WO1997012975A1 - An epithelial protein and dna thereof for use in early cancer detection - Google Patents
An epithelial protein and dna thereof for use in early cancer detection Download PDFInfo
- Publication number
- WO1997012975A1 WO1997012975A1 PCT/US1996/015825 US9615825W WO9712975A1 WO 1997012975 A1 WO1997012975 A1 WO 1997012975A1 US 9615825 W US9615825 W US 9615825W WO 9712975 A1 WO9712975 A1 WO 9712975A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- cancer
- protein
- hnrnp
- cell
- peptide
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
- C12Q1/00—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
- C12Q1/68—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving nucleic acids
- C12Q1/6809—Methods for determination or identification of nucleic acids involving differential detection
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
- C07K14/4701—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
- C07K14/4747—Apoptosis related proteins
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
- C12Q1/00—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
- C12Q1/68—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving nucleic acids
- C12Q1/6813—Hybridisation assays
- C12Q1/6816—Hybridisation assays characterised by the detection means
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
- C12Q1/00—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
- C12Q1/68—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving nucleic acids
- C12Q1/6813—Hybridisation assays
- C12Q1/6841—In situ hybridisation
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
- C12Q1/00—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
- C12Q1/68—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving nucleic acids
- C12Q1/6876—Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes
- C12Q1/6883—Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes for diseases caused by alterations of genetic material
- C12Q1/6886—Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes for diseases caused by alterations of genetic material for cancer
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
- C12Q2600/00—Oligonucleotides characterized by their use
- C12Q2600/136—Screening for pharmacological compounds
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
- C12Q2600/00—Oligonucleotides characterized by their use
- C12Q2600/158—Expression markers
Definitions
- the present invention relates to the area of cancer diagnostics and therapeutics. More specifically, the invention relates to the isolation and purification of an early cancer detection marker protein of epithelial cells and the cloning of the DNA sequence encoding the protein. The invention further relates to the protein and DNA sequence for detecting and diagnosing individuals predisposed to cancer. The present inventin relates to a computerized method for generating a discriminant function predictive of cancer. The present invention also relates to therapeutic intervention to regulate the expression of the gene product. Background of the Invention
- Lung cancer is the most frequent cause of cancer death of both males and females in the United States, accounting for one in three cancer deaths (1) .
- cancer-related survival of this disease has improved only minimally.
- Successful treatment of this disease by surgical resection and drug chemotherapy is strongly dependent on identification of early-stage tumors.
- a conceptually attractive early detection approach is to establish the presence of a cancer by evaluation of shed bronchial epithelial cells.
- Saccomanno et al. proposed the use of sputum cytology to evaluate cytomorphologic changes in the exfoliated bronchial epithelium as a technique to enhance the early detection of lung cancer ⁇ 2) .
- clinical trials using o combination chest X-ray and sputum cytology have not shown any decrease in cancer-related mortality 0 *.
- Tockman et al. reported a sensitive method for early lung cancer detection by immunostaining cells contained within sputum samples with 5 two lung cancer-associated monoclonal antibodies' 4 '.
- the basis for this approach was to identify early pre-neoplastic changes in cells shed from bronchial epithelium.
- the antibodies used in that study were mouse monoclonal IgG's designated 703D4, disclosed in U.S. Patent No. 4,569,788, and 624H12.
- 703D4 alone identified 20 of the 21 detected true positive cases (4; U.S. Serial No. 08/152,881 which issues to Letters Patent No.
- 624H12 has been shown to detect an oncofetal antigen which is the Lewis x -related portion of a cell- surface glycoprotein (Mulshine/Magnani).
- the antigen for 703D4 was unknown.
- 703D4 was developed by immunization using a whole tumor cell extract, coupled to keyhole limpet hemocyanin, and selection was based on discrimination amongst subtypes of lung cancer histological subtypes. Preliminary 0 studies showed the 703D4 antibody recognized a protein expressed by most non- small cell lung cancer cells (5) . Immunoprecipitation defined a protein of Mr > 31 kDa. Since 703D4 demonstrated the ability to selectively detect changes related to the development of cancer in shed bronchial epithelium from the proximal airways, g the antigen recognized by 703D4 was purified in the present invention to determine its identity and explore its relationship to early lung cancer detection. The present invention uses a biochemical approach for identification of the epithelial protein from non-small cell lung tumor cells.
- This cytomoiphologic classification is useful in defining preneoplastic changes in the proximal region of the lung cancer "field".
- comparable 5 events preceding the other major lung cancer histologies, especially those arising in the peripheral lung (terminal and respiratory bronchioles, alveolar epithelium) are not well defined.
- the present invention describes the isolation and identification of an epithelial protein which is an early marker for cancer. It is an object of the present invention to provide an isolated and purified epithelial protein, peptide, or variants thereof which are an early marker for lung cancer.
- the method comprises isolating cells, tissues or extracts thereof from a human and detecting the gene or portion thereof encoding an epithelial protein which is an early marker for cancer or their expression products from the 5 cells, tissue or extracts thereof, wherein detection of a quantitative increase in the gene or expression products indicates preneoplasia and neoplasia.
- Another object of the invention is a method for detecting mutations of a gene encoding the epithelial protein which is an early marker for cancer, contained within clones expressing the gene recovered from cancer cells.
- Another method for diagnosing human preneoplastic and neoplastic cells and tissues is by detecting post-translational modifications of the epithelial protein in the preneoplastic and neoplastic cells and tissue by immunoassays such as Western blot or immunoelectrophoresis using an antibody that is reactive with the epithehal protein, by two-dimensional electrophoresis or by reverse-phase HPLC.
- immunoassays such as Western blot or immunoelectrophoresis using an antibody that is reactive with the epithehal protein, by two-dimensional electrophoresis or by reverse-phase HPLC.
- Still another object of the invention is to provide the epithelial protein, peptides or variants thereof which one substantially homologous to a portion of at least one heterogenous nuclear ribonucleotide protein for use in diagnostic and detection assays, in particular for immunoassays.
- One object of the invention is an inhibitory protein analog of the epithelial protein which is capable of binding to the same binding site recognized by the epithelial protein on RNA. Such an analog is capable of competitively inhibiting the function of the epithelial protein, peptide or variant thereof in vitro and in vivo.
- the method comprises isolating a mammalian biological sample and detecting a nucleic acid sequence encoding an epithelial protein or portion thereof which is an early marker for cancer.
- the present invention also provides a method of computer-assisted o determination of cancer and precancer in a mammal and an algorithm useful for same.
- Another aspect of the invention is a method of computerized detection of hnRNP mRNA in a biological sample. 5 It is yet another aspect of the invention to provide a method of computerized diagnosis of cancer and precancer in a mammal.
- Another aspect of the invention is a method of computer-assisted prediction of cancer in a mammal based on image analysis.
- a further aspect of the invention is a method for generating a discriminant function useful in identifying atypical cells and in predicting cancer based on computerized image analysis.
- a further aspect of the invention is a method of computerized diagnosis of cancer and precancer in a mammal comprising dual-wavelength image densitometry.
- Another aspect of the invention is a system for determining an atypical cell from a normal or typical cell in which the system comprises an optical image generator, a device for acquiring an optical image, a processor for analyzing the optical image for cellular parameters unique to an atypical cell and a program for determining a discriminant function.
- the discriminant function discriminants between atypical or abnormal cells and typical or normal cells.
- the system is particularly useful in predicting the development of cancer in an individual.
- Yet another object of the invention is to provide a method of altering or downregulating the expression of the gene or portion thereof encoding an epithelial protein or portion thereof which is an early marker for cancer of epithelial cells which comprises introduction of antisense oligonucleotides which are substantially complementary to the gene in the epithelial cell.
- the antisense oligonucleotide allows for non-neoplastic growth of the epithelial cell.
- Another object of the invention is to provide a method for screening for chemotherapeutic drugs and for monitoring the efficacy of a chemotherapeutic and intervention drugs. It is a further object of the invention to provide a transgenic animal which has incorporated into its genome one or more copies of a nucleic acid o sequence which encodes an epithelial protein which is an early marker for cancer. The incoiporation of the nucleic acid sequence results in overexpression or expression of multiple forms or variants of the epithelial protein. The resulting transgenic animal is more prone to develop cancer and may develop cancer at an 5 accelerated rate at one or more locations in the body. Such transgenic animals are useful for screening therapeutic drugs useful for treating or inhibiting cancer. It is yet another object of the invention to provide an antibody reactive to an epithelial protein, peptide or variant thereof. Such antibodies are -rank useful in diagnosis and treatment of cancer.
- Figure 1 shows the DNA coding sequence of heterogenous ribonucleoprotein Al (hnRNP) and hnRNP A2.
- Figure 2 shows the full DNA sequence of human hnRNP A2 disclosed by Burd, C.G. et al Proc. Nat'l Acad. Sci. USA 86, 9788-9792 (1989).
- Figure 3 shows the full DNA sequence of human hnRNPBl disclosed by Burd, C.G. et al Proc. Nat'l Acad. Sci. USA 86:9788-9792 (1989).
- Figure 4 shows the amino acid sequence of peptides sequenced from
- Figures 5a through 5e show polymeric reversed phase HPLC purification of 703D4 antigen.
- 10 mm X 10 cm Poros perfusion polymeric C, g column was equilibrated with 5 % acetonitrile/0.1 % TFA (5a) and 5 % methanol/0.1 % HFBA (5d).
- Protein was eluted with a gradient of 5-100% 5 acetonitrile (5A) and 5-100% methanol (5d) at a flow rate of 10 ml/min.
- Fractions were run on two identical SDS-PAGE gels and one stained with Coomassie blue (5c, 5f), the other transferred to PVDF for reaction with 703D4 antibody (5b, 5e).
- Figures 6a through 6c show C 4 reversed phase HPLC purification of 703D4 antigen.
- 6a, c4 column eluted with a gradient of 33-48% acetonitrile in 0.1 % TFA.
- 6b and 6c shown Western blot and Coomassie blue analysis of eluted fractions, respectively (49, 32 and 18 kDa protein standards are on the right).
- Figure 7a shows the amino acid alignment of the peptides of the present invention with heterogeneous nuclear ribonucleoprotein B2 (hnRNP-.A2 is 0 denoted by ⁇ skipped area) •, * methionines; * peptides produced by CNBr at this Met too small for Tricine SDS-PAGE.
- Figure 7b shows the N-terminal amino acid sequences and approximate Mr of CNBr cleavage fragments of the purified 703D4 major (hnRNP- 5 A2) and minor (hn-RNP-Bl) antigens.
- .Arrows indicate the positions of methionines within the protein, and the carrot indicates the site of alternately spliced exon differentiating hnRNP- A2 from Bl. The exact methionine at which the 15 kDa and 27 kDa peptides terminates could not be determined from the SDS- PAGE analysis. All peptides which were not recovered are too small to be 0 resolved from the migration front of the Tricine SDS-PAGE gel ( ⁇ 2.5 kDa).
- Figure 8 shows 16% tricine SDS-PAGE analysis of products of CNBr digestion of purified 703D4 principal antigen. Note the left lane is the antigen before digestion, the arrows indicated the four visible bands which 5 subjected to amino-terminal sequencing.
- Figure 9a shows expression of hnRNP- A2/B1 mRNA in lung derived cell cultures.
- 9a Northern analysis of NSCLC cell lines (NCI-H720, H157, HTB58, H520, H676, H1437, H549, H820, H4670, HI 155) and SCLC cell lines (NCI-H889, H417, H209, H345).
- All cells were harvested in station phase and analyzed as described in Materials and Methods. 28S rRNA band visualized under UV illumination used for quantification.
- Figure 9b shows RT-PCR of mRNA from cell lines NCI-H720, H1355, H157, HI 155, normal lung and normal bronchial epithelium primary culture. Expected size of the products is 280 bp (hnRNP- A2) and 316 bp (hnRNP- Bl). RT-PCR was carried out as described in Materials and Methods. Products were analyzed on 2% agarose TBE-gels, transferred to nitrocellulose, and probed with an end-labelled 20nt primer common to both hnRNP- A2 and -Bl.
- Figure 10 shows proliferation-dependent control of hnRNP- A2/B1 expression.
- Quantification of the loaded RNA was obtained by ethidium bromide staining of 28s rRNA (EtBr).
- Figure 11A through 11C shows P31 expression pattern in primary
- NSCLC 6A Focal cytoplasmic p31 staining in squamous cell carcinoma (Immunohistochemical staining, X360).
- WP Diffuse p31 expression with granular staining in an adjacent area at pulmonary adenocarcinoma. Note perinuclear staining pattern, inset. (Immunoperoxidase, X360).
- 11C Pulmonary adenocarcinoma with membranous expression pattern (Immunoperoxidase, X270).
- Figure 12 A through 12D shows P31 expression pattern in non- neoplastic lung (lacking histologic abnormalities).
- 12 A Diffuse granular localization of p31 towards the apical portion of ciliated and non-ciliated bronchial epithelium. Note faint staining of underlying basal cells (arrows) (Immunohistochemical staining, X225).
- 12B Strong p31 expression in bronchial glands (Immunoperoxidase, X225).
- 12C p31 expression in bronchial (Immunohistochemical staining, X270).
- 12D Localization of p31 in normal type ⁇ cells. Note moderate staining intensify and the distribution of normal type ⁇ cells along alveolar delicate (normal) septa. (Immunoperoxidase, X360).
- Figure 13A through 13B show variable localization of p31 expression in type ⁇ cell hyperplasia.
- 13 A Type II hypeiplasia demonstrating strong diffuse cytcplasmic p31 immunoreactivity. Note increased number of type ⁇ cells and presence of fibrosis as compared with normal alveolar epithelium in 5 Figure 12D (Immunohistochemical of p31 in type ⁇ cell hyperplasia.
- Figure 14 shows standardization and calibration procedure for dual- ⁇ n wavelength image densitometry.
- Figures 15A-15D show expression of hnRNP A2 mRNA/protein in a control mixture of Calu-3 cells plus normal sputum cells.
- Figures 16A-16D show expression of hnRNP A2 mRN.A/protein in clinical sputum cells.
- Figure 17A-17D show expression of hnRNP in developing mouse lung.
- the present invention is an isolated and purified protein, peptide and derivatives thereof as well as variants thereof which is an early detection marker for cancer.
- the protein, peptides and variants thereof are characteristically present in low levels from normal cells and are present in high levels from pre-cancer and 5 most cancer cells.
- variants include altered proteins that arise from
- DNA mutations alternate exon splicing and post translational modifications. Expression of such variant proteins correlates with transformation of normal cells to a precancer or cancer cell.
- an 31 protein having a molecular weight of 0 about 31 KDa to about 35KDa and peptides and variants thereof isolated and purified from pre-neoplastic and neoplastic cells of the lung, colon, kidney, bone, breast, prostate, melanoma, myeloma and the like.
- the protein and peptides and variants thereof of the present invention are markers for epithelial cells which are 5 committed to a pathway of transformation leading to development of lung cancer.
- a preferred protein and variant thereof is isolated from human lung cancer cells, in particular, non-small cell cancer cells.
- the isolated and purified protein and variants thereof of the present invention comprises at least one of the following amino acid sequences, preferably more than one of the sequences: AARPHSIDGRVV (SEQ ID. NO.: 1)
- REKEQFRKL ⁇ (SEQ ID. NO. : 3)
- EKTKETVPLERKKRE SEQ ID. NO.: 4
- AARPSDGRW (SEQ ID. NO.: 5)
- EREKEQFRKLFI SEQ ID. NO.: 6
- the protein, peptide and variants thereof are characterized by a molecular weight of about 4kDa and comprises the amino acid sequence according to sequence I.D. No.: 3.
- the protein, peptide and variants thereof are characterized by a molecular weight of about 27 kDa and comprises the amino acid sequence according to sequence I.D. No.: 1.
- the protein, peptide and variants thereof are characterized by a molecular weight of about 13 kDa and comprises the amino acid sequence according to sequence I.D. No.: 1.
- the protein, peptide and variants thereof are characterized by a molecular weight of 15 kDa and comprises amino acid sequence I.D. No.: 2.
- the protein, peptides and variants thereof share partial amino acid sequence homology with at least one or more heterogenous nuclear nbonucleotide proteins (hn-RNP).
- the protein peptides and variants of the present invention may share partial amino acid sequence homology with one or more of the hn-RNP selected from the group consisting of hn-RNPAl, hn-RNPA2, hn-RNP-Bl, hn-RNPB2, hn-RNPCl, hn-RNPC2 and hn-RNPC3.
- the protein shares partial amino acid sequence homology with hn ⁇ RNP A2.
- the protein shares partial amino acid sequence homology with hn-RNP Bl .
- the protein shares partial amino acid sequence homology with hn-RNP A2 and hn- RNP Bl.
