens/immunogens and in detection/diagnosis, as well as methods for screening the proteins/nucleic acid sequences as potential anti-microbial targets.
- Streptococcus pneumoniae commonly referred to as the pneumococcus
- pneumococcus is an important pathogenic organism.
- the continuing significance of Streptoccocus pneumoniae infections in relation to human disease in developing and developed countries has been authoritatively reviewed (Fiber, G.R., Science, 265: 1385-1387 (1994)). That indicates that on a global scale this organism is believed to be the most common bacterial cause of acute respiratory infections, and is estimated to result in 1 million childhood deaths each year, mostly in developing countries (Stansfield, S.K., Pediatr. Infect. Dis., 6: 622 (1987)). In the USA it has been suggested (Breiman et al, Arch. Intern.
- pneumococcus is still the most common cause of bacterial pneumonia, and that disease rates are particularly high in young children, in the elderly, and in patients with j predisposing conditions such as asplenia, heart, lung and kidney disease, diabetes, alcoholism, or with immunosupressive disorders, especially AIDS.
- These groups are at higher risk of pneumococcal septicaemia and hence meningitis and therefore have a greater risk of dying from pneumococcal infection.
- the pneumococcus is also the leading cause of otitis media and sinusitis, which remain prevalent infections in children in developed countries, and which incur substantial costs.
- a modification of the approach using capsule antigens relies on conjugating the polysaccharide to a protein in order to derive an enhanced immune response, particularly by giving the response T-cell dependent character.
- This approach has been used in the development of a vaccine against Haemophilus influenzae. There are issues of cost concerning both the multi-polysaccharide vaccines and those based on conjugates.
- a third approach is to look for other antigenic components which offer the potential to be vaccine candidates.
- the present invention provides a Streptococcus pneumoniae protein or polypeptide having a sequence selected from those shown in table 2 herein.
- a protein or polypeptide of the present invention may be provided in substantially pure form.
- it may be provided in a form which is substantially free of other proteins.
- a protein or polypeptide having an amino acid sequence as shown in Table 3 is provided.
- the invention encompasses any protein coded for by a nucleic acid sequence as shown in Table 1 herein.
- the proteins and polypeptides of the invention are useful as antigenic material.
- Such material can be "antigenic” and/or “immunogenic” .
- antigenic is taken to mean that the protein or polypeptide is capable of being used to raise antibodies or indeed is capable of inducing an antibody response in a subject.
- immunogenic is taken to mean that the protein or polypeptide is capable of eliciting a protective immune response in a subject.
- the protein or polypeptide may be capable of not only generating an antibody response and in addition non-antibody based immune responses.
- proteins or polypeptides of the invention will also find use in the context of the present invention, ie as antigenic/immunogenic material.
- proteins or polypeptides which include one or more additions, deletions, substitutions or the like are encompassed by the present invention.
- replacing one hydrophobic amino acid with another One can use a program such as the CLUSTAL program to compare amino acid sequences. This program compares amino acid sequences and finds the optimal alignment by inserting spaces in either sequence as appropriate. It is possible to calculate amino acid identity or similarity (identity plus conservation of amino acid type) for an optimal alignment.
- a program like BLASTx will align the longest stretch of similar sequences and assign a value to the fit. It is thus possible to obtain a comparison where several regions of similarity are found, each having a different score. Both types of analysis are contemplated in the present invention.
- homologues or derivatives the degree of identity with a protein or polypeptide as described herein is less important than that the homologue or derivative should retain its antigenicity or immunogenicity to streptoccocus pneumoniae.
- homologues or derivatives having at least 60% similarity (as discussed above) with the proteins or polypeptides described herein are provided.
- homologues or derivatives having at least 70% similarity, more preferably at least 80% similarity are provided.
- homologues or derivatives having at least 90% or even 95% similarity are provided.
- the homologues or derivatives could be fusion proteins, incorporating moieties which render purification easier, for example by effectively tagging the desired protein or polypeptide. It may be necessary to remove the "tag” or it may be the case that the fusion protein itself retains sufficient antigenicity to be useful.
- antigenic fragments of the proteins or polypeptides of the invention or of homologues or derivatives thereof.
- fragments of the proteins or polypeptides described herein, or of homologues or derivatives thereof the situation is slightly different. It is well known that is possible to screen an antigenic protein or polypeptide to identify epitopic regions, ie those regions which are responsible for the protein or polypeptide 's antigenicity or immunogenicity. Methods for carrying out such screening are well known in the art.
- the fragments of the present invention should include one or more such epitopic regions or be sufficiently similar to such regions to retain their antigenic/immunogenic properties.
- the degree of identity is perhaps irrelevant, since they may be 100% identical to a particular part of a protein or polypeptide, homologue or derivative as described herein. The key issue, once again, is that the fragment retains the antigenic/immunogenic properties.
- nucleic acid molecule comprising or consisting of a sequence which is:
- the present invention provides a nucleic acid molecule comprising or consisting of a sequence which is:
- the nucleic acid molecules of the invention may include a plurality of such sequences, and/or fragments.
- the skilled person will appreciate that the present invention can include novel variants of those particular novel nucleic acid molecules which are exemplified herein. . Such variants are encompassed by the present invention. These may occur in nature, for example because of strain variation. For example, additions, substitutions and/or deletions are included. In addition, and particularly when utilising microbial expression systems, one may wish to engineer the nucleic acid sequence by making use of known preferred codon usage in the particular organism being used for expression. Thus, synthetic or non-naturally occurring variants are also included within the scope of the invention.
- RNA equivalent when used above indicates that a given RNA molecule has a sequence which is complementary to that of a given DNA molecule (allowing for the fact that in RNA "U” replaces "T” in the genetic code).
- BESTFIT When comparing nucleic acid sequences for the purposes of determining the degree of homology or identity one can use programs such as BESTFIT and GAP (both from the Wisconsin Genetics Computer Group (GCG) software package) BESTFIT, for example, compares two sequences and produces an optimal alignment of the most similar segments. GAP enables sequences to be aligned along their whole length and finds the optimal alignment by inserting spaces in either sequence as appropriate. Suitably, in the context of the present invention compare when discussing identity of nucleic acid sequences, the comparison is made by alignment of the sequences along their whole length.
- GCG Wisconsin Genetics Computer Group
- sequences which have substantial identity have at least 50% sequence identity, desirably at least 75% sequence identity and more desirably at least 90 or at least 95% sequence identity with said sequences.
- sequence identity may be 99% or above.
- the term "substantial identity” indicates that said sequence has a greater degree of identity with any of the sequences described herein than with prior art nucleic acid sequences.
- nucleic acid sequence of the present invention codes for at least part of a novel gene product
- the present invention includes within its scope all possible sequence coding for the gene product or for a novel part thereof.
- the nucleic acid molecule may be in isolated or recombinant form. It may be incorporated into a vector and the vector may be incorporated into a host. Such vectors and suitable hosts form yet further aspects of the present invention.
- genes in Streptococcus pneumoniae can be identified. They can then be excised using restriction enzymes and cloned into a vector. The vector can be introduced into a suitable host for expression.
- Nucleic acid molecules of the present invention may be obtained from S.pneumoniae by the use of appropriate probes complementary to part of the sequences of the nucleic acid molecules. Restriction enzymes or sonication techniques can be used to obtain appropriately sized fragments for probing.
- PCR techniques may be used to amplify a desired nucleic acid sequence.
- sequence data provided herein can be used to design two primers for use in PCR so that a desired sequence, including whole genes or fragments thereof, can be targeted and then amplified to a high degree.
