US20240115607A1 - Chimeric antigen receptor (car) constructs and nk cells expressing car constructs - Google Patents

Chimeric antigen receptor (car) constructs and nk cells expressing car constructs Download PDF

Info

Publication number
US20240115607A1
US20240115607A1 US18/273,661 US202218273661A US2024115607A1 US 20240115607 A1 US20240115607 A1 US 20240115607A1 US 202218273661 A US202218273661 A US 202218273661A US 2024115607 A1 US2024115607 A1 US 2024115607A1
Authority
US
United States
Prior art keywords
seq
domain
aspects
polypeptide
amino acid
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Pending
Application number
US18/273,661
Other languages
English (en)
Inventor
Qiming Xu
Li Chen
Huaxing ZHU
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Cytocares (shanghai) Inc
Original Assignee
Cytocares (shanghai) Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Cytocares (shanghai) Inc filed Critical Cytocares (shanghai) Inc
Priority to US18/273,661 priority Critical patent/US20240115607A1/en
Assigned to CYTOCARES (SHANGHAI) INC. reassignment CYTOCARES (SHANGHAI) INC. ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: CHEN, LI, XU, QIMING, ZHU, HUAXING
Publication of US20240115607A1 publication Critical patent/US20240115607A1/en
Pending legal-status Critical Current

Links

Images

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • C07K14/7051T-cell receptor (TcR)-CD3 complex
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K35/00Medicinal preparations containing materials or reaction products thereof with undetermined constitution
    • A61K35/12Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
    • A61K35/14Blood; Artificial blood
    • A61K35/17Lymphocytes; B-cells; T-cells; Natural killer cells; Interferon-activated or cytokine-activated lymphocytes
    • A61K39/4631
    • A61K39/464411
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/10Cellular immunotherapy characterised by the cell type used
    • A61K40/15Natural-killer [NK] cells; Natural-killer T [NKT] cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/30Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
    • A61K40/31Chimeric antigen receptors [CAR]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • A61K40/4202Receptors, cell surface antigens or cell surface determinants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • A61K40/4202Receptors, cell surface antigens or cell surface determinants
    • A61K40/421Immunoglobulin superfamily
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • A61K40/4202Receptors, cell surface antigens or cell surface determinants
    • A61K40/421Immunoglobulin superfamily
    • A61K40/4211CD19 or B4
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • C07K14/70507CD2
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • C07K14/70517CD8
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • C07K14/70535Fc-receptors, e.g. CD16, CD32, CD64 (CD2314/705F)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70578NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/85Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
    • C12N15/86Viral vectors
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/06Animal cells or tissues; Human cells or tissues
    • C12N5/0602Vertebrate cells
    • C12N5/0634Cells from the blood or the immune system
    • C12N5/0646Natural killers cells [NK], NKT cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/10Indexing codes associated with cellular immunotherapy of group A61K40/00 characterized by the structure of the chimeric antigen receptor [CAR]
    • A61K2239/11Antigen recognition domain
    • A61K2239/15Non-antibody based
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/10Indexing codes associated with cellular immunotherapy of group A61K40/00 characterized by the structure of the chimeric antigen receptor [CAR]
    • A61K2239/17Hinge-spacer domain
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/10Indexing codes associated with cellular immunotherapy of group A61K40/00 characterized by the structure of the chimeric antigen receptor [CAR]
    • A61K2239/21Transmembrane domain
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/10Indexing codes associated with cellular immunotherapy of group A61K40/00 characterized by the structure of the chimeric antigen receptor [CAR]
    • A61K2239/22Intracellular domain
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/27Indexing codes associated with cellular immunotherapy of group A61K40/00 characterized by targeting or presenting multiple antigens
    • A61K2239/28Expressing multiple CARs, TCRs or antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/46Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the cancer treated
    • A61K2239/48Blood cells, e.g. leukemia or lymphoma
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622Single chain antibody (scFv)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/03Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/33Fusion polypeptide fusions for targeting to specific cell types, e.g. tissue specific targeting, targeting of a bacterial subspecies
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2501/00Active agents used in cell culture processes, e.g. differentation
    • C12N2501/20Cytokines; Chemokines
    • C12N2501/23Interleukins [IL]
    • C12N2501/2302Interleukin-2 (IL-2)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2510/00Genetically modified cells
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2740/00Reverse transcribing RNA viruses
    • C12N2740/00011Details
    • C12N2740/10011Retroviridae
    • C12N2740/16011Human Immunodeficiency Virus, HIV
    • C12N2740/16041Use of virus, viral particle or viral elements as a vector
    • C12N2740/16043Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector

Definitions

  • NK natural killer
  • CAR chimeric antigen receptor
  • CAR-T cell therapies using chimeric antigen receptor (CAR) constructs have been used as a treatment for cancers.
  • CAR-T cell therapies can result in T cell overactivity and cytokine release syndrome (CRS).
  • CRS cytokine release syndrome
  • NK cells are functionally similar to CD8+ cytotoxic T cells and considered an alternative for T cells in cytotoxic killing of tumor cells.
  • CAR-NK technology offers significant advantages, e.g., lower occurrence of CRS or neurotoxicity, and high feasibility for “off-the-shelf” manufacturing.
  • an NK CAR construct comprises an extracellular domain comprising an extracellular binding domain (i.e., an antigen recognition region), a transmembrane domain (TD), and an intracellular domain comprising 1 or 2 signaling domain(s), and/or a co-stimulatory domain.
  • an extracellular binding domain i.e., an antigen recognition region
  • TD transmembrane domain
  • intracellular domain comprising 1 or 2 signaling domain(s)
  • This technology provides CAR constructs with transmembrane domains and/or intracellular domains different from those used in CAR-T therapy, and adapted for use in modifying NK cells, e.g., to target them to cells expressing a given marker or tumor antigen.
  • NK cells modified with the CAR constructs described herein have more potent NK cell activation and cytotoxic activity than those currently used for CAR-T therapy. This technology thus provides CAR constructs that induce high levels of NK cell proliferation, activation, cytokine secretion, and cytolytic activity.
  • a chimeric antigen receptor (CAR) polypeptide for expression in natural killer (NK) cells comprising: (a) an extracellular binding domain; (b) a transmembrane domain; and (c) an intracellular domain comprising at least one of the following: (i) an intracellular signaling domain from an NK cell receptor; (ii) an intracellular signaling domain from an NK cell membrane-bound signaling adaptor protein; and/or (iii) an intracellular co-stimulatory domain from a co-stimulatory receptor.
  • the polypeptide comprises from N-terminus to C-terminus: (a) the extracellular binding domain; (b) the transmembrane domain; and (c) the intracellular domain.
  • the polypeptide comprises from C-terminus to N-terminus: (a) the extracellular binding domain; (b) the transmembrane domain; and (c) the intracellular domain.
  • the NK cell receptor or NK cell membrane-bound signaling adaptor protein is selected from the group consisting of: (a) Natural Killer Cell Receptor 2B4; (b) Natural Killer-, T- And B-Cell Antigen (NTB-A); (c) CD2-Like Receptor Activating Cytotoxic Cells (CRACC); (d) cluster of differentiation 2 (CD2); (e) high-affinity IgE receptor (Fc ⁇ R1); and (f) CD3-zeta (CD3 ⁇ ).
  • the NK cell receptor is selected from the group consisting of: 2B4, NTB-A, CRACC, and CD2.
  • the NK cell receptor is 2B4.
  • the NK cell receptor is NTB-A.
  • the NK cell receptor is CRACC.
  • the NK cell receptor is CD2.
  • the NK cell membrane-bound signaling adaptor protein is CD3 ⁇ or Fc ⁇ R1.
  • the intracellular signaling domain from the NK cell receptor or the intracellular signaling domain from the NK cell membrane-bound signaling adaptor protein comprises the amino acid sequence of one of SEQ ID NOs: 7-12 or an amino acid sequence that is at least 80% identical to one of SEQ ID NOs: 7-12.
  • the co-stimulatory receptor is 4-1BB and/or IL2 receptor beta (IL2RB).
  • the intracellular co-stimulatory domain from the co-stimulatory receptor comprises the amino acid sequence of one of SEQ ID NOs: 15-16 or an amino acid sequence that is at least 80% identical to one of SEQ ID NOs: 15-16.
  • the intracellular domain further comprises at least one self-cleaving peptide.
  • the self-cleaving peptide is T2A, P2A, E2A, or F2A.
  • the self-cleaving peptide comprises the amino acid sequence of one of SEQ ID NOs: 19-20 or an amino acid sequence that is at least 80% identical to one of SEQ ID NOs: 19-20.