- partial amino acid sequence homology is meant a protein, peptide or variant thereof having at least 70% sequence homology with at least one hn-RNP, preferably at least about 90% sequence homology, more preferably at least about 95% sequence homology with at least one or more hn-RNP.
- the protein, peptide or variant shares sequence homology with the following amino acid sequence or portion thereof: 1 MEktlervplerkkREKEQFRi ⁇ -FIGGI ⁇ FE ⁇
- the protein peptide or variant thereof shares sequence homology with the following amino acid sequence or portion thereof:
- Variants include but are not limited to proteins and peptides that vary in amino acid sequence by one or more than one amino acid, preferably do not vary by more than 10 amino acids, preferably not more than 5 amino acids, more preferably not more than 1-3 amino acids.
- the amino acid change may be conservative substitutions, deletions and the like. Examples of these amino acid changes include but are not limited to alteration of aromatic amino acid to alter DNA/RNA binding sites; methylation of arginine, lysine or histidine including N°, N°-dimethyl-arginine near the COOH terminus; phosphoserines or phosphothreonine, blocked N-terminus glycosylation, and the like.
- Variants also encompass alternate mRNA splice forms of the protein or peptides.
- variants are proteins and peptides having one or more post-translational modifications of amino acids. Examples of post- translational modifications include but are not limited to glycosylation, phosphorylation, methylation, ADP ribosylation and the like.
- the variant has a post-translational modification of a methylation on the N-terminal amino acid or phosphorylations of serines and threonines.
- the variant has a post-translational modification of C-terminal glycines for affecting o protein binding.
- variants are derivatives of the proteins, peptides and post-translational modified proteins and peptides that may have other constituents attached thereto such as radiolabels, biotin, fluorescein and 5 chemiluminescent labels and the like.
- Inhibitory protein or peptide analogs are also encompassed in the invention. Such inhibitory protein or peptide analogs are capable of competitively inhibiting the binding of the epithelial protein to its binding site on RNA.
- hnRNP A2/ I The identification of the 703D4 early lung cancer detection antigen as sharing amino acid sequence homology with hnRNP A2/ I is provocative in light of the emerging knowledge about the hnRNP group of proteins (Burd and Dreyfuss, Science. Vol. 265 (July 29) pp. 615-621 , 1994).
- the family of hnRNP have roles in RNA processing, including pre-mRNA exon splicing and splice site choice, and also in transcription, DNA replication, and recombination (reviewed in Dreyfuss et al., Ann Rev Biochem.. Vol. 62, pp 289-321, year 1993.
- hnRNPs are involved in shuttling mRNA from the nucleus to the cytosol, which is consistent with both our immunohistochemical localization reported previously and 0 subcellular fractionation. A variety of post-translational modifications have been reported for members of the hnRNP family.
- Post-translational modifications of the epithelial protein, peptide or variants thereof of the present invention are identified by methods known in the art 5 such as two dimensional electrophoresis, reverse-phase APLC (Karn, J. et al.
- One method uses two dimensional gels analysis.
- a purified epithelial protein peptide or variant with and without enzymatic treatment is electrophoresed in the first dimension.
- the second dimension is conducted 5 under a pH gradient of about pH 8 to about 9.5 (.Anderson Electrophoresis 12:907,
- the protein peptide or variant may be detected by methods known in the art such as protein staining, radiolabelled metabolic labels, antibody and the like.
- the shift in migration pattern is indicative of a post-translation modification.
- Post-translational modifications are also determined using specific enzymes such as phosphatase, glucosidase and the like to treat samples separated by two dimensional gel electrophoresis or by electrospray .API-mass spectroscopy (Medzihradsky, Am. Soc. Mass. Spec.. 5:350, 1994) and the molecular weight of the treated samples compared with non-treated samples.
- specific enzymes such as phosphatase, glucosidase and the like to treat samples separated by two dimensional gel electrophoresis or by electrospray .API-mass spectroscopy (Medzihradsky, Am. Soc. Mass. Spec.. 5:350, 1994) and the molecular weight of the treated samples compared with non-treated samples.
- the invention demonstrates deregulation and overexpression of the an early lung cancer epithelial protein in cancer cell lines and in transformed bronchial epithelial cells compared to short term, normal primary bronchial epithelial cultures.
- This data parallels previous work on the closely related molecule hnRNP- A 1 which showed deregulation of expression in transformed cells including fibroblast cells (Biamonti, J. Mol. Biol.. Vol. 230, pp 77-89, 1993).
- high level of hnRNP- A 1 expression is maintained in cultures which have reached stationary phase, whereas normal primary fibroblast cultures express hnRNP-Al only during the logarithmic phase of cell growth (Figure 10).
- the protein and variants thereof may be isolated from natural sources or may be chemically synthesized or recombinantly produced by techniques known in the art. Technique for chemical synthesis are described in J.M. Steward and J.D Young, “Solid Phase Peptide Synthesis”, W.H. Freeman & Co., San Francisco, 1969; M. Bodansky, et al. "Peptide Synthesis", John Wiley & Sons,
- the protein, peptides and variant thereof is at least about 90% pure, preferably at least about 95 % pure, more preferably greater than 95 % pure.
- the present invention also encompasses compositions comprising the epithelial protein, peptides, and variants thereof which are early markers for precancer and cancer each as separate molecular species or in the form of complexes.
- the composition comprises one or more proteins, peptides and variants thereof have at least one amino acid sequence defined by SEQ ID NOS: 1- 6 or portions thereof.
- the composition comprises one or more proteins, peptides and variants thereof that share amino acid sequence homology with at least one heterogeneous nuclear ribonucleoprotein.
- the complex of protein, peptides and variants thereof may be held together by covalent or noncovalent bands.
- One or more protein and variants thereof may form the complex.
- the complex comprises at least one protein, peptide or variant thereof that shares amino acid sequence homology with hnRNP A2. In another embodiment the complex comprises at least one protein, peptide or variant thereof that shares amino acid sequence homology with hnRNP Bl . In yet another embodiment, the complex comprises a protein, peptide or variant thereof that shares amino acid sequence homology with hnRNP A2 and a second protein, peptide or variant thereof that shares amino acid sequence homology with hnRNP Bl.
- the present invention provides methods of purifying an epithelial cancer protein, peptides and variants thereof, which are early markers for cancer, that achieves high levels of purification.
- the methods described herein achieve at least 20,000 fold purification, preferably 25,000 fold purification, more preferably greater than 25,000 fold purification compared to the source material.
- the method of purification takes steps to prevent or inhibit degradation of the protein, peptide or variant thereof during the purification process.
- a large amount of starting material is preferred.
- the purification was made possible by the use of enormous numbers of p31 expressing tumor cells approximately greater than about 2.5 x 10" cells.
- the protein, peptides and variants thereof may be used in diagnostic methods and in in vitro assays to detect the presence of a similar protein, peptide and variants thereof present in a biological sample.
- the assays allow for early detection of pre-neoplastic and neoplastic cells and in defining the process of care biogenesis.
- the isolated and purified protein, peptide or variant thereof is useful in immunoassays for the detection of the corresponding protein or variant thereof.
- the immunoassays are qualitative and quantitative.
- the o immunoassays are useful in detection of precancer and cancer cells in which an increase in the quantity of the epithelial protein, peptide or variant thereof is indicative of precancer and cancer.
- the immunoassays are useful in monitoring the efficacy of cancer treatment or intervention in which the absence or 5 decrease in the quantity of the epithelial protein, peptide or variant thereof recovered from a patient undergoing treatment or intervention is an indication of an efficacious treatment.
- Immunoassays of the present invention may be a radioimmunoassay, ] 0 Western blot assay, immunofluorescent assay, enzyme immunoassay, chemiluminescent assay, immunohistochemical assay and the like and may be performed in vitro, in vivo or in situ.
- the standard techniques known in the art for ELISA are described in "Methods in Immunodiagnosis", 2nd Edition, Rose and Bigazzi, eds. John Wiley & Sons, 1980; Campbell et al. , "Methods and
- Bio samples appropriate for such detection assays include, but are not limited to, cells, tissue biopsy extracts, whole blood, plasma, serum, sputum, cerebrospinal fluid, pleural fluid, urine and the 0 like.
- test sample suspected of containing the epithelial protein, peptide or variant thereof is reacted in fluid phase with an antibody known to be reactive with the protein, 5 peptide or variant thereof to form an antigen-antibody complex.
- This fluid phase is then placed on a solid phase reagent having surface bound protein, peptide or variant of the invention. Any antibody which is not in the form of a complex is free to bind to the surface bound protein, peptide or variant thereof.
- the amount of antibody bound to the surface is determined by methods known in the art.
- the 0 solid surface reagent can be prepared by known techniques for attaching protein to solid support material.
- attachment methods include but are not limited to non-specific adsorption of the protein or variant to the support or covalent attachment of the protein or variant to the solid support.
- the 5 antibody is 703D4 disclosed in U.S. Pat. No. 4,569,788.
- the label may be an enzyme which is detected by incubating the o solid support in the presence of a suitable fluorimetric or colorimetric reagent.
- Other detectable labels may be used, such as radiolabels or colloidal gold and the like.
- the protein, peptide and variants thereof may be prepared in the form of a kit, alone, or in combination with other reagents such as antibodies, for use in the immunoassay.
- the protein, peptide and variants thereof may be used to elicit specific antibodies and antigen binding fragments thereof that are immunoreactive with the epithelial protein, peptide or variant thereof.
- antibodies or antigen binding fragment thereof that recognize an epitope which is associated with transformation of a normal cell to a pre-cancer cell.
- the epitope is not present or is present in low amounts in normal cells and is highly expressed in precancer and cancer cells.
- the antibody or antigen binding fragment thereof reacts with an epithelial protein, peptide or variant thereof having a post-translational modification, wherein said post-translational modification is indicative of a precancer or cancer cell.
- the antibodies may be produced by methods disclosed in U.S. Patent No.
- the invention provides a purified and isolated DNA molecule comprising all or part of the nucleic acid sequence that encodes an epithelial protein, peptide or variant thereof, whose expression or overexpression is indicative of a precancer or cancer cell.
- the sequence for the primers used to amplify the entire hnRNP genes was as follows: CTA CAG CGC CAG GAC GAG T (SENSE) CCC ATG GCA AAT AGG AAG AA (ANTI SENSE) These primers allowed for the amplification of the full length of both the A2/B1 genes.
- the isolated DNA or portion thereof encoding the epithelial protein is substantially homologous to portions of the sequences disclosed in Figures 1-3. It is anticipated that the nucleic acid sequence of the present invention varies to a certain extent from that depicted on Figures 1-3.
- the sequences on Figures 1-3 were derived from a cDNA clone from a malignant human osteosarcoma cell line.
- the present invention encompasses the DNA or portion thereof isolated from normal cells and premalignant cells.
- the present invention also provides a recombinant DNA molecule and a vector capable of being propagated and expressed in a prokaryotic or a eukaryotic host cell.
- Expression vectors suitable for use in the invention comprise at least one expression control element operationally linked to the nucleic acid sequence or part thereof.
- Expression control elements are inserted in the vector to control and regulate the expression of the nucleic acid sequence. Examples of expression control elements include, but are not limited to, the lac system, operator and promoter regions of phage lambda, yeast promoters, and promoters derived from vaccinia virus, adenovirus, retrovirus, or SV40.
- the expression vector contains any additional elements necessary for the transfer and subsequent replication of the nucleic acid containing expression vector in the host system. Examples of such elements include, but are not limited to, origins of replication and selectable markers.
- Such expression vectors are commercially available or are readily constructed using methods known to those in the art (eg. F. Ausubel et al, 1987 in: “Current Protocols in Molecular Biology", John Wiley & Sons, New York, NY).
- Examples include, but are not limited to vaccinia virus vectors, adenovirus vectors, herpes virus vectors and baculovirus vectors.
- the recombinant expression vector containing all or part of the nucleic acid sequence encoding the epithelial protein, peptide or variant thereof is transformed, transfected or otherwise inserted into a host organism or cell.
- the host cells transformed with the nucleic acid sequence encoding the epithelial protein of the invention include eukaryotic cells such as animal, plant, insect, algae, and yeast cells, and prokaryotic cells such as R coli.
- eukaryotic host cells include but are not limited to, COS cells, CHO cells, insect cells, bronchial epithelial cells, especially eukaryotic cells that allow for post-translational modifications of the expressed epithelial protein, peptide or variants thereof.
- the means by which the vector carrying the nucleic acid sequence may be introduced into a cell include, but is not limited to, microinjection, electroporation, transduction or transfection using DEAE-dextran, lipofection, calcium phosphate or other procedures known to the use skilled in the art (Sambrook et al, 1989, in: Molecular Cloning. A Laboratory Manual", Cold Springs Harbor Press, Plain view, New York).
- the expressed recombinant epithelial protein, peptides or variants thereof may be detected by methods known in the art, including but not limited to, Coomassie blue staining, silver staining and Western blot analysis using antibodies specific for the epithelial protein, peptides or variants thereof as described herein.
- the recombinant epithelial protein, peptides and variants thereof of o the present invention may be isolated and purified using the protocol described herein including anion exchange chromatography, preparative isoelectric focusing, polymer-based C, custom HPLC and analytic C 4 HPLC.
- the genes or gene products of epithelial protein, peptides or variants 5 thereof can be detected in mammalian biological samples such as blood, serum, stool, urine, ammotic fluid, sputum, bone tissue biopsy specimens and the like. Of particular interest is the detection of an epithelial protein, peptide or variant thereof having sequence homology with at least one hnRNP gene or gene product.
- mammalian biological samples such as blood, serum, stool, urine, ammotic fluid, sputum, bone tissue biopsy specimens and the like.
- an epithelial protein, peptide or variant thereof having sequence homology with at least one hnRNP gene or gene product.
- early detection of precancer cells may be achieved and in turn early treatment may be provided to the mammal to inhibit or prevent transformation of the precancer cells to a cancer cells.
- the efficacy of chemotherapy and/or radiotherapy can be monitored by testing of body samples for the altered expression or overexpression of the genes or gene products.
- a genomic nucleic acid sequence isolated from a biological sample taken from a mammal is contacted with the nucleic acid sequence or portion thereof encoding an epithelial protein which is an 0 early marker for cancer, under conditions that allow hybridization between the sequences and detecting the hybridized sequences.
- the presence of a genomic nucleic acid sequence or the presence of an altered genomic nucleic acid sequence as compared to a normal nucleic acid sequence is indicative of precancer or cancer 5 in the mammal.
- the increased presence of the DNA, mRNA and/or alternate splice forms of the mRNA in the biological sample is indicative of precancer and o cancer in the mammal.
- the oligonucleotides of the present invention are useful in detection of the gene and detection of alterations or mutations in the gene encoding the epithelial protein.
- the oligonucleotides may also be used to monitor the response 5 of epithelial cells to cancer treatment and intervention and as such are important intermediate endpoint markers.
- oligonucleotide primers are useful for the synthesis of all or a portion of the gene encoding the epithelial protein, , ft peptide or variants thereof using the polymerase chain reaction.
- a pair of single stranded DNA primers can be annealed to sequences within or surrounding a gene in order to amplify DNA synthesis of the gene.
- the polymerase chain reaction is known in the art as described by Saiki et al. , 1988 Science 239:487-491; U.S. Pat. No. 4,683,202 and U.S. Pat. No. 4,683,195 and Methods in Enzvmologv.
- primers which can be used to amplify the gene include but are not limited to:
- TGTTCTGTTACCTCTGGGCTCTCA (SEQ ID NO.: 15) and the like.
- 5 Specific pairs of primers may be used to clone the cDNA encoding the epithelial protein, peptide and variants of the present invention.
- Examples of primer pair that may be used to clone the cDNA using PCR include but are not limited to SEQ ID Nos: 11 and 12; SEQ ID Nos: 13 and 14; SEQ ID Nos: 11 and 15, and the like. 0
- the gene for hnRNP A2 as well as for the gene for Bl have been recovered from a PCR reaction with a library of genes created from the cell line NCI-H157, NCI-H720 as well and a short term culture of bronchial epithehal cells. These genes have been inserted into a vector (pCRII) and expressed in E. coli. 5 The presence of the appropriate gene product has been confirmed by PCR with a set of conserved hnRNP primers (used a Sense primer 5'-3' , o
- GCTCGGCTGCGGGAAATC SEQ ID NO: 23
- anti sense primer TAAGCTTTCCCCATTGTTCGTAGT (SEQ ID NO: 20) with an expected 146 bp PCR product.
- the plasmids containing these genes are on deposit at ATCC under the conditions of the Treaty of Budapest. The differences in the gene sequences 5 from the cancer cell lines relative to the gene obtained from normal bronchial cells were determined. It was found that the gene from all sources were highly homologous.