- One primer will normally show a high degree of specificity for a first sequence located on one strand of a DNA molecule, and the other primer will normally show a high degree of specificity for a second sequence located on the complementary strand of the DNA sequence and being spaced from the complementary sequence to the first sequence.
- primers will be at least 15-25 nucleotides long.
- chemical synthesis may be used. This may be automated. Relatively short sequences may be chemically synthesised and ligated together to provide a longer sequence.
- the present invention provides an immunogenic/antigenic composition
- an immunogenic/antigenic composition comprising one or more proteins or polypeptides selected from those whose sequences are shown in Tables 2-4, or homologues or derivatives thereof, and/or fragments of any of these.
- the immunogenic/antigenic composition is a vaccine or is for use in a diagnostic assay.
- the invention also provides a vaccine composition comprising one or more nucleic acid sequences as defined herein.
- DNA vaccines See for instance, Donnelly et al , Ann. Rev. Immunol, 15:617-648 (1997).
- the proteins or polypeptides described herein, their homologues or derivatives, and/or fragments of any of these can be used in methods of detecting/diagnosing S.pneumoniae. Such methods can be based on the detection of antibodies against such proteins which may be present in a subject. Therefore the present invention provides a method for the detection/diagnosis of S.pneumoniae which comprises the step of bringing into contact a sample to be tested with at least one protein, or homologue, derivative or fragment thereof, as described herein.
- the sample is a biological sample, such as a tissue sample or a sample of blood or saliva obtained from a subject to be tested.
- proteins described herein, or homologues, derivatives and/or fragments thereof can be used to raise antibodies, which in turn can be used to detect the antigens, and hence S.pneumoniae.
- Such antibodies form another aspect of the invention.
- Antibodies within the scope of the present invention may be monoclonal or polyclonal.
- Polyclonal antibodies can be raised by stimulating their production in a suitable animal host (e.g. a mouse, rat, guinea pig, rabbit, sheep, goat or monkey) when a protein as described herein, or a homologue, derivative or fragment thereof, is injected into the animal.
- a suitable animal host e.g. a mouse, rat, guinea pig, rabbit, sheep, goat or monkey
- an adjuvant may be administered together with the protein.
- Well- known adjuvants include Freund's adjuvant (complete and incomplete) and aluminium hydroxide.
- the antibodies can then be purified by virtue of their binding to a protein as described herein.
- Monoclonal antibodies can be produced from hybridomas. These can be formed by fusing myeloma cells and spleen cells which produce the desired antibody in order to form an immortal cell line. Thus the well-known Kohler & Milstein technique (Nature 256 (1975)) or subsequent variations upon this technique can be used.
- the present invention includes derivatives thereof which are capable of binding to proteins etc as described herein.
- the present invention includes antibody fragments and synthetic constructs. Examples of antibody fragments and synthetic constructs are given by Dougall et al in Tibtech 12 372-379 (September 1994).
- Antibody fragments include, for example, Fab, F(ab') 2 and Fv fragments. Fab fragments (These are discussed in Roitt et al [supra] ). Fv fragments can be modified to produce a synthetic construct known as a single chain Fv (scFv) molecule. This includes a peptide linker covalently joining V h and V, regions, which contributes to the stability of the molecule.
- Other synthetic constructs that can be used include CDR peptides. These are synthetic peptides comprising antigen-binding determinants. Peptide mimetics may also be used. These molecules are usually conformationally restricted organic rings that mimic the structure of a CDR loop and that include antigen-interactive side chains.
- Synthetic constructs include chimaeric molecules.
- humanised (or primatised) antibodies or derivatives thereof are within the scope of the present invention.
- An example of a humanised antibody is an antibody having human framework regions, but rodent hypervariable regions. Ways of producing chimaeric antibodies are discussed for example by Morrison et al in PNAS, 81, 6851-6855 (1984) and by Takeda et al in Nature. 314, 452-454 (1985).
- Synthetic constructs also include molecules comprising an additional moiety that provides the molecule with some desirable property in addition to antigen binding.
- the moiety may be a label (e.g. a fluorescent or radioactive label).
- it may be a pharmaceutically active agent.
- Antibodies, or derivatives thereof find use in detection/diagnosis of S.pneumoniae.
- the present invention provides a method for the detection/diagnosis of S.pneumoniae which comprises the step of bringing into contact a sample to be tested and antibodies capable of binding to one or more proteins described herein, or to homologues, derivatives and/or fragments thereof.
- binding proteins selected from combinatorial libraries of an alpha-helical bacterial receptor domain (Nord et al , )
- Small protein domains capable of specific binding to different target proteins can be selected using combinatorial approaches.
- the present invention provides a method for the detection/diagnosis of S.pneumoniae which comprises the step of bringing into contact a sample to be tested with at least one nucleic acid sequence as described herein.
- the sample is a biological sample, such as a tissue sample or a sample of blood or saliva obtained from a subject to be tested.
- samples may be pre-treated before being used in the methods of the invention. Trhus, for example, a sample may be treated to extract DNA.
- DNA probes based on the nucleic acid sequences described herein ie usually fragments of such sequences may be used to detect nucleic acid from S.pneumoniae.
- the present invention provides:
- kits for use in detecting/diagnosing S.pneumoniae infection comprising one or more proteins or polypeptides of the invention, or homologues, derivatives or fragments thereof, or an antigenic composition of the invention;
- kits for use in detecting/diagnosing S.pneumoniae infection comprising one or more nucleic acid molecules as defined herein.
- the present invention also provides a method of determining whether a protein or polypeptide as described herein represents a potential anti-microbial target which comprises inactivating said protein and determining whether S.pneumoniae is still viable, in vitro or in vivo.
- a suitable method for inactivating the protein is to effect selected gene knockouts, ie prevent expression of the protein and determine whether this results in a lethal change. Suitable methods for carrying out such gene knockouts are described in Li et al, P.N.A.S., 94: 13251-13256 (1997).
- the present invention provides the use of an agent capable of antagonising, inhibiting or otherwise interfering with the function or expression of a protein or polypeptide of the invention in the manufacture of a medicament for use in the treatment or prophylaxis of S.pneumoniae infection.
- the vector chosen for use as a DNA vaccine vector was pcDNA3.1 (Invitrogen) (actually pcDNA3.1 + , the forward orientation was used in all cases but may be referred to as pcDNA3.1 here on).
- This vector has been widely and successfully employed as a host vector to test vaccine candidate genes to give protection against pathogens in the literature (Zhang, et al. , Kurar and Splitter, Anderson et al.).
- the vector was designed for high-level stable and non-replicative transient expression in mammalian cells.
- pcDNA3.1 contains the ColEl origin of replication which allows convenient high-copy number replication and growth in E. coli. This in turn allows rapid and efficient cloning and testing of many genes.
- the pcDNA3.1 vector has a large number of cloning sites and also contains the gene encoding ampicillin resistance to aid in cloning selection and the human cytomegalovirus (CMV) immediate-early promoter/enhancer which permits efficient, high-level expression of the recombinant protein.
- CMV human cytomegalovirus
- the CMV promoter is a strong viral promoter in a wide range of cell types including both muscle and immune (antigen presenting) cells. This is important for optimal immune response as it remains unknown as to which cells types are most important in generating a protective response in vivo.
- a T7 promoter upstream of the multiple cloning site affords efficient expression of the modified insert of interest and which allows in vitro transcription of a cloned gene in the sense orientation.
- Oligonucleotide primers were designed for each individual gene of interest derived using the LEEP system. Each gene was examined thoroughly, and where possible, primers were designed such that they targeted that portion of the gene thought to encode only the mature portion of the gene protein. It was hoped that expressing those sequences that encode only the mature portion of a target gene protein, would facilitate its correct folding when expressed in mammalian cells. For example, in the majority of cases primers were designed such that putative N-terminal signal peptide sequences would not be included in the final amplification product to be cloned into the pcDNA3.1 expression vector.