- the protein product may be expressed of the hnRNP A2/B1 gene from the cancer cell line NCI-H157 and NCI-H720 in an expression system that has the metabolic machinery to process the post translational changes in the gene product.
- the final protein is compared with the product of the hnRNP A2/B1 gene product from the normal bronchial cell line.
- the protein is purified from those different cell sources, cyanogen bromide digestion performed and then the products analyzed using one or two dimensional gel electrophoresis or mass spectrometry. Any difference in the gene product from NCI-H157 or H720 compared to the normal source of the hnRNP could be due to a critical mutation.
- oligonucleotide pairs based on the nucleic acid sequence encoding the epithelial protein or portion thereof may be used as PCR primers to detect mRNA in a biological sample using the reverse transcriptase polymerase chain reaction (RT-PCR) process for amplifying selected RNA nucleic acid sequences as detailed herein as well as in Ausubel et al, 1987 In: "Current Protocols In Molecular Biology” Chapter 15, John Wiley & Sons, New York, New
- oligonucleotides can be synthesized by automated instruments sold by a variety of manufacturers.
- the present invention also encompasses in sjtu PCR and in situ RT- PCR for detection of DNA and RNA encoding the epithelial protein, peptides and variants thereof.
- the technique is preferred when the copy number of a target nucleic acid is very low, or when different forms of nucleic acids must be distinguished.
- the method is especially important in detecting and differentiating precancer and cancer cells from normal cells.
- the method is also useful in detecting subsets of epithehal cells destined to become cancer cells. Confirmation of in situ PCR product identity is accomplished by in situ hybridization with a nested 32 P-labeled probe or by examining the products using Southern blot analysis to corroborate predicted base pair size.
- the first set of probes were constructed by inserting the hnRNP A2-PCR product (generated from the lung cancer cell line NCI-H720) into a pCR II vector (Invitrogen). To generate the antisense probes, an EcoRV digestion was performed yielding a 1.1 kb product driven from a Sp6 promoter. For the sense probe, the same construct was used but was digested with Kpnl and generated a 1.1 kb product driven by a T7 product.
- Additional constructs were generated by digesting the full length hnRNP A2 constructs with Dra HI to generate a 0.8 kb sense probe driven by a T7 promoter.
- the antisense probe was generated digesting the full length hnRNP A2 antisense construct with Nde I, yielding a 0.7 kb driven by a T7 promoter.
- Another set of probes using the PCR sequence derived for the lung cancer cell line was generated using a Dra III digestion. This yielded two nucleotides products (1.2kb T7 and 3.8kb Sp6) which were gel purified, then in vitro transcribed in an in vivo transcription system (DIG RNA labeling kit, Boehringer Mannheim) to yield a 0.7kb sense probe driven by T7 promoter. The other gel product was also transcribed and yielded a 0.4kb anti sense probe driven by a Sp6 promoter.
- DIG RNA labeling kit Boehringer Mannheim
- the full length hnRNP A2 insert referenced in GenBank was used. This full length hnRNP A2 gene sequence was inserted into a pcDNA 3 vector (Invitrogen).
- the construct was digested with EcoRV to yield a 1.8kb product driven by a T7 promoter.
- the antisense probe the same construct was digested with BamHl, yielding a 1.6kb product driven by Sp6 promoter.
- All of the probes are useful for detecting hnRNP mRNA in cells, tissues and extracts in assays such as in situ hybridization and the like.
- the present invention encompasses a computerized method for o generating a discriminant function which is predictive of the development of cancer.
- the method utilizes image analysis to identify one or more parameters unique to an64 atypical or abnormal cell such as a cancer or precancer cell as compared to a 5 normal or typical cell.
- image analysis to identify one or more parameters unique to an64 atypical or abnormal cell such as a cancer or precancer cell as compared to a 5 normal or typical cell.
- the discriminant function is useful in predicting individuals who will ultimately develop cancer.
- the method is not restricted to any particular assay, as it is useful in any assay in which an
- image from a biological sample may be acquired for computer-assisted image analysis.
- the image is a densitometry image.
- the image is a fluorescence image.
- the present invention also provides a method of computer-assisted determination of cancer and precancer in a mammal, preferably a human.
- the method of computer-assisted determination of cancer and precancer utilizes image densitometry, preferably dual-wavelength 0 image densitometry to determine cells, extracts or tissue positive for hn-RNP mRNA.
- at least one labelled probe is used to hybridize with the hn-RNP mRNA present in the cell, extract or tissue.
- Cells, extracts or tissue are illuminated with a wavelength of light appropriate for the label used.
- a second label may optionally be employed in the method.
- the second label does not hybridize with hn-RNP mRNA.
- the second label may be employed to distinguish structures within the cell, extract or tissue.
- One such label is a chromogen, including but not limited to hematoxylin blue and the like. In the case where two labels are used, an appropriate wavelength for each label is used. 0
- the appropriate wavelength is provided by a light source such as Koehler illumination.
- the light source is used to illuminate the biological sample so that an optical image acquiring means may collect a video image of the biological sample.
- the video image gathering means connects the 5 video image of the biological sample into an analog electronic signal representative of the image.
- the video image means such as a video camera, may be any suitable technology which receives hght as an input and provides a standard analog television video frame formatted output signal.
- the video image means is a high resolution video camera from Hamamatsu Photonic Systems (Japan).
- the standard analog television video frame format signal from the video image gathering means is provided to the input of a programmable analog-to-digital converter as are known in the art.
- the converter converts the analog video signal from the video image gathering means into digital values.
- converter is a digital image processor, the Metamorph v2.0 from Universal Imaging, West Chester, PA).
- a cell, extracts or tissue positive for hn-RNP mRNA may be determined visually by direct inspection of the image by an operator or by computer detection.
- a discriminant function is used to calculate a positive cell, extract or tissue.
- the computerized determination allows the assay to determine precancer in a subject before the subject has any clinical manifestation of cancer.
- a discriminant function value of about zero, or a velue less than zero of a test biological sample taken from an individual with no clinical manifestations of cancer is predictive that the individual will develop cancer.
- the method of computer-assisted detection of hnRNP mRNA of the present invention allows for high accuracy in predicting the probability that a subject who will go to develop cancer.
- the method provides an accuracy of at least about 80% or greater in predicting those subjects who will develop cancer. In one embodiment, the level of accuracy is about 100%. This method allows for early detection of individuals at risk for developing cancer and provides an opportunity for continued monitoring and early treatment of the individual to prevent or inhibit the cancer.
- antisense therapy refers to administration or in situ generation of DNA or RNA oligomers or their derivatives which bind specifically to a target nucleic acid sequence.
- the binding may be by conventional base pair complementarily, or, for example, in the case of binding DNA duplexes, through specific interactions in the major groove of the double helix.
- the antisense oligonucleotides of the present invention may vary in the number of nucleotide residues and may range from about 3 to about 100 nucleotide residues, preferably ranging from about 3 to about 50 nucleotide residues, more preferably from about 3 to about 25 nucleotide residues. In one embodiment the oligonucleotide has less than about 20 nucleotide residues. In another embodiment, the oligonucleotide has about 15 to about 20 nucleotide residues.
- Antisense oligonucleotides of the present invention are constructed to prevent the expression of the epithehal protein, peptide or variant thereof that is a marker for early detection of cancer.
- Antisense oligonucleotides of the invention are nucleotides that bind and prevent or inhibit the transcription and/or translation of the nucleic acid encoding the epithelial protein.
- hnRNP A2/B1 Arginine-rich motif, RGGbx, ⁇ 2, TI, and j84 regions of hn-RNP.
- hnRNP A2/B1 have been implicated in a variety of cellular functions that could be important in the process of carcinogenesis. These functions include the regulation of alternative splice site switch activity, RNA (DNA)-protein interactions, and RNA (DNA) annealing.
- hnRNP A/B proteins are major nuclear proteins binding with high affinity to teleomeric DNA repeats (TTAGGG) ⁇ and to the RNA equivalent (UUAGG) n .
- Anti sense strategies to modulate the gene coding region for the part of the hnRNP A B protein involved in splice site regulation or interactions with telomeric binding would be steps to inhibit the role of hnRNP .A/B proteins in progressive carcinogenesis.
- the antisense oligonucleotides comprise a nucleic acid sequence which is anticomplementary to the nucleic acid sequence encoding the amino acid sequences: ATVEEVDAAMNARPHKVDGRVVEPKRAVS (SEQ ID NO.: 16) or portions thereof; DDHDSVDKIVIQKYHTVNGHNCEVRKALS (SEQ ID NO.: 17) or portion thereof, and the like.
- antisense oligonucleotides of the present invention include but are not limited to nucleic acid sequences anti complementary to the sequence or portion thereof of hn-RNPAl , A2, Bl of Figures 1-3.
- the oligonucleotides of the present invention may contain at least one or more modified linking group, sugar residue and/or base.
- the modified oligonucleotides of the invention are resistant to degradation under both physiological and tissue culture conditions, and in particular are resistant to degradation by exonucleases.
- Such modifications include but are not limited to methyl phosphorothioate intemucleotide linkages, phosphorothioate linkages, phosphoramidate intemucleotide linkages, a 3' end cap and a 3' hair-pin loop structure.
- modified oligonucleotides and methods for production thereof are described in U.S. Patent 5,264,562, 5,194,599 and 5,256,775, Padmapriya and Agrawal, Bio Ore. & Med. Chem. Lett.. 3, 761 (1993), Temsamani et al., Ann.
- modified oligonucleotides include but are not limited to ohgonucleotide methylphosphorothionates, 3' end-capped oligodeoxy nucleotide phosphorothioates and ohgonucleotide phosphorothioates having a hair-pin loop structure at their 3' ends.
- the ohgonucleotides of the present invention may also be modified by the addition of groups to facilitate their entry into cells. Such groups include but are not limited to, non-polypeptide polymers, polypeptides, lipophilic groups and the like.
- Lipophilic groups refer to moieties which are chemically compatible with the outer cell surface, i.e., so as to enable the oligonucleotide to attach to, merge with and cross the cell membrane.
- lipophihc groups are fatty acids and fatty alcohols, in addition to long chain hydrocarbyl groups.
- modified ohgonucleotides and methods for making are disclosed in U.S. Pat. No. 5,256,775.
- Cancers which may be treated using the oligonucleotides or mixtures thereof include but are not limited to melanoma, metastases, adenocarcinoma, thymoma, lymphoma, lung cancer, liver cancer, colon cancer, kidney cancer, pancreatic cancer, brain cancer and the like.
- adenocarcinoma thymoma
- lymphoma lung cancer, liver cancer, colon cancer, kidney cancer, pancreatic cancer, brain cancer and the like.
- cancers that are associated with overexpression of the hn-RNP gene product or expression of the altered gene product include cancers that are associated with overexpression of the hn-RNP gene product or expression of the altered gene product.
- the administration of the ohgonucleotides of the invention may be provided prophylactically or therapeutically.
- the ohgonucleotide or mixtures thereof may be provided in a unit dose form, each dose containing a predetermined quantity of ohgonucleotides calculated to produce the desired effect in association with a pharmaceutically acceptable diluent or carrier such as phosphate-buffered saline to form a pharmaceutically composition.
- a pharmaceutically acceptable diluent or carrier such as phosphate-buffered saline
- the ohgonucleotide may be formulated in solid form and redissolved or suspended prior to use.
- the pharmaceutical composition may optionally contain other chemotherapeutic agents, antibodies, antivirals, exogenous immunomodulators or the like.
- the route of administration may be intravenous, intramuscular, subcutaneous, intradermal, intraperitoneal, intrathecal, ex vivo, and the like. Administration may also be by transmucosal or transdermal means, or the compound may be administered orally.
- transmucosal or transdermal administration penetrants appropriate to the barrier to be permeated as used in the formulation. Such penetrants are generally known in the art, and include, for example, for transmucosal administration bile salts and fusidic acid derivatives. In addition, detergents may be used to facilitate permeation.
- Transmucosal administration may be through nasal sprays, for example, or using suppositories.
- the ohgonucleotides are formulated into conventional oral administration forms, such as capsules, tablets and tonics.
- the ohgonucleotides of the invention are formulated into ointments, salves, gels, or creams, as is generally known in the art.
- the dosage of administered ohgonucleotide will vary depending upon such factors as the mammal's age, weight, height, sex, general medical condition, previous medical history, disease progression, tumor burden, and the like.
- the dose is administered as indicated.
- Other therapeutic drugs may be administered in conjunction with the oligonucleotide.
- the efficacy of treatment using the ohgonucleotide may be assessed by determination of alterations in the concentration or activity of the DNA, RNA or gene product of epithehal protein, peptide or variant thereof, tumor regression, or a reduction of the pathology or symptoms associated with the cancer.
- the ohgonucleotides of the invention may be used as diagnostic reagents to detect the presence or absence of the DNA, RNA or portion thereof of the epithehal protein, peptide or variant thereof to which the ohgonucleotide is complementary. Of particular interest is the detection of at least one hn-RNP or portion thereof.
- diagnostic tests are conducted by binding of the ohgonucleotide to its specific target molecule which is then detected by conventional means.
- the oligonucleotide may be labeled using radioactive, fluorescent, chemiluminescent, or chromogenic labels and the like and the presence of the label detected. The presence of the target molecule may be detected in vitro or in vivo.
- Another aspect of the invention is a method of overexpressing the o gene encoding the epithehal protein, peptide or variant thereof by the introduction of the gene or multiple copies of the gene into a low expressing cell line such as short term culture of normal bronchial, mammary, colon cells, NIH 3T3 cells, and the like.
- a low expressing cell line such as short term culture of normal bronchial, mammary, colon cells, NIH 3T3 cells, and the like.
- normal low expressing cell lines obtained from lung, breast, kidney, skin, bone, prostate, ovary and the like for incorporation of the gene.
- the introduction of the gene is accomplished by placing the gene in an expression vector such as PCRII and transfecting the vector into the low expressing cell line.
- features associated with a transformed phenotype such as clonogenially, loss of contact inhibition and tumorigenicity in nude mice is evaluated.
- Overexpressor cell lines showing a precancer or cancer phenotype are useful in screening for therapeutic agents that down regulate expression of the epithehal protein.
- the invention also provides a transgenic animal which has incorporated into its genome one or more copies of the gene encoding an epithelial protein, peptide or variant thereof which is an early marker for cancer.
- the general method of producing transgenic animal is described in Krimpenfort et al U.S. Pat. No. 5,175,384, Leder et al. U.S. Pat. No. 5,175,383, Wagner et al. U.S. Pat. No. 5,175,385, Evans et al. U.S. Pat. No. 4,870,009 and Bems U.S.
- 703D4 is an IgG2b k monoclonal antibody ⁇ 6 .
- the antibody was
- Human tumor cell lines including the NSCLC cell lines NCI-H720 0 (carcinoid) and NCI-H157 (squamous ATCC CRL-5802) used for antigen purification, were grown in RPMI-1640 medium (Gibco) supplemented with 5 % fetal calf serum at 37 °C and 5 % CO 2 . The cells were harvested and washed twice with iced Dulbecco's Phosphate-buffer solution (pH7.4) and resuspended in MES 5 buffer (17 mM morpholinoethanesulfonic acid), 20 mM EDTA, 250 mM sucrose] and homogenized in a hand-held homogenizer.
- MES 5 buffer 17. mM morpholinoethanesulfonic acid
- 20 mM EDTA 250 mM sucrose
- Trypan blue exclusion was employed to ensure greater than 90% cell lysis following homogenization.
- the ly sates were transferred to Beckman polyallomer centrifuge tubes, and centrifuged at 150,000 x g for 60 min using a Beckman XL90 ultracentrifiige and SW41 rotor. The pellet containing the membrane and nuclear fractions were retained, and the cytosolic supernatant was discarded [Krajewski, 1993, Cancer Res. 53:4701-4714].
- the pellet fractions were resuspended in extraction buffer (0.015 M NaCl, 10 mM Tris pH7.4, 5 mM EDTA) containing 1 % Tween-20.
- the samples were incubated on ice for one hour with frequent vortexing, and centrifuged at 16,000 x g for 20 minutes.
- the supematants were then diluted 3 times with DI water and adjusted to pH 6.5
- a Dupont Bio Series W.AX (weak anion exchange) column (MacMod, Chads Ford, PA), equilibrated with Tris-HCl pH 6.5, was used. Detergent-solubilized proteins were pumped through the column at 2.0mL/min, and fractions were pooled and freeze dried. 703D4 immunoreactive material bound weakly to the resin in the presence of 50mM NaCl, and was eluted in the unbound material from this column.