- the signal peptide directs the polypeptide precursor to the cell membrane via the protein export pathway where it is normally cleaved off by signal peptidase I (or signal peptidase II if a lipoprotein). Hence the signal peptide does not make up any part of the mature protein whether it be displayed on the surface of the bacteria surface or secreted. Where a N-terminal leader peptide sequence was not immediately obvious, primers were designed to target the whole of the gene sequence for cloning and ultimately, expression in pcDNA3.1.
- PCR primers were designed for each gene of interest and any and all of the regions encoding the above features was removed from the gene when designing these primers.
- the primers were designed with the appropriate enzyme restriction site followed by a conserved Kozak nucleotide sequence (in all cases) GCCACC was used.
- the Kozak sequence facilitates the recognition of initiator sequences by eukaryotic ribosomes) and an ATG start codon upstream of the insert of the gene of interest.
- the forward primer using a BamHl site the primer would begin GCGGGATCCGCCACCATG followed by a small section of the 5' end of the gene of interest.
- the reverse primer was designed to be compatible with the forward primer and with a Notl restriction site at the 5' end in all cases (this site is TTGCGGCCGC).
- PCR primers The following PCR primers were designed and used to amplify the truncated genes of interest.
- the insert along with the flanking features described above was amplified using PCR against a template of genomic DNA isolated from type 4 S. pneumoniae strain 11886 obtained from the National Collection of Type Cultures.
- the PCR product was cut with the appropriate restriction enzymes and cloned in to the multiple cloning site of pcDNA3.1 using conventional molecular biological techniques.
- Suitably mapped clones of the genes of interested were cultured and the plasmids isolated on a large scale (> 1.5 mg) using Plasmid Mega Kits (Qiagen).
- Successful cloning and maintenance of genes was confirmed by restriction mapping and sequencing ⁇ 700 base pairs through the 5' cloning junction of each large scale preparation of each construct.
- a strain of type 4 was used in cloning and challenge methods which is the strain from which the S. pneumoniae genome was sequenced.
- a freeze dried ampoule of a homogeneous laboratory strain of type 4 S. pneumoniae strain NCTC 11886 was obtained from the National Collection of Type Strains. The ampoule was opened and the cultured re suspended with 0.5 ml of tryptic soy broth (0.5 % glucose, 5% blood). The suspension was subcultured into 10 ml tryptic soy broth (0.5% glucose, 5% blood) and incubated statically overnight at 37 °C.
- This culture was streaked on to 5 % blood agar plates to check for contaminants and confirm viability and on to blood agar slopes and the rest of the culture was used to make 20% glycerol stocks. The slopes were sent to the Public Health Laboratory Service where the type 4 serotype was confirmed.
- a glycerol stock of NCTC 11886 was streaked on a 5 % blood agar plate and incubated overnight in a CO2 gas jar at 37 °C. Fresh streaks were made and optochin sensitivity was confirmed.
- a standard inoculum of type 4 S. pneumoniae was prepared and frozen down by passaging a culture of pneumococcus lx through mice, harvesting from the blood of infected animals, and grown up to a predetermined viable count of around 10 9 cfu/ml in broth before freezing down.
- the preparation is set out below as per the flow chart.
- Virulence Testing Use standard inoculum to determine effective dose
- mice were lightly anaesthetised using halothane and then a dose of 1.4 x 10 5 cfu of pneumococcus was applied to the nose of each mouse. The uptake was facilitated by the normal breathing of the mouse, which was left to recover on its back.
- mice Vaccine trials in mice were carried out by the administration of DNA to 6 week old CBA/ca mice (Harlan, UK). Mice to be vaccinated were divided into groups of six and each group was immunised with recombinant pcDNA3.1 + plasmid DNA containing a specific target-gene sequence of interest. A total of 100 ⁇ g of DNA in Dulbecco's PBS (Sigma) was injected intramuscularly into the tibialis anterior muscle of both legs (50 ⁇ l in each leg). A boost was carried using the same procedure 4 weeks later. For comparison, control groups were included in all vaccine trials.
- mice were challenged intra-nasally with a lethal dose of S. pneumoniae serotype 4 (strain NCTC 11886). The number of bacteria administered was monitored by plating serial dilutions of the inoculum on 5% blood agar plates.
- a problem with intranasal immunisations is that in some mice the inoculum bubbles out of the nostrils, this has been noted in results table and taken account of in calculations. A less obvious problem is that a certain amount of the inoculum for each mouse may be swallowed.
- mice remaining after the challenge were killed 3 or 4 days after infection.
- challenged mice were monitored for the development of symptoms associated with the onset of S. pneumoniae induced-disease. Typical symptoms in an appropriate order included piloerection, an increasingly hunched posture, discharge from eyes, increased lethargy and reluctance to move. The latter symptoms usually coincided with the development of a moribund state at which stage the mice were culled to prevent further suffering.
- mice were deemed to be very close to death, and the time of culling was used to determine a survival time for statistical analysis. Where mice were found dead, the survival time was taken as the last time point when the mouse was monitored alive.
- a positive result was taken as any DNA sequence that was cloned and used in challenge experiments as described above which gave protection against that challenge. Protection was taken as those DNA sequences that gave statistically significant protection (to a 95% confidence level (p ⁇ 0.05)) and also those which were marginal or close to significant using Mann-Whitney or which show some protective features for example there were one or more outlying mice or because the time to the first death was prolonged. It is acceptable to allow marginal or non-significant results to be considered as potential positives when it is considered that the clarity of some of the results may be clouded by the problems associated with the administration of intranasal infections.
- Trial 8 The group vaccinated with ID211 survived significantly longer than unvaccinated controls. 4197.4, 4122.1 and 4126.7 vaccinated groups showed longer mean survival times than the unvaccinated group but the results were not statistically significant. The 4197.4 and 4126.7 groups also showed a prolonged time to the first death and the 4122.1 group showed 1 outlying result.
- Trial 11 The group vaccinated with 4193.1 was the most promising and survived an average of 6.5 hours longer than the pcDNA3.1 + vaccinated group and 6 hours longer than the unvaccinated group although the results were not statistically significant.
- ATCCAATGCTCTTACCAGTTTACGATGAAGATGGAGCAACCTTTAGCCTCTTCCGTCTTAAAGTAGCCATGGACTT GTACGACCTCn GGCAGGTGTTAGCAACACACCAGC GCGAACAAGGTTTTGAGCAAGGATCAAGTCTTGGAACG CCAGCCAAACTTGAAGAAGGAAGGCTTGGTAGGAGGTGGAGTGTATCTTGACTTCCGTAACAACGATGCGCGTCT
- TTCAATAGTTTCATGGGACTTGTACTTGGTCTAC rGGTGGTGTATTTATTCTrGGATTTGTTTCTAAAAA ⁇ TAAACAAGGTGCTTATGCAGCGCTGATTGTATCAACCATCGTCATGGTATTTATTAAATACTTCCTTCCTCCAACA GCTGTTAGCTACTGGGCATATTCATTGATTTCAATCTCTGTATCAGTAGTTTCAGGTTATATTGTATCTGTTCTTAC TGGAAATAAAGTATCTGCACCTAAATATACAACGATTCATGATATTACAGAAATTAAAGCGGATTCAAGTTGGGA AGTTCGTCACTAA
- TGATTTCCAGTTTCTTCTTGC AGCCTTGCTTGCTCCGATTTGTGAGGAAATCTTGTGTCGTGGGATTGTTCCT AAGATTTTCCGAGGCAAGGAGAACN GGGATTTGTAGTCGGTACGATTGTGTTTGCTTTATTGCATCAACCAAGTA
- GCAAGCATGATGATGATGTCAACAGCTC ⁇ GCTTTGGTGGATAAAGGAGAGATGACCAATAAAATCTTCGCTATG GATAATCGTTCCTTCTATAAACCAGATTTAGATTAA
- GTCATTCI GATCCCATCTTCATCTGGTCTTGCCAGCGCAACTATGGGTATCATGGC TCCACTTGGAGAATTTGTAAATGTCCGTCCTAGCTTGATTATCACTGCTTACCAATCTGCTTCAGGTGTCTTGAACT TGATTGCACCAACATCTGGTATTGTGATGGGAGC CTTGCACTTGGACGTATCAACATTGGTACTTGGTGGAAATT CATGGGCAAACTCGTAGTCGCTATTATTGTAGTGACCATCGCCC ⁇ TCTTCCTTGGAACCTTCCTTCCATTCCTAT AA
- CAAGGTGGAAAATCCCTTAGAAATTGAAGGAATCTTATCTAAAACAGATTCGATTCATCGATTATATAAAGGTCA AAATGGCTACGCTI TGAAATTTTCTCACCAGAAGATGATTTGARRTTGATTCATGCGGAAGATGACATAGCAAGT CTAGTAGAAGTAGGAGAAAAGCCTGAATTTCAAACAGATTTGGCATCAATTTC ⁇ TTAAGTAAATTTGAGATTTCTA TGGAATTACATCTCCCAAC GATATCGAAAGTTTCTTGGAATCATCTGAAATTGGGGCATCCCTTGATTTTATTCC AGCTCAGGGGCAGGATT ⁇ GACTGTGGACAATACGGTTACCTGGGACTTATCTATGCTCAAGTTCTTGGTCAATGAA
- GIGTFAVGTLIVGIGLSLGGTTGYA NPARD GPRIMHSILPIPNKGDGDWSYAWIPVVGPVIGAALAVLVFS FZ MTKKKIERISVIHREKILW WYFMRD EQP YSVLERKMFDAA NQDMLAYQ YATIKQITDIRVQTSEADILEAVKE
- VFHEVFEAHYQGKQ ETFSHLL NFAGRGKDERGLRQQVY IYDFLQSTSNPQ WLSESFLKGFE ADFTSE EK TE QIKQALWD ESFFRYHLDNDAKEFAKAAYLENVQ I DEIGSLNQESDSQAYQAV ARVVAISKEKNGRALTNASRKA D KP ADAYNEER TQFAK GQ SDQIAILDYQERYHGDTWKLAKTFQSFMSDFVEAYRQRKRQENAFEFADISHYTIE ILENFPQVRESYQERFHEVMVDEYQDTNH1QERMLE LSNGHNRFMVGDIKQSIYRFRQADPQIFNEKFQRYAQNPQEG RLIILKENFRSSSEVLSATNDVFERLMDQEVGEINYDNKHQ VFANTKLTPNPDNKAAFLLYDKDDTGEEEESQTETK
- VQINPE AAETYKRVVPISMEFVLVKVQKNICLNFFVVLQLLVPSSLVZ
- SUBSTTTUTE SHEET (RULE 26) LVVSFGTEAVAGNAIGEVLTQFNYMPAFGVATATVMLLARAVGEDDWKRVASLSKQTFWLS FLMLPLSFSIYVLGVP LTHLYTTDS AVEASVLVTLFS LGTPMTTGTVIYTAVWQGLGNARLPFYATSIGMWCIRIGTGYLMGIV GWGLPGIW AGSLLDNGFRW FLRYRYQRYMSLKGZ MQTQEKHSQAAVLGLQHLLAMYSGSI VPIMIATALGYSAEQLTYLISTDIFMCGVATFLQLQLNKYFGIGLPVVLGVA
- DAPSQKDMEGRLDLRDEITFTIDGADAKD DDAVHI ALKNGNLEFGVHIADVSYYVTEGSALD EALNRATSVYVTD RVVPMLPER SNGICSLNPQVDRLTQSAIMEID HGRVVNYTITQTVIKTSFRMTYSDVNDILAGDEEKRKEYHKRVSSIE LMAKLHET ENMRVKRGA NFDTNEAKILVDKQG PVDIVLRQRGIAERMIESFMLMANETVAEHFSKLDLPFIYRIHE EPKAEKVQKFIDYASSFGLRIYGTASEISQEALQDIMRAVEGEPYADV SMMLLRSMQQARYSEHNHGHYGLAADYYT HFTSPIRRYPDLLVHRMIRDYGRS EIAEHFEQVIPEIATQSSNRERRAIEAEREVEAM KAEYMEEYVGEEYDAVVSSIV FG FVELPNTVEGLIHITNLPEFYHFNERDLTLRGE SGIT
- IPYSKLSALEE IARMVPISGTGSTVSTNAKPNEVVSS GSLSSNPSSLTTSKE SSASDGYIFNPKDIVEETATAYIVRHGD HFHYIPKSNQIGQPTLPNNSLATPSPSLPINPGTSHE HEEDGYGFDANRIIAEDESGFVMSHGDHNHYFFK D TEEQIK
- MIKTFLSALSVI FSIPIITYSFFPSSNLNIWLSTQPILAQIYAFP ATATMAAILSFLFFFLSFYKKNKQIRFYSGI LLLSLIL LLFGTDKTLSSASNKTKTLKLVTWNVANQIEAQHIERIFSHFDADMAIFPELATNIRGEQENQRI L FHQVGLSMANYD IFTSPPTNSGIAPVTVIVKKSYGFYTEAKTFHTTRFGTIV HSRKQNIPDIIALHTAPPLPG MEIW QD NIIHNQLASKYP KAIIAGDFNATMRHGALAKISSHRDALNA PPFERGTWNSQSPKLFNATIDHI P NHYYV DLDIVSFQNSDHRCIFT EITFZ MNPIQRS AYVSRKRLRSFILFLIL VL AGISACLTLM SNKTVESNLYKS NTSFSI KIENGQTF LSDLASVSKIKGL ENVSPELETVAKL DKEAVTGEQSVERDD SAADNNLVSL
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Medicinal Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Veterinary Medicine (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Pulmonology (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Gastroenterology & Hepatology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Communicable Diseases (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Engineering & Computer Science (AREA)
- Oncology (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Peptides Or Proteins (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
- Investigating Or Analysing Biological Materials (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
Priority Applications (11)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| DE69935986T DE69935986D1 (de) | 1998-07-27 | 1999-07-27 | Streptococcus pneumoniae proteine und nukleinsäuren |
| JP2000562519A JP2002531055A (ja) | 1998-07-27 | 1999-07-27 | 肺炎連鎖球菌のタンパク質及び核酸分子 |
| CN99811015.9A CN1367833B (zh) | 1998-07-27 | 1999-07-27 | 肺炎链球菌的蛋白质和核酸分子 |
| EP99934989A EP1100921B1 (en) | 1998-07-27 | 1999-07-27 | Streptococcus pneumoniae proteins and nucleic acid molecules |
| US09/769,787 US6936252B2 (en) | 1998-07-27 | 2001-01-26 | Streptococcus pneumoniae proteins and nucleic acid molecules |
| US10/873,528 US20050276814A1 (en) | 1998-07-27 | 2004-06-23 | Streptococcus pneumoniae proteins and nucleic acid molecules |
| US11/785,503 US7632515B2 (en) | 1998-07-27 | 2007-04-18 | Streptococcus pneumoniae proteins and nucleic acid molecules |
| US11/785,517 US7722888B2 (en) | 1998-07-27 | 2007-04-18 | Streptococcus pneumoniae proteins and nucleic |
| US11/785,513 US7713534B2 (en) | 1998-07-27 | 2007-04-18 | Streptococcus pneumoniae proteins and nucleic acid molecules |
| US11/785,507 US7648708B2 (en) | 1998-07-27 | 2007-04-18 | Streptococcus pneumoniae proteins and nucleic acid molecules |
| US12/411,487 US8110199B2 (en) | 1998-07-27 | 2009-03-26 | Streptococcus pneumoniae proteins and nucleic acid molecules |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| GBGB9816337.1A GB9816337D0 (en) | 1998-07-27 | 1998-07-27 | Proteins |
| GB9816337.1 | 1998-07-27 | ||
| US12516499P | 1999-03-19 | 1999-03-19 | |
| US60/125,164 | 1999-03-19 |
Related Child Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US09/769,787 Continuation US6936252B2 (en) | 1998-07-27 | 2001-01-26 | Streptococcus pneumoniae proteins and nucleic acid molecules |
Publications (3)
| Publication Number | Publication Date |