- HPLC All organic solvents used were HPLC grade (Burdick & Jackson,
- the protein was eluted using a twenty minute linear gradient proceeding from 5 % acetonitrile/0.1 % TFA to 100% acetonitrile/0.1 % TFA at a flow rate of 15 ml/minute (the limit of the pumping system). Fractions of 2.5 mLs (15 sees) were collected after a 2.0 min wash. Next, the positive fractions ( 2.5-5.0 mLs, ca. 40% acetonitrile) were diluted five fold with water/0.1 % heptafluorobutyric acid (HFBA) (Pierce Chemical Co.
- HFBA heptafluorobutyric acid
- the resulting peptides were separated by 16% Tricine SDS-PAGE and electroblotting onto PVDF membrane.
- the peptides were visualized using Ponceau S and representative bands excised for Edman degradation sequence analysis on an Applied Biosystem model All A. Amino acid o sequence obtained was compared to know sequences in the SwissProt data base using PepScan (PE/SCIEX, ThornhiU, Ont. , Canada).
- RNA was extracted by guanidium isothiocyanate/2-mercaptoethanol and purified by ultracentrifugation as previously described [Davis et al, 1986, Preparation and analysis of RNA from eukaryotic cells. Basic methods in molecular biology, New York, Elsevier, Science Publishing Co., Inc. 129-156].
- j After ultracentrifugation the RNA pellet was resuspended in water, ethanol precipitated in the presence 0.3 M sodium acetate and pelleted by centrifugation. The dried pellets were redissolved in water, and 10 ⁇ g of total cellular RNA from each of tumor cell lines, normal lung and normal bronchial epithehum primary cultures were used for northern blot analysis. The RNA was resolved using a 1 %
- RNA 15 agarose-formaldehyde gel with 0.2 M 3-N-morpholino-propane sulfuric acid/0.05 M sodium acetate/0.01 M EDTA as the running buffer.
- the RNA was then transferred to a nitrocellulose membrane, hybridized, washed and autoradiography was performed according to standard techniques.
- 0 Northern analysis was carried out using probes prepared by random priming of inserts gel-purified from restriction endonuclease digests of plasmids containing full-length cDNAs for hnRNP- A2 and -Al . Approximately 1x10° cp /mL of probe was used for each Northern analysis. 5
- Reverse transcription was performed with 0.2 ⁇ g of DNase-treated total RNA using Superscript according to the manufacturer's protocol (Gibco).
- the resulting cDNA was subjected to 35 cycles of polymerase chain reaction 0
- PCR on a Perkin Elmer GeneAmp PCR System 9600.
- the primers designed for the amplification were: 5'-GAGTCCGGTTCGTGTTCGTC-3' (SEQ ID NO.: 11) and 5'-TGGCAGCATCAACCTCAGC-3' (SEQ ID NO.: 18). These primers were selected using DNA-Star, and were chosen to span a site of alternate exon 5 utilization (36 nt) which generates the hnRNP splice forms -A2 and -Bl . (See
- Figure 7a The resulting amplified DNA was analyzed by electrophoresis on a 2.0% NuSieve agarose gel. Transfer to nitrocellulose filter and hybridization, wash and autoradiography were performed as previously described [Davis et al, 1986 ibidl . Southern blot analysis was carried out with a 32 P-end-labelled 20 nt antisense ohgonucleotide present in both hnRNP- A2 and -Bl . This 22nt antisense ohgonucleotide has the following sequence: GAGAGAGAAAAGGAACAGTTCC (SEQ. ID NO. 19). Tables 1-3 provide the characteristics a 1164b ⁇ , a 1145 bp and a 1178 bp cDNA product of the present invention and the primers used to produce the cDNA products.
- Preliminary data showed a wide range of expression of the 703D4 antigen in non-small cell lung cancer cell hnes, as judged by a sohd phase radiobinding assay. All results shown are for purification steps using NCI-H720 cells which grows rapidly as floating clumps of cells in culture medium containing 5 % fetal bovine serum, allowing high cell density. After the methods were developed, an identical protocol was followed to purify the antigen from the original immunogen cell line, NCI-H157. 703D4 immunoreactivity at all stages of the purification was detected by SDS-PAGE followed by immunoblot analysis as preliminary attempts to scale up our previously reported immunoprecipitation technique were not successful.
- the antigen in a NCI-H720 subcellular fraction containing nuclei and membrane-bound proteins could be solubilized by gentle extraction with either non-ionic detergents such as Tween-20, NP-40 and Triton X-100 or ionic detergent such as 1 % SDS.
- non-ionic detergents such as Tween-20, NP-40 and Triton X-100
- ionic detergent such as 1 % SDS.
- -HI 57 cells by a six-step procedure.
- the first steps were carried out rapidly to prevent degradation of the target molecule by a variety of protease inhibitors or reducing agents. We were not able to completely prevent loss of the molecule.
- To prevent degradation during the SDS-PAGE and western blot analysis of each 0 fractionation step the bulk of the material was stored frozen at -30°C during the analysis. Determination of exact recoveries at each step could not be made using a western-blot analysis method, therefore the overall yield was estimated from the total protein used for purification and the final yield of purified antigen. 5 A typical purification commenced with 7-10 mLs packed cells, washed with phosphate buffered saline to remove serum proteins present in the cell culture medium.
- the initial step was subcellular fractionation to remove cytosohc proteins, and gentle detergent solubilization of the membrane-bound fraction.
- the detergent- solubilized fraction was then diluted to lower the salt concentration and injected onto the weak anion-exchange column.
- Studies with weak and strong anion and cation exchange resins demonstrated tight binding to cation and strong anion exchange matrices at acidic to neutral pH, but poor recovery of immunoreactive material. Therefore a weak anion exchange resin was used to remove a significant portion (approximately 75%) of irrelevant protein. This prevented loss of immunoreactive protein through co-precipitation at the IEF step.
- the unbound material was collected, freeze-dried, and redissolved in a denaturing buffer for preparative IEF. DBF concentrated the immunoreactive protein into a basic region of the pH gradient. Several batches of cells were pooled at this point for HPLC purification.
- Figure 7a shows these sequences aligned 5 with the translated cDNA sequence of hnRNP Bl , which is identical to hnRNP A2 but includes a previously reported 36 nucleotide (12 amino acid) exon close to the protein amino terminus.
- the 4kDa CNBr fragment sequence crossed this site of alternate exon splicing, demonstrating the major antigen is substantially homologous to hnRNP Al.
- each sequence is immediately C-terminal to a methionine residue in the predicted sequence.
- the last step in the purification of the 703D4 antigen resolved a second immunoreactive band of slightly higher molecular size, and parallel immunoreactivity (judged by a comparison of Coomasie and immunostaining intensities).
- a CNBr digestion was carried out on pooled C 4 HPLC fractions containing the minor immunoreactive band which eluted slightly before the hn RNP-.A2 (pooled from three separate purifications).
- the CNBr digest yielded two principal Coomasie-stained bands after Tricine SDS-PAGE.
- the approximate 5 kDa band was Edman sequenced on an Apphed Biosystems 494A and yielded a sequence EKTKEtVPlerKkrE (SEQ ID NO.:4) (amino acids in upper case represent the primary amino acid in each cycle, and lower case letters denote amino acids identified as the secondary cehs).
- This sequence is identical to that of the hnRNP-Bl CNBr fragment which includes the 12 amino acid insertion not present in the hnRNP- A2.
- a lower level sequence present in the same sample was consistent with hn RNP-A2, which had not been completely resolved from hnRNP- Bl by the C 4 HPLC ( Figure 6a).
- the 13 kDa band from the same digest yielded sequences AaRp-s-DGRw (SEQ ID NO.:5) consistent with that expected for the 13 kDa CNBr fragment of hn RNP-A2/B1.
- Figure 9a demonstrates a wide range of expression of hnRNP A2/B1 in both normal and tumor cell lines, and is generally consistent with our radiobinding assays (results not shown).
- hnRNP- A2/B1 mRNA is also expressed in the single transformed normal bronchial epithehal cell line tested, and in several normal bronchial epithehal cell primary cultures. Digitized signal intensity of the Northern blot was adjusted for loading differences by quantitation of the 28S rRNA band o photographed under UV hght and scanned by laser densitometry (Molecular Dynamics Personal Densitometer). Expression of hnRNP- A2/B1 in most tumor cell lines is higher than in the normal lung cell primary cultures analyzed.
- hnRNP-.A2/Bl preliminary evidence for hnRNP-.A2/Bl showed overexpression in breast tumor cells and transformed breast epithehal cells compared to normal breast epithelial cell primary cultures (data not shown). These findings showed overexpression in several immortalized or transformed cell lines such as epidermal carcinoma cells, 0 promyelocytic cells, SV40 transformed human fibroblasts and teratocarcinoma cell. Rat neuronal cell also expression a high level of hnRNP-Al mRNA both shortly before and after birth, whereas normal primary fibroblast cultures overexpress hnRNP-Al only during the logarithmic phase of cell growth (Biamonti, G. et al, 5 Mol. Biol.. 230, 77-89, 1993).
- hnRNP-.A2/Bl The family of hnRNPs have roles in RNA processing, including pre-mRNA exon splicing and splice site choice, and also in transcription, DNA replication, and recombination (Dreyfuss, et al, Annu. Res. Biochem.. 62, 289-321, 1993) (Spector, D.L. Curr. Opin. Cell. Biol.. 5, 442-447, 1993).
- hnRNPs are involved in shuttling mRNA from the nucleus to the cytosol, which is consistent with the subcellular fractionation described here and our previously reported immunohistochemical localization (Katz, D. et al Nucleic Acid Res. 22, 238-246, 1994; Pinol-Roma et al Nature 355, 730-732, 1992). These roles for the hnRNPs indicate these proteins are integral to cellular proliferation, although the exact mechanism by which hnRNP-A2/Bl is involved in carcinogenesis is not yet clear. Proliferation markers increase in cehs responding normally to injury or during fetal growth, and so are not selective for pre-neoplastic carcinogenized cehs (Risio, M.J. J.
- epithehal protein expression and tumor growth rate inhibition may be demonstrated in the following manner.
- H-157 or H720 tumor cell line known to express high levels of the epithehal protein is injected subcutaneously into the flanks of Balb/C (strain) mice.
- the antisense ohgonucleotide (SEQ ID NO.: 20) (5 AAGCTITCCCCATTGTTCGTAGT3') is administered at a concentration of 2.5 mg per Kg body weight by intravenous injection into one group of mice.
- Control mice are injected with a control ohgonucleotide. After 30 days the lungs are removed and the expression of the epithehal protein monitored by immunoassay, or by Northern or Southern blot analysis.
- hnRNP expression and tumor growth rate are expected to be lower in those mice receiving injections of antisense ohgonucleotides than those receiving injection of the control ohgonucleotide.
- Inhibition of epithelial protein expression in human cells may be shown as follows. NCI-H720 human lung carcinoid cancer cehs are grown in R5 medium. Antisense ohgonucleotide having the nucleic acid sequence 5'TAAGCTTTCCCCATTGTTCGTAGT3' is resuspended in phosphate buffered saline and mixed with DOTAP (Boehringer Mannheim), a hpofection reagent (2.5 ⁇ g/ml of culture medium) at the desired concentration. Fresh antisense ohgonucleotide, in the absence of DOTAP, is added after 16-20 hrs of incubation.
- DOTAP Boehringer Mannheim
- 703D4 (5) was purified from mouse ascites using a Protein A column and discontinuous glycine NaCl/citrate gradient (Pierce, Rockford, IL). 10 g/ml of Protein A purified mouse monoclonal antibody was used to identify areas of p31 expression. Immunohistochemical staining was performed using the
- Vectastian ABC kit Vector Laboratories, Burlingame, CA
- All experiments incorporated a tumor shde known to express p31 as a positive control and an isotopic (IgG 2b) myeloma protein (Sigma Chemical Co., St. Louis, MO) as a negative control.
- IgG 2b isotopic myeloma protein
- bronchi, bronchioli, and alveoli Three distinct lung compartments (bronchi, bronchioli, and alveoli) were mapped for each case using hght microscopy in corresponding hematoxylin and eosin stained sections. These compartments were differentiated by their epithelium and surrounding tissue as previously described (12). Ah shdes were screened for the presence of the following histologic abnormalities: basal cell hyperplasia (BCH); goblet cell hyperplasia (GCH); squamous metaplasia (SQM), dysplasia (DYS); type ⁇ cell hyperplasia (T2H); fibrosis (FIB) and bronchiolization of the alveoli (BOA) (Table I). These morphologic designations were determined by concurrence of three reviewers (J.Z., S.M.I. , R.I.L.) using pubhshed criteria (9,13,14).
- BCH basal cell hyperplasia
- GCH goblet cell
- HPFs high power fields
- bronchi and bronchioli it was not always possible to evaluate 10 HPFs of abnormalities, therefore as many HPFs as possible were included. For instance, in one bronchus 3 HPFs of BCH in a total of HPFs (Table ⁇ ) were counted. For comparison between regions, the staining index (SI, see below) for areas of related histology (ARH) was averaged, that is, for each histological abnormality and for normal epithehum in each lung compartment
- T2H was the most common histologic abnormality observed (15/24), while BOA was detected in only 3 of the 24 cases (2 of which also contained T2H) and one alveolar compartment contained FIB.
- a summary of histologic abnormahties detected in the various lung compartments are shown in Table 5.
- BCH basal cell hyperplasia
- GCH goblet cell hype ⁇ lasia
- SQM squamous metaplasia
- DYS dysplasia
- I T2H-type ⁇ hype ⁇ lasia BOA-bronchiolization of the alveoli
- p3I expression in NSCLC p31 expression in a range of NSCLC subtypes are tabulated in Table 6.
- 16 demonstrated p31 immunoreactivity.
- p31 expression in all histologic subtypes except the single carcinoid examined was observed.
- Both focal (detected in sohtary cell or small groups of tumor cehs) and diffuse ( ⁇ 50% of tumor cells positive) staining was observed.
- the predominant staining pattern was diffuse and cytoplasmic as illustrated in Figures 11a and lib.
- membranous staining was observed in 1 of the 9 adenocarcinomas ( Figure lie) and the 1 pulmonary blastoma. No correlation was apparent between staining pattern, mean staining index and tumor histology.
- a tumor with staining index > 2 was called positive.
- Adenocarcinoma subtypes included: Papihary and bronchioalveolar (11), Moderately differentiated (3) and Poorly differentiated (2).
- One of the adenocarcinomas had a small cell lung cancer compartment next to a papillary component which was negative.
- Results of p31 staining in normal and atypical lung compartments are summarized in Table 7. While p31 staining was not detected in histologically abnormal bronchi and bronchioh, patterns of diffuse and/or focal cytoplasmic p31 5 staining was expressed in one third of mo ⁇ hologically normal bronchi and bronchioh. More specifically, p31 expression was detected in both ciliated and non-cihated epithehal cells as well as underlying basal ceh epithehum ( Figures 12a, 12b). While only 2 of 27 cases demonstrated well preserved bronchial glands, - 0 both demonstrated strong granular staining for p31 ( Figure 12c).
- Mean staining index was calculated to yield one value per patient per subcompartment.
- T2H was most commonly expressed in areas of T2H, which may reflect changes in the biology of this common cell type suggesting that T2H is a candidate preneoplastic change. This may be particularly relevant because the histopathology of lung cancer has been changing recently, with adenocarcinoma increasing in the United States. Pulmonary adenocarcinomas commonly demonstrating papillolepidic features are thought to arise from progenitor cehs in the peripheral airways, namely the Clara cehs and type ⁇ pneumocytes. Yet, preneoplastic histologic abnormahties found in the peripheral airways (bronchioh and/or alveoh) are not well defined. The fact that normal appearing type ⁇ cells can express the p31 early lung cancer detection marker may be indicative of the initial transformation to a precancer state. In contrast, well-defined histologic abnormahties such as BCH,
- p31 can be detected in all major types of lung cancer the expression of p31 may be an early event in lung carcinogenesis. As reported in Table V there were 3 specimens which did not express p31 but p31 was still expressed in the surrounding non neoplastic epithehum. p31 expression occurs throughout the human lung in both non-neoplastic and neoplastic tissue from patients who had Stage I NSCLC resections with curative intent. The distinct expression pattern makes p31 an informative marker for potentially neoplastic events such as peripheral adenocarcinomas originating in the alveolar region of human lung. Increased p31 expression was found to be associated with T2H, increased age and prolonged smoking history.
- hnRNP expression was evaluated in Yunnan Tin Co ⁇ (YTC) miners, a community-dwelling Chinese population of tobacco smokers, industrially exposed to radon and arsenic, whose average annual incidence of primary lung cancer (1 °LC) is 1 percent. 26
- YTC Yunnan Tin Co ⁇
- SPLC was defined as lung cancer that, if it appeared less than 2 years after primary resection, had to be a different histological ceh type, and if it appeared more than 2 years after resection, could be of the same ceh type, provided that it had the characteristics of a primary cancer and arose in a different lobe. 25
- each LCEDWG institution received local Human Volunteers Committee approval, established its sputum induction facility, and received specimen collection training and approval during a site visit by a cytotechnologies from the Johns Hopkins University School of Hygiene. Techniques for specimen production and handling were as fohows: To help ensure an adequate specimen, each patient annually performed a 15-minute hypertonic saline induction. Fresh sputum was smeared on glass shdes for Papanicolaou staining, and the remaining sputum was homogenized, concentrated and placed a Saccomanno's preservative (2 percent polyethylene glycol 1450 in 50 percent ethanol).