|---|---|
| WO2000006737A2 true WO2000006737A2 (en) | 2000-02-10 |
| WO2000006737A3 WO2000006737A3 (en) | 2000-06-29 |
| WO2000006737A8 WO2000006737A8 (en) | 2000-11-09 |
Family
ID=26314125
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/GB1999/002451 Ceased WO2000006737A2 (en) | 1998-07-27 | 1999-07-27 | Streptococcus pneumoniae proteins and nucleic acid molecules |
Country Status (5)
| Country | Link |
|---|---|
| EP (2) | EP1100921B1 (https=) |
| JP (6) | JP2002531055A (https=) |
| AT (1) | ATE361365T1 (https=) |
| DE (1) | DE69935986D1 (https=) |
| WO (1) | WO2000006737A2 (https=) |
Cited By (39)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2000039299A3 (en) * | 1998-12-23 | 2000-11-02 | Iaf Biochem Int | Streptococcus antigens |
| WO2000037105A3 (en) * | 1998-12-21 | 2000-11-09 | Medimmune Inc | Streptococcus pneumoniae proteins and immunogenic fragments for vaccines |
| EP1075841A1 (en) * | 1999-08-13 | 2001-02-14 | Erasmus Universiteit Rotterdam | Pneumococcal vaccines |
| JP2004501618A (ja) * | 2000-06-20 | 2004-01-22 | シャイアー・バイオケム・インコーポレイテッド | ストレプトコッカス抗原 |
| WO2005046721A3 (en) * | 2003-11-10 | 2005-12-01 | Uab Research Foundation | Compositions for reducing bacterial carriage and cns invasion and methods of using same |
| US7074415B2 (en) | 2000-06-20 | 2006-07-11 | Id Biomedical Corporation | Streptococcus antigens |
| US7128919B2 (en) | 2000-08-08 | 2006-10-31 | St. Jude Children's Research Hospital | Group B streptococcus polypeptides nucleic acids and therapeutic compositions and vaccines thereof |
| US7128918B1 (en) | 1998-12-23 | 2006-10-31 | Id Biomedical Corporation | Streptococcus antigens |
| US7262024B2 (en) | 2001-12-20 | 2007-08-28 | Id Biomedical Corporation | Streptococcus antigens |
| US7381815B2 (en) | 1997-07-02 | 2008-06-03 | Sanofi Parker Limited | Nucleic acid and amino acid sequences relating to Streptococcus pneumoniae for diagnostics and therapeutics |
| EP1950302A2 (en) | 1998-12-23 | 2008-07-30 | ID Biomedical Corporation | Streptococcus antigens |
| WO2009111337A1 (en) | 2008-03-03 | 2009-09-11 | Irm Llc | Compounds and compositions as tlr activity modulators |
| JP2009213466A (ja) * | 2001-03-27 | 2009-09-24 | Chiron Srl | Streptococcuspneumoniaeタンパク質および核酸 |
| US7709009B2 (en) | 2003-07-31 | 2010-05-04 | Novartis Vaccines And Diagnostics, Srl | Immunogenic compositions for streptococcus pyogenes |
| US20100143394A1 (en) * | 2006-09-27 | 2010-06-10 | St. Jude Children's Research Hospital | Synthetic streptococcus pneumoniae vaccine |
| WO2010144734A1 (en) | 2009-06-10 | 2010-12-16 | Novartis Ag | Benzonaphthyridine-containing vaccines |
| EP2277896A1 (en) * | 2000-10-27 | 2011-01-26 | Novartis Vaccines and Diagnostics S.r.l. | Nucleic acids and proteins from streptococcus groups A & B |
| US7892552B2 (en) | 2001-08-08 | 2011-02-22 | University Of Utah Research Foundation | Group B Streptococcus polypeptides nucleic acids and therapeutic compositions and vaccines thereof |
| WO2011027222A2 (en) | 2009-09-02 | 2011-03-10 | Novartis Ag | Immunogenic compositions including tlr activity modulators |
| EP2251035A3 (en) * | 2007-04-12 | 2011-03-16 | Stichting Katholieke Universiteit, more particularly the Radboud University Nijmegen Medical Centre | New virulence factors of Streptococcus pneumoniae |
| EP2298934A1 (en) * | 2003-04-15 | 2011-03-23 | Intercell AG | S. pneumoniae antigens |
| WO2011049677A1 (en) | 2009-09-02 | 2011-04-28 | Irm Llc | Compounds and compositions as tlr activity modulators |
| WO2011057148A1 (en) | 2009-11-05 | 2011-05-12 | Irm Llc | Compounds and compositions as tlr-7 activity modulators |
| WO2011084549A1 (en) | 2009-12-15 | 2011-07-14 | Novartis Ag | Homogeneous suspension of immunopotentiating compounds and uses thereof |
| WO2011105891A1 (en) | 2010-02-23 | 2011-09-01 | Stichting Katholieke Universiteit, More Particularly The Radboud University Nijmegen Medical Centre | Combination vaccine for streptococcus |
| WO2011119759A1 (en) | 2010-03-23 | 2011-09-29 | Irm Llc | Compounds (cystein based lipopeptides) and compositions as tlr2 agonists used for treating infections, inflammations, respiratory diseases etc. |
| US8252546B2 (en) | 2006-08-17 | 2012-08-28 | The Uab Research Foundation | Diagnosing pneumococcal pneumonia |
| US8329195B2 (en) | 2007-05-23 | 2012-12-11 | The Uab Research Foundation | Detoxified pneumococcal neuraminidase and uses thereof |
| EP2572726A1 (en) | 2007-08-01 | 2013-03-27 | Novartis AG | Compositions comprising pneumococcal antigens |
| WO2013131983A1 (en) | 2012-03-07 | 2013-09-12 | Novartis Ag | Adjuvanted formulations of streptococcus pneumoniae antigens |
| WO2014118305A1 (en) | 2013-02-01 | 2014-08-07 | Novartis Ag | Intradermal delivery of immunological compositions comprising toll-like receptor agonists |
| WO2014124228A1 (en) * | 2013-02-07 | 2014-08-14 | Children's Medical Center Corporation | Protein antigens that provide protection against pneumococcal colonization and/or disease |
| US8821895B2 (en) | 2000-12-21 | 2014-09-02 | Id Biomedical Corporation Of Quebec | Streptococcus pyogenes antigens and corresponding DNA fragments |
| US8945589B2 (en) | 2003-09-15 | 2015-02-03 | Novartis Vaccines And Diagnostics, Srl | Immunogenic compositions for Streptococcus agalactiae |
| WO2019157509A1 (en) | 2018-02-12 | 2019-08-15 | Inimmune Corporation | Toll-like receptor ligands |
| US11013793B2 (en) | 2018-09-12 | 2021-05-25 | Affinivax, Inc. | Multivalent pneumococcal vaccines |
| US11235047B2 (en) | 2010-03-12 | 2022-02-01 | Children's Medical Center Corporation | Immunogens and methods for discovery and screening thereof |
| WO2022096596A1 (en) | 2020-11-04 | 2022-05-12 | Eligo Bioscience | Cutibacterium acnes recombinant phages, method of production and uses thereof |
| US12036276B2 (en) | 2021-09-09 | 2024-07-16 | Affinivax, Inc. | Multivalent pneumococcal vaccines |
Families Citing this family (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| ES2451620T3 (es) * | 2002-11-07 | 2014-03-28 | Synergy America, Inc. | Composiciones y métodos destinados a tratar o prevenir la infección neumocócica |
| CA2699513C (en) | 2007-09-12 | 2018-03-13 | Novartis Ag | Gas57 mutant antigens and gas57 antibodies |
| GB201509782D0 (en) * | 2015-06-05 | 2015-07-22 | Isis Innovation | Methods and products for fusion protein synthesis |
Family Cites Families (8)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5980909A (en) * | 1991-02-15 | 1999-11-09 | Uab Research Foundation | Epitopic regions of pneumococcal surface protein A |
| CA2116261A1 (en) * | 1993-04-20 | 1994-10-21 | David E. Briles | Epitopic regions of pneumococcal surface protein a |
| US5928900A (en) * | 1993-09-01 | 1999-07-27 | The Rockefeller University | Bacterial exported proteins and acellular vaccines based thereon |
| EP0956289A4 (en) * | 1996-08-16 | 2004-10-13 | Smithkline Beecham Corp | NOVEL PROKARYOTA POLYNUCLEOTIDES AND POLYPEPTIDES AND USES THEREOF |
| JP4469026B2 (ja) * | 1996-10-31 | 2010-05-26 | ヒューマン ジノーム サイエンシーズ,インコーポレイテッド | Streptococcus pneumoniaeの抗原およびワクチン |
| EP0885966A3 (en) * | 1997-06-20 | 1999-12-29 | Smithkline Beecham Corporation | Novel compouds |
| EP0891984A3 (en) * | 1997-06-20 | 2000-01-19 | Smithkline Beecham Corporation | Nucleic acid encoding streptococcus pneumoniae response regulator |
| EP1783224A3 (en) * | 1998-07-27 | 2007-08-15 | Sanofi Pasteur Limited | Streptococcus pneumoniae proteins and nucleic acid molecules |
-
1999
- 1999-07-27 DE DE69935986T patent/DE69935986D1/de not_active Expired - Lifetime
- 1999-07-27 JP JP2000562519A patent/JP2002531055A/ja active Pending
- 1999-07-27 EP EP99934989A patent/EP1100921B1/en not_active Expired - Lifetime
- 1999-07-27 EP EP09001462A patent/EP2053126A1/en not_active Ceased
- 1999-07-27 AT AT99934989T patent/ATE361365T1/de not_active IP Right Cessation
- 1999-07-27 WO PCT/GB1999/002451 patent/WO2000006737A2/en not_active Ceased
-
2008
- 2008-03-26 JP JP2008081183A patent/JP2008263969A/ja active Pending
- 2008-03-26 JP JP2008080923A patent/JP2008263968A/ja active Pending
- 2008-03-26 JP JP2008080545A patent/JP2008263966A/ja active Pending
- 2008-03-26 JP JP2008081417A patent/JP2008263970A/ja active Pending
-
2009
- 2009-02-19 JP JP2009035978A patent/JP2009148283A/ja active Pending
Cited By (87)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US7396532B2 (en) | 1997-07-02 | 2008-07-08 | Sanofi Pasteur Limited | Nucleic acid and amino acid sequences relating to Streptococcus pneumoniae for diagnostics and therapeutics |
| US7381816B2 (en) | 1997-07-02 | 2008-06-03 | Sanofi Pasteur Limited | Nucleic acid and amino acid sequences relating to Streptococcus pneumoniae for diagnostics and therapeutics |
| US7404958B2 (en) | 1997-07-02 | 2008-07-29 | Sanofi Pasteur Limited | Nucleic acid and amino acid sequences relating to Streptococcus pneumoniae for diagnostics and therapeutics |
| US7405291B2 (en) | 1997-07-02 | 2008-07-29 | Sanofi Pasteur Limited | Nucleic acid and amino acid sequences relating to Streptococcus pneumoniae for diagnostics and therapeutics |
| US7390493B2 (en) | 1997-07-02 | 2008-06-24 | Sanofi Pasteur Limited | Nucleic acid and amino acid sequences relating to Streptococcus pneumoniae for diagnostics and therapeutics |
| US7381815B2 (en) | 1997-07-02 | 2008-06-03 | Sanofi Parker Limited | Nucleic acid and amino acid sequences relating to Streptococcus pneumoniae for diagnostics and therapeutics |
| US7388090B2 (en) | 1997-07-02 | 2008-06-17 | Sanofi Pasteur Limited | Nucleic acid and amino acid sequences relating to Streptococcus pneumoniae for diagnostics and therapeutics |
| US7385047B1 (en) | 1997-07-02 | 2008-06-10 | Sanofi Pasteur Limited | Nucleic acid and amino acid sequences relating to Streptococcus pneumoniae for diagnostics and therapeutics |
| US8298788B2 (en) * | 1997-07-02 | 2012-10-30 | Sanofi Pasteur Limited | Nucleic acid and amino acid sequences relating to Streptococcus pneumoniae for diagnostics and therapeutics |
| US7381814B1 (en) | 1997-07-02 | 2008-06-03 | Sanofi Pasteur Limted | Nucleic acid and amino acid sequences relating to Streptococcus pneumoniae for diagnostics and therapeutics |
| WO2000037105A3 (en) * | 1998-12-21 | 2000-11-09 | Medimmune Inc | Streptococcus pneumoniae proteins and immunogenic fragments for vaccines |
| EP2050464A3 (en) * | 1998-12-21 | 2012-04-25 | Medimmune, Inc. | Streptococcus pneumoniae proteins and immunogenic fragments for vaccines |
| EA007409B1 (ru) * | 1998-12-23 | 2006-10-27 | Шайе Биокем Инк. | Антигенные полипептиды стрептококков, способы их получения и применения |
| KR100802198B1 (ko) * | 1998-12-23 | 2008-02-11 | 샤이어 바이오켐 인코포레이티드 | 신규한 스트렙토코커스 항원 |
| US7128918B1 (en) | 1998-12-23 | 2006-10-31 | Id Biomedical Corporation | Streptococcus antigens |
| US7635482B2 (en) | 1998-12-23 | 2009-12-22 | Id Biomedical Corporation | Streptococcus antigens |
| WO2000039299A3 (en) * | 1998-12-23 | 2000-11-02 | Iaf Biochem Int | Streptococcus antigens |
| EP1950302A2 (en) | 1998-12-23 | 2008-07-30 | ID Biomedical Corporation | Streptococcus antigens |
| US8211437B2 (en) | 1998-12-23 | 2012-07-03 | Id Biomedical Corporation Of Quebec | Streptococcus antigens |
| EP1075841A1 (en) * | 1999-08-13 | 2001-02-14 | Erasmus Universiteit Rotterdam | Pneumococcal vaccines |
| WO2001012219A1 (en) * | 1999-08-13 | 2001-02-22 | Erasmus Universiteit Rotterdam | Pneumococcal vaccines |
| US7074415B2 (en) | 2000-06-20 | 2006-07-11 | Id Biomedical Corporation | Streptococcus antigens |
| EP2281891A3 (en) * | 2000-06-20 | 2011-08-17 | ID Biomedical Corporation | Streptococcus antigens |
| JP2004501618A (ja) * | 2000-06-20 | 2004-01-22 | シャイアー・バイオケム・インコーポレイテッド | ストレプトコッカス抗原 |
| US7128919B2 (en) | 2000-08-08 | 2006-10-31 | St. Jude Children's Research Hospital | Group B streptococcus polypeptides nucleic acids and therapeutic compositions and vaccines thereof |
| US7645577B2 (en) | 2000-08-08 | 2010-01-12 | St. Jude Children's Research Hospital | Group B streptococcus polypeptides nucleic acids and therapeutic compositions and vaccines thereof |