- the primary statistical endpoint for this study was the occurrence of cancer: a second primary lung cancer (recurrences were not counted) in the SPLC population, and a primary lung cancer in the YTC population. Student's T and chi squared tests were used to assess the significance of differences between those with and without cancer, and multiple logistic regression was used to determine the simultaneous association of multiple factors. These significance levels may, of course, change by the end of these studies, but since this simply a report of consistent findings among parallel study designs, no alteration is required in the sample sizes or type I error calculations. JHLP samples were used to develop a dual-wavelength densitometry algorithm and a linear discriminant function.
- D ⁇ 0 + 0, (Optical Density ⁇ ) - ⁇ 2 (Optical Density J10 ) , ⁇
- the cutpoint value of D (indicating neoplasia and the weights ⁇ 0 , ⁇ and ⁇ 2 were determined in advance from reference sputum specimens of JHLP participants who developed squamous ceh, adenocarcinoma, or small ceh lung cancer, or no lung cancer at all. 4 The sensitivity and specificity of the prospective discriminant score classification among test specimens and their exact 95 percent binomial confidence hmits were then calculated.
- adenocarcinoma 43.8 percent
- adenocarcinoma constituted 55.3 percent of the resected primary tumors.
- the present invention relates to the area of cancer diagnostics and therapeutics. More specifically, the invention relates to the isolation and purification of an early cancer detection marker protein of epithehal cehs and the cloning of the DNA sequence encoding the protein. The invention further relates 0 to the protein and DNA sequence for detecting and diagnosing individuals predisposed to cancer. The present inventin relates to a computerized method for generating a discriminant function predictive of cancer. The present invention also relates to therapeutic intervention to regulate the expression of the gene product. -r Background of the Invention
- Lung cancer is the most frequent cause of cancer death of both males and females in the United States, accounting for one in three cancer deaths' 0 . In the last thirty years, cancer-related survival of this disease has improved only minimally. Successful treatment of this disease by surgical resection and drug 0 chemotherapy is strongly dependent on identification of early-stage tumors. A conceptually attractive early detection approach is to establish the presence of a cancer by evaluation of shed bronchial epithehal cehs. In the late 1960's Saccomanno et al. proposed the use of sputum cytology to evaluate 5 cytomorphologic changes in the exfoliated bronchial epithehum as a technique to enhance the early detection of lung cancer (2) . However, clinical trials using ⁇ & - o combination chest X-ray and sputum cytology have not shown any decrease in cancer-related mortahty (3) .
- Tockman et al. reported a sensitive method for early lung cancer detection by immunostaining cells contained within sputum samples with 5 two lung cancer-associated monoclonal antibodies' 4 '.
- the basis for this approach was to identify early pre-neoplastic changes in cells shed from bronchial epithehum.
- the antibodies used in that study were mouse monoclonal IgG's designated 703D4, disclosed in U.S. Patent No. 4,569,788, and 624H12.
- 703 D4 alone identified 20 of the 21 detected true positive cases (4; U.S. Serial No. 08/152,881 which issues to Letters Patent No. 5,455,159 on October 3, 1995).
- 624H12 has been shown to detect an oncofetal antigen which is the Lewis x -related portion of a cell-surface glycoprotein (Mulshine/Magnani).
- 703D4 was developed by immunization using a whole tumor ceh extract, coupled to keyhole limpet hemocyanin, and selection was based on discrimination amongst subtypes of lung cancer histological subtypes. Preliminary 0 studies showed the 703D4 antibody recognized a protein expressed by most non- small cell lung cancer cells (5) . Immunoprecipitation defined a protein of Mr > 31 kDa. Since 703D4 demonstrated the ability to selectively detect changes related to the development of cancer in shed bronchial epithehum from the proximal airways, ⁇ the antigen recognized by 703D4 was purified in the present invention to determine its identity and explore its relationship to early lung cancer detection. The present invention uses a biochemical approach for identification of the epithehal protein from non-small ceh lung tumor cehs.
- This cytomorphologic classification is useful in defining preneoplastic changes in the proximal region of the lung cancer "field" .
- comparable events preceding the other major lung cancer histologies, especiahy those arising in the peripheral lung (terminal and respiratory bronchioles, alveolar epithehum) are not well defined.
- the present invention describes the isolation and identification of an epithehal protein which is an early marker for cancer. It is an object of the present invention to provide an isolated and purified epithehal protein, peptide, or variants thereof which are an early marker for lung cancer.
- the method comprises isolating cells, tissues or extracts thereof from a human and detecting the gene or portion thereof encoding an epithelial protein which is an early marker for cancer or their expression products from the cehs, tissue or extracts thereof, wherein detection of a quantitative increase in the gene or expression products indicates preneoplasia and neoplasia. -7/ ._
- Another object of the invention is a method for detecting mutations of a gene encoding the epithehal protein which is an early marker for cancer, contained within clones expressing the gene recovered from cancer cehs.
- Another method for diagnosing human preneoplastic and neoplastic cehs and tissues is by detecting post-translational modifications of the epithehal protein in the preneoplastic and neoplastic cells and tissue by immunoassays such as Western blot or immunoelectrophoresis using an antibody that is reactive with the epithelial protein, by two-dimensional electrophoresis or by reverse-phase HPLC.
- immunoassays such as Western blot or immunoelectrophoresis using an antibody that is reactive with the epithelial protein, by two-dimensional electrophoresis or by reverse-phase HPLC.
- Still another object of the invention is to provide the epithehal protein, peptides or variants thereof which one substantially homologous to a portion of at least one heterogenous nuclear ribonucleotide protein for use in diagnostic and detection assays, in particular for immunoassays.
- One object of the invention is an inhibitory protein analog of the epithehal protein which is capable of binding to the same binding site recognized by the epithehal protein on RNA. Such an analog is capable of competitively inhibiting the function of the epithehal protein, peptide or variant thereof in vitro and in vivo.
- the method comprises isolating a mammalian biological sample and detecting a nucleic acid sequence encoding an epithelial protein or portion thereof which is an early marker for cancer.
- the present invention also provides a method of computer-assisted o determination of cancer and precancer in a mammal and an algorithm useful for same.
- Another aspect of the invention is a method of computerized detection of hnRNP mRNA in a biological sample. 5 It is yet another aspect of the invention to provide a method of computerized diagnosis of cancer and precancer in a mammal.
- Another aspect of the invention is a method of computer-assisted prediction of cancer in a mammal based on image analysis, j ⁇
- a further aspect of the invention is a method for generating a discriminant function useful in identifying atypical cells and in predicting cancer based on computerized image analysis.
- a further aspect of the invention is a method of computerized diagnosis of cancer and precancer in a mammal comprising dual-wavelength image
- Another aspect of the invention is a system for determining an atypical ceh from a normal or typical cell in which the system comprises an optical image generator, a device for acquiring an optical image, a processor for analyzing 20 the optical image for cellular parameters unique to an atypical cell and a program for determining a discriminant function.
- the discriminant function discriminants between atypical or abnormal cehs and typical or normal cells.
- the system is particularly useful in predicting the development of cancer in an individual.
- Yet another object of the invention is to provide a method of altering or downregulating the expression of the gene or portion thereof encoding an epithehal protein or portion thereof which is an early marker for cancer of epithehal cehs which comprises introduction of antisense ohgonucleotides which are substantially complementary to the gene in the epithehal ceh.
- the antisense 0 ohgonucleotide allows for non-neoplastic growth of the epithehal cell.
- Another object of the invention is to provide a method for screening for chemotherapeutic drugs and for monitoring the efficacy of a chemotherapeutic and intervention drugs. 5 It is a further object of the invention to provide a transgenic animal which has incorporated into its genome one or more copies of a nucleic acid sequence which encodes an epithehal protein which is an early marker for cancer. The incorporation of the nucleic acid sequence results in overexpression or expression of multiple forms or variants of the epithehal protein. The resulting transgenic animal is more prone to develop cancer and may develop cancer at an accelerated rate at one or more locations in the body. Such transgenic animals are useful for screening therapeutic drugs useful for treating or inhibiting cancer. It is yet another object of the invention to provide an antibody reactive to an epithehal protein, peptide or variant thereof. Such antibodies are useful in diagnosis and treatment of cancer.
- Figure 1 shows the DNA coding sequence of heterogenous ribonucleoprotein Al (hnRNP) and hnRNP Al.
- Figure 2 shows the full DNA sequence of human hnRNP A2 disclosed by Burd, C.G. et al Proc. Nat'l Acad. Sci. USA 86, 9788-9792 (1989).
- Figure 3 shows the full DNA sequence of human hnRNPBl disclosed by Burd, C.G. et al Proc. Nat'l Acad. Sci. USA 86:9788-9792 (1989).
- Figure 4 shows the amino acid sequence of peptides sequenced from
- Figures 5a through 5e show polymeric reversed phase HPLC purification of 703D4 antigen.
- 10 mm X 10 cm Poros perfusion polymeric C 18 column was equilibrated with 5 % acetonitrile/0.1 % TFA (5a) and 5 % methanol/0.1 % HFBA (5d).
- Protein was eluted with a gradient of 5-100% acetonitrile (5A) and 5-100% methanol (5d) at a flow rate of 10 ml/min.
- Fractions were run on two identical SDS-PAGE gels and one stained with Coomassie blue (5c, 5f), the other transferred to PVDF for reaction with 703D4 antibody (5b, 5e).
- Figures 6a through 6c show C 4 reversed phase HPLC purification of 703D4 antigen.
- 6a, c4 column eluted with a gradient of 33-48% acetonitrile in 0.1 % TFA.
- 6b and 6c shown Western blot and Coomassie blue analysis of eluted fractions, respectively (49, 32 and 18 kDa protein standards are on the right).
- Figure 7a shows the amino acid ahgnment of the peptides of the present invention with heterogeneous nuclear ribonucleoprotein B2 (hnRNP-A2 is denoted by ⁇ skipped area) • , * methionines; * peptides produced by CNBr at this Met too small for Tricine SDS-PAGE.
- Figure 7b shows the N-terminal amino acid sequences and approximate Mr of CNBr cleavage fragments of the purified 703D4 major (hnRNP- A2) and minor (hn-RNP-Bl) antigens.
- Arrows indicate the positions of methionines within the protein, and the carrot indicates the site of alternately spliced exon differentiating hnRNP- A2 from Bl .
- the exact methionine at which the 15 kDa and 27 kDa peptides terminates could not be determined from the SDS- PAGE analysis.
- Ah peptides which were not recovered are too small to be resolved from the migration front of the Tricine SDS-PAGE gel ( ⁇ 2.5 kDa).
- Figure 8 shows 16% tricine SDS-PAGE analysis of products of CNBr digestion of purified 703D4 principal antigen. Note the left lane is the antigen before digestion, the arrows indicated the four visible bands which subjected to amino-terminal sequencing.
- Figure 9a shows expression of hnRNP-A2/Bl mRNA in lung derived -? sx o ceh cultures.
- 9a Northern analysis of NSCLC cell lines (NCI-H720, H157, HTB58, H520, H676, H1437, H549, H820, H4670, HI 155) and SCLC ceh lines (NCI-H889, H417, H209, H345). All cells were harvested in station phase and analyzed as described in Materials and Methods. 28S rRNA band visualized under 5 TJV illumination used for quantification.
- Figure 9b shows RT-PCR of mRNA from ceh lines NCI-H720, H1355, H157, HI 155, normal lung and normal bronchial epithehum primary culture. Expected size of the products is 280 bp (hnRNP- A2) and 316 bp (hnRNP- lf) Bl). RT-PCR was carried out as described in Materials and Methods. Products were analyzed on 2 % agarose TBE-gels, transferred to nitrocellulose, and probed with an end-labelled 20nt primer common to both hnRNP- A2 and -Bl.
- Figure 10 shows proliferation-dependent control of hnRNP- A2/B1 expression.
- Quantification of the loaded RNA was obtained by ethidium bromide staining of 28s rRNA (EtBr).
- 0 Figure 11A through 11C shows P31 expression pattern in primary
- NSCLC 6A Focal cytoplasmic p31 staining in squamous cell carcinoma (Immunohistochemical staining, X360).
- WP Diffuse p31 expression with granular staining in an adjacent area at pulmonary adenocarcinoma. Note perinuclear 5 staining pattern, inset. (Immunoperoxidase, X360).
- 11C Pulmonary adenocarcinoma with membranous expression pattern (Immunoperoxidase, X270).
- Figure 12A through 12D shows P31 expression pattern in non- neoplastic lung (lacking histologic abnormahties).
- 12 A Diffuse granular localization of p31 towards the apical portion of ciliated and non-cihated bronchial 0 epithehum. Note faint staining of underlying basal cehs (arrows) (Immunohistochemical staining, X225).
- 12B Strong p31 expression in bronchial glands (Immunoperoxidase, X225).
- 12C p31 expression in bronchial (Immunohistochemical staining, X270).
- 12D Localization of p31 in normal type 5 ⁇ cehs. Note moderate staining intensify and the distribution of normal type II cehs along alveolar dehcate (normal) septa. (Immunoperoxidase, X360).
- Figure 13A through 13B show variable localization of p31 expression in type II ceh hype ⁇ lasia.
- 13 A Type II hype ⁇ lasia demonstrating strong diffuse cytoplasmic p31 immunoreactivity. Note increased number of type II cehs and presence of fibrosis as compared with normal alveolar epithehum in 5 Figure 12D (Immunohistochemical of p31 in type ⁇ cell hype ⁇ lasia.
- Figure 14 shows standardization and calibration procedure for dual ⁇ ly wavelength image densitometry.
- Figures 15A-15D show expression of hnRNP A2 mRN A/protein in a control mixture of Calu-3 cells plus normal sputum cehs.
- Figures 16A-16D show expression of hnRNP A2 mRN A/protein in clinical sputum cehs.
- Figure 17A-17D show expression of hnRNP in developing mouse lung.
- the present invention is an isolated and purified protein, peptide and derivatives thereof as well as variants thereof which is an early detection marker for cancer.
- the protein, peptides and variants thereof are characteristically present in low levels from normal cehs and are present in high levels from pre-cancer and 5 most cancer cells.
- variants include altered proteins that arise from
- DNA mutations alternate exon splicing and post translational modifications. Expression of such variant proteins correlates with transformation of normal cehs to a precancer or cancer ceh.
- an 31 protein having a molecular weight of 0 about 31KDa to about 35KDa and peptides and variants thereof isolated and purified from pre-neoplastic and neoplastic cells of the lung, colon, kidney, bone, breast, prostate, melanoma, myeloma and the like.
- the protein and peptides and variants thereof of the present invention are markers for epithehal cehs which are 5 committed to a pathway of transformation leading to development of lung cancer.
- a preferred protein and variant thereof is isolated from human lung cancer cehs, in particular, non-small cell cancer cehs.
- the isolated and purified protein and variants thereof of the present invention comprises at least one of the following amino acid sequences, preferably more than one of the sequences:
- AARPHSIDGRVV (SEQ ID. NO. : 1)
- REKEQFRKLH (SEQ ID. NO.: 3)
- EKT ETVPLERKKRE SEQ ID. NO.: 4
- AARPSDGRVV (SEQ ID. NO.: 5)
- EREKEQFRKLFI (SEQ ID. NO. : 6)
- the protein, peptide and variants thereof are characterized by a molecular weight of about 4kDa and comprises the amino acid sequence according to sequence I.D. No. : 3.
- the protein, peptide and variants thereof are characterized by a molecular weight of about 27 kDa and comprises the amino acid sequence according to sequence I.D. No.: 1.
- the protein, peptide and variants thereof are characterized by a molecular weight of about 13 kDa and comprises the amino acid sequence according to sequence I.D. No.: 1.
- the protein, peptide and variants thereof are characterized by a molecular weight of 15 kDa and comprises amino acid sequence I.D. No.: 2.
- the protein, peptides and variants thereof share partial amino acid sequence homology with at least one or more heterogenous nuclear ribonucleotide proteins (hn-RNP).
- the protein peptides and variants of the present invention may share partial amino acid sequence homology with one or more of the hn-RNP selected from the group consisting of hn-RNPAl , hn-RNP A2, hn-RNP-Bl , hn-RNPB2, hn-RNPCl, hn-RNPC2 and hn-RNPC3.
- the protein shares partial amino acid sequence homology with hn ⁇ RNP A2.
- the protein shares partial amino acid sequence homology with hn-RNP Bl.
- the protein shares partial amino acid sequence homology with hn-RNP A2 and hn- RNP Bl .
- partial amino acid sequence homology is meant a protein, peptide or variant thereof having at least 70% sequence homology with at least one hn-RNP, - 7 fr -
- sequence homology preferably at least about 90% sequence homology, more preferably at least about 95 % sequence homology with at least one or more hn-RNP.
- the protein, peptide or variant shares sequence homology with the following amino acid sequence or portion thereof: 1 MEk ⁇ etvpl ⁇ rkkREKEQFRKLFIGGLSFETTEESLRNYYEQWGK TDCVVMRDPASKR
- the protein peptide or variant thereof shares sequence homology with the fohowing amino acid sequence or portion thereof: 1 MEREKEQFRKLFIGGLSFETTEESLRNYYEQWG LTDCVVMRDPASKR 9 SRGFGFVTFSSMAEVDAAMAAWPHSIJDGRVVEPI RAVARBESGKPGAHVTVKK FVGGIK
- Variants include but are not limited to proteins and peptides that vary in amino acid sequence by one or more than one amino acid, preferably do not vary by more than 10 amino acids, preferably not more than 5 amino acids, more preferably not more than 1-3 amino acids.
- the amino acid change may be conservative substitutions, deletions and the like. Examples of these amino acid changes include but are not hmited to alteration of aromatic amino acid to alter DNA/RNA binding sites; methylation of arginine, lysine or histidine including N°, N°-dimethyl-argmine near the COOH terminus; phosphoserines or phosphothreonine, blocked N-terminus glycosylation, and the like.
- Variants also encompass alternate mRNA sphce forms of the protein or peptides.
- variants proteins and peptides having one or more post-translational modifications of amino acids.
- post- translational modifications include but are not limited to glycosylation, phosphorylation, methylation, ADP ribosylation and the like.
- the variant has a post-translational modification of a methylation on the N-terminal amino acid or phosphorylations of serines and threonines.
- the variant has a post-translational modification of C-terminal glycines for affecting
- variants are derivatives of the proteins, peptides and post-translational modified proteins and peptides that may have other constituents attached thereto such as radiolabels, biotin, fluorescein and chemiluminescent labels and the like.
- Inhibitory protein or peptide analogs are also encompassed in the invention. Such inhibitory protein or peptide analogs are capable of competitively inhibiting the binding of the epithehal protein to its binding site on RNA.
- the identification of the 703D4 early lung cancer detection antigen as sharing amino acid sequence homology with hnRNP A2/B1 is provocative in hght of the emerging knowledge about the hnRNP group of proteins (Burd and Dreyfuss, Science. Vol. 265 (July 29) pp. 615-621, 1994).
- hnRNP The family of hnRNP have roles in RNA processing, including pre-mRNA exon sphcing and sphce site choice, and also in transcription, DNA replication, and recombination (reviewed in Dreyfuss et al. , Ann Rev Biochem .. Vol. 62, pp 289-321, year 1993. Some hnRNPs are involved in shuttling mRNA from the nucleus to the cytosol, which is consistent with both our immunohistochemical localization reported previously and subcellular fractionation. A variety of post-translational modifications have been reported for members of the hnRNP family.
- Post-translational modifications of the epithehal protein, peptide or variants thereof of the present invention are identified by methods known in the art such as two dimensional electrophoresis, reverse-phase APLC (Kam, J. et al. J.
- One method uses two dimensional gels analysis.
- a purified epithehal protein peptide or variant with and without enzymatic treatment is electrophoresed in the first dimension.
- the second dimension is conducted under a pH gradient of about pH 8 to about 9.5 (Anderson Electrophoresis 12:907,
- the protein peptide or variant may be detected by methods known in the o art such as protein staining, radiolabelled metabolic labels, antibody and the like.
- the shift in migration pattern is indicative of a post-translation modification.
- Post-translational modifications are also determined using specific enzymes such as phosphatase, glucosidase and the like to treat samples separated 5 by two dimensional gel electrophoresis or by electrospray API-mass spectroscopy (Medzihradsky, Am. Soc. Mass. Spec.. 5:350, 1994) and the molecular weight of the treated samples compared with non-treated samples.
- specific enzymes such as phosphatase, glucosidase and the like to treat samples separated 5 by two dimensional gel electrophoresis or by electrospray API-mass spectroscopy (Medzihradsky, Am. Soc. Mass. Spec.. 5:350, 1994) and the molecular weight of the treated samples compared with non-treated samples.
- the invention demonstrates deregulation
- the protein and variants thereof may be isolated from natural sources or may be chemicaUy synthesized or recombinantly produced by techniques known in the art. Technique for chemical synthesis are described in J.M. Steward and J.D Young, "Solid Phase Peptide Synthesis", W.H. Freeman & Co. , San 5 Francisco, 1969; M. Bodansky, et al. "Peptide Synthesis", John Wiley & Sons,
- the protein, peptides and variant thereof is at least about 90% pure, 0 preferably at least about 95 % pure, more preferably greater than 95 % pure.
- compositions comprising the epithehal protein, peptides, and variants thereof which are early markers for precancer and cancer each as separate molecular species or in the form of 5 complexes.
- the composition comprises one or more proteins, peptides and variants thereof have at least one amino acid sequence defined by SEQ ID NOS: 1- -"S/ -
- Subjects with second primary lung cancer have a significantly greater optical density than either noncancer subjects (p ⁇ 0.05) or nonendpoint subjects (p ⁇ 0.05).
- All 94 primary lung cancer subjects are Chinese males
- optical density can be roughly considered to be the proportion of background light blocked by hnRNP immunostaini ⁇ g. -S 2- -
- Sensitivity 77% Exact 95% binomial confidence interval, 46% to 95%.
- hnRNP Up-regulation of hnRNP in sputum specimens was 80% accurate in detecting a second primary lung cancer within 12 months, even though cytologic change suggestive of lung cancer was found in only one patient.
- overexpressed hnRNP was 73% accurate in identifying preclinical primary lung cancer, while only 22 % of primary lung cancers were diagnosed cytologically.
- Fluorescence in situ hybridization in combination with propidium iodide (PI) counterstaining is used to demonstrate mRNA expression of epithehal protein, peptides or variants in bone sections as described by Wulf, M. et 5 al. Biotechniques. Vol. 19, No. 3, ⁇ .368-372, 1995.
- tissue samples are immediately fixed in 10% formaldehyde (pH 7.0) and nondecalcified, paraffin-embedded specimens are used for FISH.
- Pretreatment of sections before hybridization is carried out as described by Sandberg, M. et al., J. Bone Joint Surg.. 71:69-71 , 1989.
- prehybridization buffer 50% deionized formamide, 0.3 M NaCl lOmM Tris-HCl, pH 7.5; lOmM NaHPO 4 pH 6.8; 5 mM EDTA; 0.1 x Denhardt's lOmM dithiothreitol; 0.25 mg/ml yeast tRNA [Sigma Chemical, St. Louis, MO]; 12.5% dextran sulfate; 0.5 mg/ml salmon 5 sperm DNA [Sigma Chemical] and is incubated in a humid chamber for 2 hr at
- a digoxigenin-labeled double-stranded cDNA probe for the epithelial protein having the sequence 5'-GAGTCCGGTTCGTGTTCGTC-3' (SEQ ID NO. : 11) and 5'-TGGCAGCATCAACCTCAGC-3' (SEQ ID NO.: 18) are used.
- the probe is labeled with digoxigenin according to the protocol of the Dig- Labeling Kit (Boehringer Mannheim, Mannheim, Germany). Prior to hybridization, the labeled probe is mixed with prehybridization buffer to a concentration of 1 ⁇ g/mL, heated for 10 min. at 95 °C and quickly chilled on ice.
- Probe detection is carried out using an anti-digoxigenin antibody conjugated to FTTC (fluorescein isothiocyanate; Boehringer Mannheim). Unbound conjugate is removed by washing two times for 10 min. with phosphate-buffered saline (PBS) (3.8 mM NaH 2 PO 4 ; 7.8 mM Na 2 HPO 4 ; 0.13 M NaCl). Sections are counterstained with PI (Boehringer Mannheim) in PBS (500 ng/mL) for 5 min. at room temperature (30 ⁇ l per section). Excess PI is removed by washing with PBS, followed by dehydration (70%, 96%, 100% ethanol). Sections are air-dried and mounted in a glycerol/PBS solution. For analyses, a fluorescence microscope (Leitz Diaplan, Wetzlar, Germany) is used.
- differential expression of the epithelial protein, peptide or variant mRNA in precancer and cancer cehs is determined as compared to normal cehs.
- an atypical ceh refers to a functionally and/or morphologically altered ceh such as a precancer ceh and cancer ceh.
- a prediction may be made far in advance of any clinical signs of cancer in the individual. Prediction can be made as early as two years or more prior to any clinical signs of the cancer.
- Such a method is invaluable in identifying those individuals at risk for cancer and allows for early intervention of treatment to inhibit or prevent the development of cancer.
- the method relys on measurement of cellular features or labels whose expression differs as compared to typical or normal cehs. These features or labels may include one or more of those hsted below.
- Image analysis in combination with appropriate statistical software allows for the identity of cellular features which are predictive of the development of cancer.
- the image analysis detects differences or alterations in cellular features or labels distinctive of cancer and precancer.
- Various parameters may be labeled and measured as indicators or predictors of cancer including but not limited to alterations in morphology increased or altered mRNA expression, increased or altered cancer proteins, expression of a cehular receptor or alternatively a decline in cehular receptor, factors associated with apoptosis or other cehular events which are unique to precancer or cancer cehs.
- the present method of predicting cancer has distinct advantages in that it is computer assisted, and highly accurate in predicting cancer development.
- Archived tissues or cells taken from known positive cancer patients, patients known to develop cancer and negative individuals known to remain negative are used to provide specimens for the image analysis method for determining the parameters unique to cancer and precancer cehs.
- a discriminant function may be derived from me best linear combination of parameters which distinguishes specimens of individuals who develop cancer compared with those that remain cancer free. This discriminant function is useful for predicting cancer in unknown samples.
- a labeled probe may specifically identify mRNA, DNA, protein, glycoprotein, cehular receptors, carbohydrate and the like which are modulated in some fashion in cancer or precancer as compared o to normals.
- the labeled probe detects hn-RNP mRNA.
- the image analysis may be made from any spatial electronic array such as that recorded during video microscopy by a charge coupled device (CCD) camera, analog or digital, whether recording transmitted, reflected, or fluorescent illumination. Any image that distinguishes cancer or precancer from normal cehs, tissue or extracts may be used in the present invention to determine a discriminant function predictive of cancer or precancer.
- CCD charge coupled device
- MetaMorph 2.x Universal Imaging Corporation, West Chester, PA
- MetaMorph 2.x Universal Imaging Corporation, West Chester, PA
- the user can select the measurements to calculate and log to a data file. For example, the 108 possible measurements in MetaMorph 's "Object Classifer Set", Version 2.1 are presented below:
- Total area "Pixel area”, “.Area”, “Hole area”, “Relative hole area”, “Standard area count”, “Perimeter”, “Centroid X”, “Centroid Y”, “Width”, “Height”, “Orientation”, “Length”, “Breadth”, “Fiber length”, “Fiber breadth”, “Shape factor”, “Eh. form factor”, “Inner radius”, “Outer radius”, “Mean radius”, “Equiv. radius”, “Equiv. sphere vol.”, “Equiv. prolate vol.”, “Equiv. oblate vol.”,
- Harmomc 12 Semi-Minor .Axis", “EFA Harmonic 12, Semi-Major Axis Angle”, “EFA Harmonic 12, Ellipse Area”, “EFA Harmonic 12, -Axial Ratio”, “EFA Harmonic 13, Semi-Major .Axis” , “EFA Harmomc 13, Semi-Minor Axis”, “EFA Harmomc 13, Semi-Major Axis Angle”, “EFA Harmonic 13, Ehipse Area”, "EFA
- SPSS 7.0 for Windows SPSS, Inc., Chicago, EL
- SPSS Powerful commercial statistical packages
- the algorithms are identical to those used in SPSS software on mainframe computers, and the statistical result will be as precise as those computed on a mainframe.
- the SPSS package includes discriminant analysis which provides direct prediction of group membership. In this procedure, the best linear combination of variables is automatically selected for distinguishing among several groups. Coefficients for the variables are chosen by the computer to make the o ratio of between-groups sums of squares to total sums of squares as large as possible.
- the present invention provides a method for determuiing a discriminant function algorithm using commercial statistical package to select and weight an optimal combination of cehular measurements (made by a commercial imaging package) to provide a direct prediction of group membership (precancer or cancer case or control).
- a discriminant function for predicting lung cancer utilizes the parameters of optical density, nuclear texture difference moment and nuclear area of the elliptical Fourier harmonic which provides an accuracy of about 100% in predicting those individuals who will go on to develop cancer.
- the discriminant function may be based on optical density alone, without the nuclear parameters.
- Different tissue or epithehal cehs from different locations may utilize the same discriminant function or an alternative discriminant function.
- the method of determining a discriminant function may lead to selection of alternative sets of variables, with corresponding different coefficients depending on the tissue, ceh type and the degree of accuracy desired.
- the method is useful in determining a predictive discriminant function equation for any cancer for which prospective specimens may be obtained including but not limited to cancer of the lung, breast, hver, prostate, uterus, ovary, gastro-intestinal tract, esophagus and the like.
- Such a discriminant function used in image analysis allows for prediction of individuals who will go on to develop cancer. o
- Up-regulated hnRNP mRNA may be recognized visually by the intensity and frequency of epithehal cehs labeled with biotin-11-UTP and immunostained by peroxidase-D.AB. Visual interpretation compares the "differential display" of immunolabeled informative (mildly atypical) epithehal cehs to background (mature) epithehal cehs. Accuracy has been improved by objective measurement of hght intensity transmitted through immunolabeled epithelial cehs using video microscopy.
- the computer constructs a four point calibration curve of gray scale hght intensity (on an 8-bit, 256 interval ordinate) against optical density (abscissa).
- One calibration curve is constructed for each wavelength.
- the calibration curves for the first day are arbitrarily selected as the standard curves, and calibration curves 0 from the subsequent measurement sessions are standardized to these, assuring comparability of measurement values during the course of an experiment.
- f. Acquire positive control images. Immunostained Calu-3 cultured lung cancer ceh hybridized with the mRNA antisense probe are 5 selected.
- the ceh image at 600 nm is acquired after averaging 16 frames, background subtraction and shading correction.
- a second image is acquired at 510 a nm without any change in ceh position (registration) by automatically rotating the filter wheel.
- the negative control images are acquired in a similar fashion from an identical control shde to which the sense probe has been hybridized.
- Each test shde is scanned by a cytotechnologist who selects epithehal ceh fields for imaging. Each image is acquired first at 600 nm and then at 510 nm by averaging 16 frames, background subtraction and shading correction without change in registration. Each image pair is saved to a "stack" of images for the same patient. Each stack is saved to the optical disk file which includes the stack of 11 reference images.
- the computer checks the integrity of the reference stack, standardizes die densitometry calibration, retrieves the stack of patient images and places the image of the first field on the computer screen.
- a. Select the nucleus to be measured. A mouse chck when the cursor overlies the nucleus of the first ceh to be measured causes me computer to enlarge the ceh 400x and place it in the center of the field.
- b. Outline the nucleus region of interest. Rapidly dragging the mouse outlines the nucleus to separate it from other structures in the image.
- the threshold of included values is raised and lowered by the technician until a best fit is achieved.
- d. Measure the nucleus. More than 100 separate measurements may be made and recorded electronically to an Excel spreadsheet by a dynamic data entry (DDE) link. In one embodiment, the measurements which most contribute to the separation of cehs by cancer outcome are:
- Nuclear Texture Difference Moment This measurement is based on the number of sign changes proceeding from pixel-to-pixel across the nucleus. A texture difference moment of 0 indicates uniform gray. Higher values o indicate coarse clumping.
- the actual margins of the cytoplasm are determined by the pixel values of transmitted hght.
- the threshold of includes values is raised and lowered by the technician until a best fit is achieved.
- g. Measure the cytoplasm at 600 nm.
- the nucleus is converted into a binary mask which is subtracted from the cytoplasmic image. Similar to the nucleus, more than 100 separate measurements may be made and recorded electronically to an Excel spreadsheet by a dynamic data entry (DDE) link.
- DDE dynamic data entry
- Average cytoplasmic density at 600 nm The optical density of die cytoplasm at 600 nm is determined by die average measured pixel gray level and the standardized calibration table. 5 h. Outline the cytoplasm region of interest at 510 nm.