| US8529912B2 (en) | 2000-08-08 | 2013-09-10 | St. Jude Children's Reseach Hospital | Group B Streptococcus polypeptides, nucleic acids and therapeutic compositions and vaccines thereof |
| US8025890B2 (en) | 2000-10-27 | 2011-09-27 | Novartis Vaccines And Diagnostics, Inc. | Nucleic acids and proteins from streptococcus groups A and B |
| US9738693B2 (en) | 2000-10-27 | 2017-08-22 | Novartis Ag | Nucleic acids and proteins from streptococcus groups A and B |
| US8431139B2 (en) * | 2000-10-27 | 2013-04-30 | Novartis Vaccines And Diagnostics, Inc. | Nucleic acids and proteins from Streptococcus groups A and B |
| EP2277896A1 (en) * | 2000-10-27 | 2011-01-26 | Novartis Vaccines and Diagnostics S.r.l. | Nucleic acids and proteins from streptococcus groups A & B |
| US8137673B2 (en) | 2000-10-27 | 2012-03-20 | Novartis Vaccines And Diagnostics, Inc. | Nucleic acids and proteins from Streptococcus groups A & B |
| US7955604B2 (en) | 2000-10-27 | 2011-06-07 | Novartis Vaccines And Diagnostics, Inc. | Nucleic acids and proteins from streptococcus groups A and B |
| US10428121B2 (en) | 2000-10-27 | 2019-10-01 | Novartis Ag | Nucleic acids and proteins from streptococcus groups A and B |
| US9840538B2 (en) | 2000-10-27 | 2017-12-12 | Novartis Ag | Nucleic acids and proteins from Streptococcus groups A and B |
| US7939087B2 (en) | 2000-10-27 | 2011-05-10 | Novartis Vaccines And Diagnostics, Inc. | Nucleic acids and proteins from Streptococcus groups A & B |
| US9340586B2 (en) | 2000-12-21 | 2016-05-17 | Id Biomedical Corporation Of Quebec | Streptococcus pyogenes antigens and corresponding DNA fragments |
| US8821895B2 (en) | 2000-12-21 | 2014-09-02 | Id Biomedical Corporation Of Quebec | Streptococcus pyogenes antigens and corresponding DNA fragments |
| EP2270177A1 (en) * | 2001-03-27 | 2011-01-05 | Novartis Vaccines and Diagnostics S.r.l. | Streptococcus pneumoniae proteins and nucleic acids |
| JP2009213466A (ja) * | 2001-03-27 | 2009-09-24 | Chiron Srl | Streptococcuspneumoniaeタンパク質および核酸 |
| EP2278009A1 (en) * | 2001-03-27 | 2011-01-26 | Novartis Vaccines and Diagnostics S.r.l. | Streptococcus pneumoniae proteins and nucleic acids |
| US7892552B2 (en) | 2001-08-08 | 2011-02-22 | University Of Utah Research Foundation | Group B Streptococcus polypeptides nucleic acids and therapeutic compositions and vaccines thereof |
| US7262024B2 (en) | 2001-12-20 | 2007-08-28 | Id Biomedical Corporation | Streptococcus antigens |
| EP2298934A1 (en) * | 2003-04-15 | 2011-03-23 | Intercell AG | S. pneumoniae antigens |
| US7709009B2 (en) | 2003-07-31 | 2010-05-04 | Novartis Vaccines And Diagnostics, Srl | Immunogenic compositions for streptococcus pyogenes |
| US8128936B2 (en) | 2003-07-31 | 2012-03-06 | Novartis Vaccines And Diagnostics, S.R.L. | Immunogenic compositions for Streptococcus pyogenes |
| US9056912B2 (en) | 2003-07-31 | 2015-06-16 | Novartis Vaccines And Diagnostics, Srl | Immunogenic compositions for Streptococcus pyogenes |
| US8945589B2 (en) | 2003-09-15 | 2015-02-03 | Novartis Vaccines And Diagnostics, Srl | Immunogenic compositions for Streptococcus agalactiae |
| WO2005046721A3 (en) * | 2003-11-10 | 2005-12-01 | Uab Research Foundation | Compositions for reducing bacterial carriage and cns invasion and methods of using same |
| US9132179B2 (en) | 2003-11-10 | 2015-09-15 | The Uab Research Foundation | Compositions for reducing bacterial carriage and CNS invasion and methods of using same |
| US8252546B2 (en) | 2006-08-17 | 2012-08-28 | The Uab Research Foundation | Diagnosing pneumococcal pneumonia |
| US8722055B2 (en) * | 2006-09-27 | 2014-05-13 | St. Jude Children's Research Hospital | Synthetic Streptococcus pneumoniae vaccine |
| US9249199B2 (en) | 2006-09-27 | 2016-02-02 | St. Jude Children's Research Hospital | Synthetic Streptococcus pneumoniae vaccine |
| US20100143394A1 (en) * | 2006-09-27 | 2010-06-10 | St. Jude Children's Research Hospital | Synthetic streptococcus pneumoniae vaccine |
| US10485860B2 (en) | 2007-04-12 | 2019-11-26 | Stichting Katholieke Universiteit / Radboud University Nijmegen Medical Centre | Virulence factors of Streptococcus pnuemoniae |
| EP2450054A1 (en) * | 2007-04-12 | 2012-05-09 | Stichting Katholieke Universiteit, more particularly the Radboud University Nijmegen Medical Centre | New virulence factors of Streptococcus pneumoniae |
| EP2251035A3 (en) * | 2007-04-12 | 2011-03-16 | Stichting Katholieke Universiteit, more particularly the Radboud University Nijmegen Medical Centre | New virulence factors of Streptococcus pneumoniae |
| US8329195B2 (en) | 2007-05-23 | 2012-12-11 | The Uab Research Foundation | Detoxified pneumococcal neuraminidase and uses thereof |
| US9080159B2 (en) | 2007-05-23 | 2015-07-14 | The Uab Research Foundation | Detoxified pneumococcal neuraminidase and uses thereof |
| EP2572726A1 (en) | 2007-08-01 | 2013-03-27 | Novartis AG | Compositions comprising pneumococcal antigens |
| WO2009111337A1 (en) | 2008-03-03 | 2009-09-11 | Irm Llc | Compounds and compositions as tlr activity modulators |
| WO2010144734A1 (en) | 2009-06-10 | 2010-12-16 | Novartis Ag | Benzonaphthyridine-containing vaccines |
| WO2011027222A2 (en) | 2009-09-02 | 2011-03-10 | Novartis Ag | Immunogenic compositions including tlr activity modulators |
| WO2011049677A1 (en) | 2009-09-02 | 2011-04-28 | Irm Llc | Compounds and compositions as tlr activity modulators |
| WO2011057148A1 (en) | 2009-11-05 | 2011-05-12 | Irm Llc | Compounds and compositions as tlr-7 activity modulators |
| US10046048B2 (en) | 2009-12-15 | 2018-08-14 | Glaxosmithkline Biologicals S.A. | Homogenous suspension of immunopotentiating compounds and uses thereof |
| WO2011084549A1 (en) | 2009-12-15 | 2011-07-14 | Novartis Ag | Homogeneous suspension of immunopotentiating compounds and uses thereof |
| US9408907B2 (en) | 2009-12-15 | 2016-08-09 | Glaxosmithkline Biologicals Sa | Homogenous suspension of immunopotentiating compounds and uses thereof |