- the optical density of the cytoplasm at 510 nm is determined by the average measured pixel gray level 5 and the standardized calibration table.
- the linear discriminant Function Data Analysis (This is a commercially available routine for the PC by SPSS Inc. , Chicago, IL). a. Excel measurement data are entered into the SPSS program to find linear combinations of dependent variables that best separate specimens from individuals who later develop cancer from those who remain cancer free. b.
- RNAse free glass shdes (American Histo). Calu-3 (ATCC human bronchogenic adenocarcinoma ceh line) was mixed with normal sputum and used as control material. Pretreatment optimization included the following procedures. .After 4% paraformaldehyde (Sigma) post-fixation for 1 hr. at room temperature, we treated the shdes with 0.1M Tris/50mM EDTA (pH 8.0) prewarmed to 37°C containing 10 g/ml proteinase K (Gibco BRL) for 10 min. to increase probe access. Acetylation with 0.25% acetic anhydride and 0.1M triethanolamine solution (pH 8.0, sigma) for 10 min. is used to decrease background binding. Probes are labeled with 10 nmol/ ⁇ l digoxigenin-11-UTP (Boehringer Mannheim). 0 The in situ hybridization procedure fohows that of Cox et al. fDev.
- Hybridization of one set of shdes was conducted to an antisense single-stranded riboprobe to detect specific hybridization.
- a second set of shdes was hybridized to the sense riboprobe to detect nonspecific background hybridization.
- a third set of shdes was treated with RNAse prior to antisense probe hybridization to detect any signal which may result from binding to non-RNA ceh components. Immunocytochemistry is used to detect the digoxigenin-labeled, hybridized probe.
- optical density values are measured at 600 nm and 510 nm as previously determined from the transmittance spectrum of the chromogen labels.
- Nuclear texture analysis is based on the number of sign changes in pixel-to-pixel comparisons (nuclear texture difference moment), with larger values indicating coarse clumping.
- the shape of the nuclear membrane is determined by evaluating the Fourier power at various frequency ranges. Greater irregularity is reflected as increased cytoplasmic area high Fourier harmonics.
- Figure 15a-d The expression of hnRNP A2 messenger RNA and protein in positive and negative control specimens are presented in Figures 15a-d.
- Figure 15a labeled “immunocytochemistry” shows mature squamous epithehal cehs in normal sputum mixed with cultured Calu-3 adenocarcinoma cehs.
- the normal epithehal cells display smah nuclei with extensive cytoplasm, expressing a normal (background) level of hnRNP detected by monoclonal antibody 703D4 and faintly stained with DAB.
- the cultured tumor cehs have large nuclei with a smah rim of densely staining cytoplasm indicating hnRNP up-regulation.
- Figure 15b (labeled tot.
- antisense shows similar positive control material expressing specific mRNA hybridization labeled with DAB. Note the similarity of spatial expression to the hnRNP protein ( Figure 15a). Figures 15c ("Sense”) and 15d (“RNAse”) present the in situ hybridization negative controls. In Figures 16a-d, the expression of hnRNP A2 messenger RNA and protein is contrasted between a positive case ( Figures 16a, 16b) and a negative case ( Figures 16c, 16d). In the upper row, two ahquots of a specimen from a patient who later developed squamous lung cancer illustrates mild morphologic atypia and positive expression of hnRNP protein ( Figure 16a) and hnRNP messenger RNA
- Table 16 shows the group means and standard deviations for the specific variables measured on the hybridized sputum cehs of individuals who later developed cancer and those who remained cancer-free. Although the sample is small, the carefully made measurements demonstrate significantly greater optical densities (message expression) of the cells of patients who later develop cancer, significantly less fine folding of the nuclear membrane and coarser nuclear clumping (which just fails to reach statistical significance, Table 17). Although the values of specific variables are strongly suggestive, individually they do not successfully predict the subsequent development of cancer.
- Table 20 shows the group means and standard deviations for the optical densities measured on the immunostained sputum cehs of individuals who later developed cancer and those who remained cancer-free. .Although a trend is apparent, measurement variability and the smah sample size preclude a significant difference (Table 21).
- NCH720 and NCH157 ceh lines are used in this study. These ceh lines were grown under protein-free and hormone-free conditions using phenol red- free RPMI-1640 containing 30 nM selenium and 10 mM L-glutamine (Siegfried et al. , J. Biol. Chem. 269:8596, 1994). Pellets of approximately 5 x 10 5 cehs are washed in PBS, re-suspended in 1 ml of 2% NuSieve low melting-point agarose (Cat. 50082, Lot 626592; FMC BioProducts, Rockland, ME), allowed to solidify, fixed for 2 hr in 4% paraformaldehyde or 10% formalin, and embedded in paraffin by routine histopathology techniques. ,
- Ten formalin-fixed, paraffin-embedded blocks containing normal lung and representative cases of precancer and lung tumors are obtained from the files of the BPRB, NCI at the NCI-Navy Medical Oncology Branch.
- the monoclonal antibody 703D4 is used (U.S. Pat. No. 4,569,788).
- a avidin-biotin histochemical staining procedure (Hsu et al, J. Histochem. Cytochem. 29:577, 1981) is used to localize 703D4 immunoreactivity in lung tissue and cell lines using the Vectastrain ABC kit (Cat PK-4001 ; Vector Laboratories, Burlingame, CA) with a 0.03 % solution of 3, 3 '-diaminobenzidine (Cat. D-5637, Lot 122H3642; Sigma, St. Louis, MO) and 0.006% H 2 O 2 as the enzyme substrates.
- RNA from the ceh lines Poly A + RNA from normal human brain (Cat. 6516-2, Lot 2Y081), hver (Cat. 6510-2, Lot 39076), lung (Cat. 6524-2, Lot 34401), stomach (Cat. 6548-2, Lot 38131), and uterus (Cat. 6537-2, Lot 29100) are purchased from Clontech Laboratories (Palo .Alto, CA).
- Standard formaldehyde gels were run with total RNA (10 g/well) at 120 v. 100 mAmp for 3 hr. At the end of the run, the gels are washed for 15 min in 20 x SSC and then blotted overnight by capillary flow transfer onto a 0.45- ⁇ m nitrocellulose filter (Davis et al, Basic Methods in Molecular Biology. Norwalk,
- the blots are UV crosslinked at 1200 Joules and pre-hybridized for 4 hr.
- the Stratagene Prime-It kit (Stratagene; La Jo a, CA) is used to label the probe.
- the probes were prepared by random priming of inserts gel purified from restriction endonuclease digests of plasmids containing full-length cDNAs for hnRNP-A2 and Al with 32 P-dCTP. Probe (1 x 10° cpm) is added to each ml of hybridizing buffer.
- the blot is washed once in 2 x SSC/0.1 % SDS at room temperature, the blot is washed once in 2 x SSC/0.1 % at room temperature (RT; 30 min) and once with 0.1 % SSC/0.1 % SDS at 60°C (30 min). The blots are then air-dried and autoradiographed at -80°C on Kodak XAR5 film for 1-2 days. Standard PCR
- Ohgonucleotide primers for epithehal protein are made using a MilhGen 8700 DNA synthesizer (Milhpore; Marlborough, MA). Sequences are 5'-GAGTCCGGTTCGTGTTCGTC-3' (SEQ ID NO. : 11) and 5'- TGGCAGCATCAACCTCAGC-3' (SEQ ID NO.: 18). Ah buffers, enzymes, and nucleotides used are obtained from Apphed Biosystems (Perkin-Elmer Cetus; Norwald, CT). A Perkin-Elmer 9600 Thermocycler is used to amplify the samples.
- PCR products are analyzed electrophoreticahy using a 1 % agarose gel (80 V, 3 hr) and the ethidium bromide staining is observed under UV hght, fohowed by Southern analysis with nested 32 P-labeled probes.
- Gels are denatured in 1.5 M NaCl/0.6 M NaOH and 1.5 M NaCl/2 M Tris and blotted onto a 0.2- m nitrocellulose filter in 20 x SSC by capillary flow transfer overnight.
- the filter are cross-linked at 80°C under vacuum and put in hybridization buffer.
- Anti-sense nested probes are end-labeled by standard 32 P procedures (Sambrook et al, Molecular Cloning: A Laboratory Manual. Vol. ⁇ , Cold Spring Harbor, NY, Cold Spring Harbor Laboratory Press, 8.3, 1989).
- Hybridization with the probe is done overnight at 42° C.
- Stringency washing at RT is in 5 x SSC/0.1 % SDS (twice for 30 min), then 1 x SSC/0.1 % SDS (twice for 30 min).
- Filters are air-dried and autoradi ⁇ graphed at -80°C on Kodak X.AR5 film for 2-4 hr.
- the in situ PCR technique for localizing specific DNA sequences is performed by a three-step protocol as described by Nuovo (PCR in situ hybridization, In Nuovo, GJ, ed. PCR In Situ Hybridization: Protocols and Apphcations, New York, Raven Press, 157, 1992a). After dewaxing the tissue sections, a protein digestion is carried out to facilitate reagent penetration into the cehs. The second step consists of the PCR itself with simultaneous labeling of the PCR products, fohowed by the third step that visualizes the labeled product.
- the in situ amplification technique for RNA detection utilizes a similar protocol. i ts
- reagent access to the target nucleic acid can vary.
- we analyzed enzyme digestion procedures may be varied by the concentration of proteinase K (Cat. P-0390, Lot 93H0603; Sigma) between 1 and 100 ⁇ glml and incubation time (5-45 min).
- the shdes are then maintained at RT for 10 min, at 45°C for 45 min, and at 70°C for 10 min. o
- ah parameters for the PCR reaction including MgCl 2 concentration, pH, and annealing temperature, is optimized by standard PCR. At this point the PCR products can be cloned and 5 sequenced to confirm identity. Products are cloned into a pCRII vector (Cat.
- Taq-blocking monoclonal antibody was purchased from Clontech (TaqStart 0 antibody; Cat. 5400-1, Lot 47656).
- PCR mixture 2.5 mM MgCl 2 200 ⁇ M dNTP2, 100 ⁇ M digoxigenin-ll-2'-deoxyuridine-5'- triphosphate (Cat. 1558 706, Lot 13945241-12; Boehringer Mannheim, 5 Indianapolis, IN), 1 ng/ l primers, 50 mM KC1, 10 mM Tris-HCL, pH 8.3.
- each shde 80- ⁇ l aliquot of solution is apphed to each shde, and then each shde is covered by silanated glass covershps, sealed with rubber cement, and placed in the thermocycler.
- the targets are amplified, 15-20 cycles to obtain crisp stam-ng.
- two washes in 0.1 x SSC at 45°C, 20 min each, are 0 performed to eliminate unbound nucleotides.
- Detection of digoxigenin-tagged PCR products is done with a kit 5 from Boehringer Mannheim (Cat. 1210 220, Lot. 14101420-13). It involves a 2-hr incubation with an anti-digoxigenin antibody bound to alkaline phosphatase. After //7 o a thorough rinse, the appropriate substrates (nitroblue tetrazolium and 5-bromo- chloro-3-indolyl-phosphate) are enzymaticahy transformed into a dark blue precipitate. Color deposition was checked under the microscope.
- the PCR technique is well known for its ability to amplify even
- At least three types of controls are recommended in every experiment to avoid false-positives or -negatives.
- An additional control consists of establishing existing relationship between the transcriptional/ translational products. This can be done by staining one section for the nucleic acid by in situ PCR and a serial section with a specific antibody against the polypeptide. The co-localization of the mRNA and its protein within the same cehs wih strengthen the validity of the observation.
- hnRNP A2/B1 Expression in Fetal Lung
- the expression of hnRNP A2/B1 by immunocytochemistry and in situ hybridization in fetal tissue was evaluated to determine if these molecules were potentiahy involved in early organogenesis. This would estabhsh hnRNP A2/B1 as an oncofetal antigen and provide additional support for the hypothesis that hnRNP A2/ I is playing a central role in the process of carcinogenesis and fetal development.
- the tissues evaluated included multiple sections of mouse and rat lung tissue from various stages of embryonal development and examples of mature rodent lung. Comparable human tissue was also evaluated.
- Sections (4 ⁇ m thick) were mounted on shdes coated with Vectabond (SP-1800; Vector Laboratories, Burlingame, CA), dewaxed and prepared for hybridization with RNA probes as described by Gibson and Polak.
- Plasmid 72 ORNPclA containing the human hnRNP gene was used to generate riboprobes.
- the DNA fragment was subcloned into pCR ⁇ vector (Invitrogen) and linearized with the appropriate restriction enzymes.
- Labeled probes were prepared using digoxigenin-11-UTP (1277 073; Boehringer, Barcelona, Spain) and T7 (881 767; Boehringer) or T3 RNA polymerases (1031 163; Boehringer) to synthesize sense and antisense RNA transcripts, respectively. Hybridization was performed in a moist chamber at 46°C for 20 hours in a 15- ⁇ l volume containing 0.5 ng/ ⁇ l of probe for each section.
- Stringency washes included treatments with 150 mmol/L NaCl, 15 mmol/L sodium citrate, pH 7.0 (SSC), and sodium dodecyl sulfate (SDS) as fohows: four washes in 2X SSC/0/1 % SDS, two washes in 0.1 x SSC/0.1 %
- RNAse at 37°C for 15 minutes, and additional rinses in 2X SSC.
- the results of this analysis are as fohows.
- the hnRNP A2/B1 expression in the lung begins with the mesenchymal cehs of the mainstream bronchus on day 10 of embryonal development.
- the immunoreactivity migrates from the mainstream to the evolving bronchi through Day 13 and 14 with strong expression in the undifferentiated epithehum.
- Figures 17a-17d show the dynamic changes in fetal mouse lung.
- the central expression of the antigen is restricted and the activity becomes positive in the undifferentiated epithehum of the peripheral airways by Day 16. So the pattern of expression of hnRNP A2/B1 mirrors the known sequence of lung development in moving from central to distal in a timeframe that precisely corresponds to peak organ development activity.
- hnRNP A2/B1 may have diagnostic value for other types of cancer.
- World Health Organization The World Health Organization histological typing of lung tumors. American Journal of Chnical Pathology, 77: 123-136, 1982.
- ADDRESSEE MORGAN & FINNEGAN, L.L.P.
Landscapes
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- Health & Medical Sciences (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Zoology (AREA)
- Engineering & Computer Science (AREA)
- Wood Science & Technology (AREA)
- Genetics & Genomics (AREA)
- Analytical Chemistry (AREA)
- Biochemistry (AREA)
- Immunology (AREA)
- General Health & Medical Sciences (AREA)
- Molecular Biology (AREA)
- Biophysics (AREA)
- General Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Physics & Mathematics (AREA)
- Microbiology (AREA)
- Biotechnology (AREA)
- Pathology (AREA)
- Oncology (AREA)
- Hospice & Palliative Care (AREA)
- Toxicology (AREA)
- Gastroenterology & Hepatology (AREA)
- Medicinal Chemistry (AREA)
- Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
- Peptides Or Proteins (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
Priority Applications (3)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| JP9514401A JP2000500322A (ja) | 1995-10-02 | 1996-10-02 | 初期癌検出への使用のための上皮タンパク質及びそのdna |
| AU73864/96A AU7386496A (en) | 1995-10-02 | 1996-10-02 | An epithelial protein and dna thereof for use in early cancer detection |
| EP96936141A EP0861323A1 (en) | 1995-10-02 | 1996-10-02 | An epithelial protein and dna thereof for use in early cancer detection |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US08/538,711 US5994062A (en) | 1995-10-02 | 1995-10-02 | Epithelial protein and DNA thereof for use in early cancer detection |
| US08/538,711 | 1995-10-02 | ||
| US08/725,027 | 1996-10-02 | ||
| US08/725,027 US6251586B1 (en) | 1995-10-02 | 1996-10-02 | Epithelial protein and DNA thereof for use in early cancer detection |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO1997012975A1 true WO1997012975A1 (en) | 1997-04-10 |
| WO1997012975B1 WO1997012975B1 (en) | 1997-05-22 |
Family
ID=27065902
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US1996/015825 Ceased WO1997012975A1 (en) | 1995-10-02 | 1996-10-02 | An epithelial protein and dna thereof for use in early cancer detection |
Country Status (5)
| Country | Link |
|---|---|
| US (1) | US6251586B1 (enExample) |
| EP (2) | EP0861323A1 (enExample) |
| JP (1) | JP2000500322A (enExample) |
| AU (1) | AU7386496A (enExample) |
| WO (1) | WO1997012975A1 (enExample) |
Cited By (9)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP0842433A1 (en) * | 1996-06-05 | 1998-05-20 | Matritech, Inc. | Materials and methods for detection of breast cancer |
| WO1998014469A3 (en) * | 1996-10-02 | 1998-05-28 | Us Health | An epithelial protein and dna thereof for use in early cancer detection |
| WO2001025275A1 (en) * | 1999-09-17 | 2001-04-12 | Rupert Donald Holms | Regulatory/unfolding peptides of ezrin |
| WO2001021649A3 (en) * | 1999-09-22 | 2001-05-17 | Cedars Sinai Medical Center | Nucleic acids encoding vitamin d response element binding proteins, products related thereto, and methods of using same |
| US6277956B1 (en) * | 1997-06-23 | 2001-08-21 | Ludwig Institute For Cancer Research | Isolated nona- and decapeptides which bind to HLA molecules, and the use thereof |
| WO2001073019A1 (de) * | 2000-03-29 | 2001-10-04 | Max-Planck-Gesellschaft | Raumform von tpr-strukturmotiv enthaltenden polypeptiden mit chaperon-bindungsfunktion, deren kristalle und verbindungen zur inhibierung derartiger polypeptide |
| EP1310556A3 (en) * | 1998-03-31 | 2003-07-23 | Genzyme Corporation | Composition and methods for the identification of lung tumor cells |
| EP1790717A3 (en) * | 1998-03-31 | 2007-06-06 | Genzyme Corporation | Compositions and methods for the identification of lung tumor cells |
| US11214613B2 (en) | 2017-05-30 | 2022-01-04 | The University Of British Columbia | Epitopes in the RNA recognition motif 1 (RRM1) of TDP-43 and misfolding-selective antibodies thereto |
Families Citing this family (43)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US7475048B2 (en) * | 1998-05-01 | 2009-01-06 | Health Discovery Corporation | Pre-processed feature ranking for a support vector machine |
| US7805388B2 (en) * | 1998-05-01 | 2010-09-28 | Health Discovery Corporation | Method for feature selection in a support vector machine using feature ranking |
| US7970718B2 (en) * | 2001-05-18 | 2011-06-28 | Health Discovery Corporation | Method for feature selection and for evaluating features identified as significant for classifying data |
| US6591003B2 (en) | 2001-03-28 | 2003-07-08 | Visiongate, Inc. | Optical tomography of small moving objects using time delay and integration imaging |
| US7907765B2 (en) | 2001-03-28 | 2011-03-15 | University Of Washington | Focal plane tracking for optical microtomography |
| US6944322B2 (en) | 2001-03-28 | 2005-09-13 | Visiongate, Inc. | Optical tomography of small objects using parallel ray illumination and post-specimen optical magnification |
| US6522775B2 (en) | 2001-03-28 | 2003-02-18 | Alan C. Nelson | Apparatus and method for imaging small objects in a flow stream using optical tomography |
| US20060023219A1 (en) * | 2001-03-28 | 2006-02-02 | Meyer Michael G | Optical tomography of small objects using parallel ray illumination and post-specimen optical magnification |
| US6519355B2 (en) * | 2001-03-28 | 2003-02-11 | Alan C. Nelson | Optical projection imaging system and method for automatically detecting cells having nuclear and cytoplasmic densitometric features associated with disease |
| KR100437887B1 (ko) * | 2001-06-29 | 2004-07-03 | 주식회사 인트론바이오테크놀로지 | 크로마토그래피의 원리를 이용한 웨스턴 블롯 분석키트 |
| US6741730B2 (en) | 2001-08-10 | 2004-05-25 | Visiongate, Inc. | Method and apparatus for three-dimensional imaging in the fourier domain |
| US6636623B2 (en) * | 2001-08-10 | 2003-10-21 | Visiongate, Inc. | Optical projection imaging system and method for automatically detecting cells with molecular marker compartmentalization associated with malignancy and disease |
| US6697509B2 (en) | 2001-10-04 | 2004-02-24 | Chromavision Medical Systems, Inc. | Method and apparatus for scoring the uptake of markers in cells |
| US7260253B2 (en) * | 2002-04-19 | 2007-08-21 | Visiongate, Inc. | Method for correction of relative object-detector motion between successive views |
| US7197355B2 (en) | 2002-04-19 | 2007-03-27 | Visiongate, Inc. | Variable-motion optical tomography of small objects |
| US7738945B2 (en) * | 2002-04-19 | 2010-06-15 | University Of Washington | Method and apparatus for pseudo-projection formation for optical tomography |
| US7811825B2 (en) * | 2002-04-19 | 2010-10-12 | University Of Washington | System and method for processing specimens and images for optical tomography |
| US20050085708A1 (en) * | 2002-04-19 | 2005-04-21 | University Of Washington | System and method for preparation of cells for 3D image acquisition |
| US6697508B2 (en) | 2002-05-10 | 2004-02-24 | Visiongate, Inc. | Tomographic reconstruction of small objects using a priori knowledge |
| US6770893B2 (en) * | 2002-05-13 | 2004-08-03 | Visiongate, Inc. | Method and apparatus for emission computed tomography using temporal signatures |
| US7687167B2 (en) * | 2003-07-18 | 2010-03-30 | Panasonic Corporation | Power supply unit |
| US7229778B2 (en) | 2004-02-26 | 2007-06-12 | The Procter & Gamble Company | Methods for determining the relative benefits and/or evaluating quantitative changes of products on epithelial tissue |
| EP1783232A4 (en) * | 2004-07-30 | 2007-11-07 | Tosoh Corp | METHOD OF MEASURING MRNA OF HETEROGENIC NUCLEAR RIBONUCLEOPROTEIN B1 (HNRNP B1) |
| US6991738B1 (en) | 2004-10-13 | 2006-01-31 | University Of Washington | Flow-through drum centrifuge |
| US20060096358A1 (en) * | 2004-10-28 | 2006-05-11 | University Of Washington | Optical projection tomography microscope |
| US7494809B2 (en) * | 2004-11-09 | 2009-02-24 | Visiongate, Inc. | Automated cell sample enrichment preparation method |
| US20070091109A1 (en) * | 2005-09-13 | 2007-04-26 | Roscoe Atkinson | Image quality |
| JP4915071B2 (ja) * | 2005-09-22 | 2012-04-11 | 株式会社ニコン | 顕微鏡、およびバーチャルスライド作成システム |
| US20070196935A1 (en) * | 2006-02-17 | 2007-08-23 | Taiwan Semiconductor Manufacturing Company, Ltd. | Prediction of ESL/ILD remaining thickness |
| US7835561B2 (en) | 2007-05-18 | 2010-11-16 | Visiongate, Inc. | Method for image processing and reconstruction of images for optical tomography |
| US7787112B2 (en) | 2007-10-22 | 2010-08-31 | Visiongate, Inc. | Depth of field extension for optical tomography |
| US8143600B2 (en) | 2008-02-18 | 2012-03-27 | Visiongate, Inc. | 3D imaging of live cells with ultraviolet radiation |
| US8090183B2 (en) | 2009-03-12 | 2012-01-03 | Visiongate, Inc. | Pattern noise correction for pseudo projections |
| US8254023B2 (en) * | 2009-02-23 | 2012-08-28 | Visiongate, Inc. | Optical tomography system with high-speed scanner |
| JP5627698B2 (ja) | 2009-10-19 | 2014-11-19 | ベンタナ メディカル システムズ, インコーポレイテッド | 撮像システムおよび技法 |
| US8492325B2 (en) | 2010-03-01 | 2013-07-23 | The Procter & Gamble Company | Dual-usage liquid laundry detergents comprising a silicone anti-foam |
| EP2582842A2 (en) | 2010-06-16 | 2013-04-24 | Yissum Research Development Company of The Hebrew University of Jerusalem | Method of diagnosing and treating cancer |
| US8113412B1 (en) | 2011-05-13 | 2012-02-14 | Taiwan Semiconductor Manufacturing Company, Ltd | Methods for detecting defect connections between metal bumps |
| JP2017523291A (ja) | 2014-08-07 | 2017-08-17 | ザ プロクター アンド ギャンブルカンパニー | 洗濯洗剤組成物を含む可溶性単位用量 |
| US11069054B2 (en) | 2015-12-30 | 2021-07-20 | Visiongate, Inc. | System and method for automated detection and monitoring of dysplasia and administration of immunotherapy and chemotherapy |
| US20200306408A1 (en) | 2019-03-28 | 2020-10-01 | The Procter & Gamble Company | Cyclodextrin containing freshening composition |
| EP4045620A1 (en) | 2019-10-15 | 2022-08-24 | The Procter & Gamble Company | Detergent compositions |
| CN113936738B (zh) * | 2021-12-14 | 2022-04-22 | 鲁东大学 | 一种基于卷积神经网络的rna-蛋白质结合位点预测方法 |
Family Cites Families (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4569788A (en) | 1983-05-18 | 1986-02-11 | The United States Of America As Represented By The Department Of Health And Human Services | Monoclonal antibodies against non small cell lung cancer |
| US4683202A (en) | 1985-03-28 | 1987-07-28 | Cetus Corporation | Process for amplifying nucleic acid sequences |
| US4683195A (en) | 1986-01-30 | 1987-07-28 | Cetus Corporation | Process for amplifying, detecting, and/or-cloning nucleic acid sequences |
| AU632469B2 (en) | 1988-04-04 | 1993-01-07 | Johns Hopkins University, The | A method for early detection of lung cancer |
| US5194599A (en) | 1988-09-23 | 1993-03-16 | Gilead Sciences, Inc. | Hydrogen phosphonodithioate compositions |
| US5256775A (en) | 1989-06-05 | 1993-10-26 | Gilead Sciences, Inc. | Exonuclease-resistant oligonucleotides |
| US5264562A (en) | 1989-10-24 | 1993-11-23 | Gilead Sciences, Inc. | Oligonucleotide analogs with novel linkages |
-
1996
- 1996-10-02 AU AU73864/96A patent/AU7386496A/en not_active Abandoned
- 1996-10-02 EP EP96936141A patent/EP0861323A1/en not_active Withdrawn
- 1996-10-02 JP JP9514401A patent/JP2000500322A/ja active Pending
- 1996-10-02 EP EP03078938A patent/EP1426381A1/en not_active Withdrawn
- 1996-10-02 US US08/725,027 patent/US6251586B1/en not_active Expired - Fee Related
- 1996-10-02 WO PCT/US1996/015825 patent/WO1997012975A1/en not_active Ceased
Non-Patent Citations (6)
Cited By (14)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US6218131B1 (en) | 1996-06-05 | 2001-04-17 | Matritech, Inc. | Materials and methods for detection of breast cancer |
| EP0842433A1 (en) * | 1996-06-05 | 1998-05-20 | Matritech, Inc. | Materials and methods for detection of breast cancer |
| WO1998014469A3 (en) * | 1996-10-02 | 1998-05-28 | Us Health | An epithelial protein and dna thereof for use in early cancer detection |
| US6277956B1 (en) * | 1997-06-23 | 2001-08-21 | Ludwig Institute For Cancer Research | Isolated nona- and decapeptides which bind to HLA molecules, and the use thereof |
| EP1310556A3 (en) * | 1998-03-31 | 2003-07-23 | Genzyme Corporation | Composition and methods for the identification of lung tumor cells |
| EP1790717A3 (en) * | 1998-03-31 | 2007-06-06 | Genzyme Corporation | Compositions and methods for the identification of lung tumor cells |
| US6849596B1 (en) | 1999-09-17 | 2005-02-01 | Rupert Donald Holms | Regulatory/unfolding peptides of ezrin |
| AU770208B2 (en) * | 1999-09-17 | 2004-02-19 | Rupert Donald Holms | Regulatory/unfolding peptides of ezrin |
| EP1760090A1 (en) * | 1999-09-17 | 2007-03-07 | Rupert Donald Holms | Regulatory/unfolding peptides of ezrin |
| WO2001025275A1 (en) * | 1999-09-17 | 2001-04-12 | Rupert Donald Holms | Regulatory/unfolding peptides of ezrin |
| CN100387619C (zh) * | 1999-09-17 | 2008-05-14 | 鲁珀特·唐纳德·霍姆斯 | 埃滋蛋白的调节/伸展肽 |
| WO2001021649A3 (en) * | 1999-09-22 | 2001-05-17 | Cedars Sinai Medical Center | Nucleic acids encoding vitamin d response element binding proteins, products related thereto, and methods of using same |
| WO2001073019A1 (de) * | 2000-03-29 | 2001-10-04 | Max-Planck-Gesellschaft | Raumform von tpr-strukturmotiv enthaltenden polypeptiden mit chaperon-bindungsfunktion, deren kristalle und verbindungen zur inhibierung derartiger polypeptide |
| US11214613B2 (en) | 2017-05-30 | 2022-01-04 | The University Of British Columbia | Epitopes in the RNA recognition motif 1 (RRM1) of TDP-43 and misfolding-selective antibodies thereto |
Also Published As
| Publication number | Publication date |
|---|---|
| AU7386496A (en) | 1997-04-28 |
| EP0861323A1 (en) | 1998-09-02 |
| EP1426381A1 (en) | 2004-06-09 |
| JP2000500322A (ja) | 2000-01-18 |
| US6251586B1 (en) | 2001-06-26 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US6251586B1 (en) | Epithelial protein and DNA thereof for use in early cancer detection | |
| US6342483B1 (en) | Method for detection and treatment of breast cancer | |
| US6429011B1 (en) | Neuronal apoptosis inhibitor protein gene sequence and mutations causative of spinal muscular atrophy | |
| US6500625B1 (en) | Methods for diagnosing cancer or precancer based upon hnRNP protein expression | |
| JP2008099698A (ja) | 多重腫瘍異常生長遺伝子 | |
| WO1998051824A1 (en) | Reagents and methods useful for detecting disease of the urinary tract | |
| US20040053262A1 (en) | Supressor gene | |
| WO1998051805A1 (en) | Reagents and methods useful for detecting diseases of the prostate | |
| WO1997030108A1 (en) | Characterized brca1 and brca2 proteins and screening and therapeutic methods based on characterized brca1 and brca2 proteins | |
| JP2007289196A (ja) | 癌組織でディファレンシャルに発現される核酸配列 | |
| WO1998015657A1 (en) | Reagents and methods useful for detecting diseases of the prostate | |
| CA2469027A1 (en) | Human genes and gene expression products isolated from human prostate | |
| EP0870025A1 (en) | Reagents and methods useful for detecting diseases of the breast | |
| US7214488B2 (en) | Detection of MECT1-MAML2 fusion products | |
| WO1998014469A2 (en) | An epithelial protein and dna thereof for use in early cancer detection | |
| US7060457B2 (en) | Aberrant glutamate transporters and methods of use | |
| JP2013143958A (ja) | ヒトbrca2遺伝子の表現型の決定方法 | |
| CA2373466C (en) | Application of aprataxin gene to diagnosis and treatment for early-onset spinocerebellar ataxia (eaoh) | |
| CA2293661A1 (en) | Reagents and methods useful for detecting diseases of the breast | |
| WO1998055656A1 (en) | Reagents and methods useful for detecting diseases of the urinary tract | |
| CA2430794A1 (en) | Human genes and gene expression products isolated from human prostate | |
| JP4297209B2 (ja) | Kiaa0172遺伝子の疾病治療及び診断並びに創薬への利用 | |
| US20070128645A1 (en) | Use of KIAA0172 gene in treatment and diagnosis of diseases as well as in pharmaceutical development | |
| DE60319693T2 (de) | Marker fur lungentumoren | |
| US20030225008A1 (en) | Diagnostic and therapeutic methods using the H37 tumor suppressor gene |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| AK | Designated states |
Kind code of ref document: A1 Designated state(s): AL AM AT AU AZ BB BG BR BY CA CH CN CU CZ DE DK EE ES FI GB GE HU IL IS JP KE KG KP KR KZ LK LR LS LT LU LV MD MG MK MN MW MX NO NZ PL PT RO RU SD SE SG SI SK TJ TM TR TT UA UG UZ VN AM AZ BY KG KZ MD RU TJ TM |
|
| AL | Designated countries for regional patents |
Kind code of ref document: A1 Designated state(s): KE LS MW SD SZ UG AT BE CH DE DK ES FI FR GB GR IE IT LU MC NL PT SE BF BJ CF CG CI CM GA |
|
| DFPE | Request for preliminary examination filed prior to expiration of 19th month from priority date (pct application filed before 20040101) | ||
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application | ||
| ENP | Entry into the national phase |
Ref country code: JP Ref document number: 1997 514401 Kind code of ref document: A Format of ref document f/p: F |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 1996936141 Country of ref document: EP |
|
| REG | Reference to national code |
Ref country code: DE Ref legal event code: 8642 |
|
| WWP | Wipo information: published in national office |
Ref document number: 1996936141 Country of ref document: EP |
|
| NENP | Non-entry into the national phase |
Ref country code: CA |
|
| WWW | Wipo information: withdrawn in national office |
Ref document number: 1996936141 Country of ref document: EP |