| WO2011105891A1 (en) | 2010-02-23 | 2011-09-01 | Stichting Katholieke Universiteit, More Particularly The Radboud University Nijmegen Medical Centre | Combination vaccine for streptococcus |
| US11235047B2 (en) | 2010-03-12 | 2022-02-01 | Children's Medical Center Corporation | Immunogens and methods for discovery and screening thereof |
| US12370246B2 (en) | 2010-03-12 | 2025-07-29 | Children's Medical Center Corporation | Immunogens and methods for discovery and screening thereof |
| WO2011119759A1 (en) | 2010-03-23 | 2011-09-29 | Irm Llc | Compounds (cystein based lipopeptides) and compositions as tlr2 agonists used for treating infections, inflammations, respiratory diseases etc. |
| WO2013131983A1 (en) | 2012-03-07 | 2013-09-12 | Novartis Ag | Adjuvanted formulations of streptococcus pneumoniae antigens |
| WO2014118305A1 (en) | 2013-02-01 | 2014-08-07 | Novartis Ag | Intradermal delivery of immunological compositions comprising toll-like receptor agonists |
| US9827190B2 (en) | 2013-02-01 | 2017-11-28 | Glaxosmithkline Biologicals Sa | Intradermal delivery of immunological compositions comprising toll-like receptor 7 agonists |
| US11576958B2 (en) | 2013-02-07 | 2023-02-14 | Children's Medical Center Corporation | Protein antigens that provide protection against pneumococcal colonization and/or disease |
| WO2014124228A1 (en) * | 2013-02-07 | 2014-08-14 | Children's Medical Center Corporation | Protein antigens that provide protection against pneumococcal colonization and/or disease |
| US12083173B2 (en) | 2013-02-07 | 2024-09-10 | Children's Medical Center Corporation | Protein antigens that provide protection against pneumococcal colonization and/or disease |
| EP4410802A2 (en) | 2018-02-12 | 2024-08-07 | Inimmune Corporation | Toll-like receptor ligands |
| WO2019157509A1 (en) | 2018-02-12 | 2019-08-15 | Inimmune Corporation | Toll-like receptor ligands |
| US11701416B2 (en) | 2018-09-12 | 2023-07-18 | Affinivax, Inc. | Multivalent pneumococcal vaccines |
| US11013793B2 (en) | 2018-09-12 | 2021-05-25 | Affinivax, Inc. | Multivalent pneumococcal vaccines |
| US12370247B2 (en) | 2018-09-12 | 2025-07-29 | Affinivax, Inc. | Multivalent pneumococcal vaccines |
| WO2022096590A1 (en) | 2020-11-04 | 2022-05-12 | Eligo Bioscience | Phage-derived particles for in situ delivery of dna payload into c. acnes population |
| WO2022096596A1 (en) | 2020-11-04 | 2022-05-12 | Eligo Bioscience | Cutibacterium acnes recombinant phages, method of production and uses thereof |
| US12036276B2 (en) | 2021-09-09 | 2024-07-16 | Affinivax, Inc. | Multivalent pneumococcal vaccines |
| US12377140B2 (en) | 2021-09-09 | 2025-08-05 | Affinivax, Inc. | Multivalent pneumococcal vaccines |
Also Published As
| Publication number | Publication date |
|---|---|
| EP1100921B1 (en) | 2007-05-02 |
| ATE361365T1 (de) | 2007-05-15 |
| JP2008263968A (ja) | 2008-11-06 |
| JP2008263970A (ja) | 2008-11-06 |
| EP2053126A1 (en) | 2009-04-29 |
| JP2009148283A (ja) | 2009-07-09 |
| JP2008263966A (ja) | 2008-11-06 |
| WO2000006737A3 (en) | 2000-06-29 |
| JP2008263969A (ja) | 2008-11-06 |
| JP2002531055A (ja) | 2002-09-24 |
| DE69935986D1 (de) | 2007-06-14 |
| WO2000006737A8 (en) | 2000-11-09 |
| EP1100921A2 (en) | 2001-05-23 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| WO2000006737A2 (en) | Streptococcus pneumoniae proteins and nucleic acid molecules | |
| US8110199B2 (en) | Streptococcus pneumoniae proteins and nucleic acid molecules | |
| JP2002521058A (ja) | 肺炎連鎖球菌由来の核酸及びタンパク質 | |
| JP2002533123A (ja) | 新規連鎖球菌抗原 | |
| US20100143415A1 (en) | Streptococcus Pneumoniae Antigens | |
| US20040265933A1 (en) | Proteins | |
| ES2325911T3 (es) | Fragmento genomico de streptococcus suis y usos clinicos del mismo. | |
| CN1367833B (zh) | 肺炎链球菌的蛋白质和核酸分子 | |
| US8632784B2 (en) | Nucleic acids and proteins from Streptococcus pneumoniae | |
| EP1783224A2 (en) | Streptococcus pneumoniae proteins and nucleic acid molecules | |
| EP1801218A2 (en) | Nucleic acids and proteins from streptococcus pneumoniae | |
| EP1624064A2 (en) | Nucleic acids and proteins from streptococcus pneumoniae | |
| CN101108877A (zh) | 肺炎链球菌的核酸和蛋白质 | |
| US20110305688A1 (en) | New virulence factors of streptococcus pneumoniae |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| WWE | Wipo information: entry into national phase |
Ref document number: 99811015.9 Country of ref document: CN |
|
| AK | Designated states |
Kind code of ref document: A2 Designated state(s): CN JP US |
|
| AL | Designated countries for regional patents |
Kind code of ref document: A2 Designated state(s): AT BE CH CY DE DK ES FI FR GB GR IE IT LU MC NL PT SE |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application | ||
| DFPE | Request for preliminary examination filed prior to expiration of 19th month from priority date (pct application filed before 20040101) | ||
| AK | Designated states |
Kind code of ref document: A3 Designated state(s): CN JP US |
|
| AL | Designated countries for regional patents |
Kind code of ref document: A3 Designated state(s): AT BE CH CY DE DK ES FI FR GB GR IE IT LU MC NL PT SE |
|
| AK | Designated states |
Kind code of ref document: C1 Designated state(s): CN JP US |
|
| AL | Designated countries for regional patents |
Kind code of ref document: C1 Designated state(s): AT BE CH CY DE DK ES FI FR GB GR IE IT LU MC NL PT SE |
|
| WR | Later publication of a revised version of an international search report | ||
| WWE | Wipo information: entry into national phase |
Ref document number: 09769787 Country of ref document: US |
|
| ENP | Entry into the national phase |
Ref document number: 2000 562519 Country of ref document: JP Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 1999934989 Country of ref document: EP |
|
| WWP | Wipo information: published in national office |
Ref document number: 1999934989 Country of ref document: EP |
|
| WWG | Wipo information: grant in national office |
Ref document number: 1999934989 Country of ref document: EP |