  • the intracellular domain further comprises a cytokine.
  • the cytokine is IL-15 or IL-21.
  • the cytokine comprises the amino acid sequence of one of SEQ ID NOs: 23-24 or an amino acid sequence that is at least 80% identical to one of SEQ ID NOs: 23-24.
  • the intracellular domain further comprises at least one self-cleaving peptide and at least one cytokine.
  • the cytokine is adjacent and distal to the self-cleaving peptide, such that the cytokine is separated from the polypeptide by the self-cleaving peptide.
  • the transmembrane domain comprises a transmembrane domain of a natural NK cell receptor.
  • the transmembrane domain of the natural NK cell receptor is selected from the group consisting of Natural Killer Group 2D (NKG2D); Natural Killer Cell P46-Related Protein (NKp46); and DNAX Accessory Molecule-1 (DNAM1).
  • NSG2D Natural Killer Group 2D
  • NKp46 Natural Killer Cell P46-Related Protein
  • DNAM1 DNAX Accessory Molecule-1
  • the transmembrane domain comprises a transmembrane domain of CD8.
  • the transmembrane domain comprises the amino acid sequence of one of SEQ ID NOs: 29-32 or 117-118 or an amino acid sequence that is at least 80% identical to one of SEQ ID NOs: 29-32 or 117-118.
  • the extracellular binding domain is an antibody, an antigen-binding fragment thereof, a F(ab) fragment, a F(ab′) fragment, a single chain variable fragment (scFv), or a single-domain antibody (sdAb).
  • the extracellular binding domain comprises a scFv.
  • the extracellular binding domain specifically binds to a tumor-associated antigen.
  • the tumor-associated antigen is CD19.
  • the tumor-associated antigen is CD33.
  • the extracellular binding domain comprises the amino acid sequence of one of SEQ ID NOs: 35-36 or an amino acid sequence that is at least 80% identical to one of SEQ ID NOs: 35-36.
  • the polypeptide further comprises a signal peptide located N-terminal to the extracellular binding domain.
  • the signal peptide is a CD8 signal peptide.
  • the signal peptide comprises the amino acid sequence of SEQ ID NO: 38 or an amino acid sequence that is at least 80% identical to SEQ ID NO: 38.
  • the polypeptide further comprises a detectable marker distal to the extracellular binding domain.
  • the detectable marker is 3 ⁇ FLAG.
  • the detectable marker comprises the amino acid sequence of SEQ ID NO: 40 or an amino acid sequence that is at least 80% identical to SEQ ID NO: 40.
  • the polypeptide further comprises a linker domain distal to the extracellular binding domain and/or proximal to the signal peptide and/or detectable marker.
  • the linker comprises the amino acid sequence of SEQ ID NO: 42 or an amino acid sequence that is at least 80% identical to SEQ ID NO: 42.
  • the polypeptide further comprises a spacer domain located between the extracellular binding domain and the transmembrane domain.
  • the spacer domain comprises a CD8 hinge domain.
  • the spacer comprises the amino acid sequence of SEQ ID NO: 44 or an amino acid sequence that is at least 80% identical to SEQ ID NO: 44.
  • the polypeptide comprises the amino acid sequence of one of SEQ ID NOs: 80-114 or an amino acid sequence that is at least 80% identical to one of SEQ ID NOs: 80-114.
  • a chimeric antigen receptor (CAR) polypeptide for expression in natural killer (NK) cells comprising: (a) an extracellular binding domain; (b) a transmembrane domain; and (c) intracellular domain comprising at least one intracellular signaling domain from a NK cell receptor.
  • CAR chimeric antigen receptor
  • the polypeptide comprises from N-terminus to C-terminus: (a) the extracellular binding domain; (b) the transmembrane domain; and (c) the intracellular domain.
  • the polypeptide comprises from C-terminus to N-terminus: (a) the extracellular binding domain; (b) the transmembrane domain; and (c) the intracellular domain.
  • the NK cell receptor is selected from the group consisting of: 2B4, NTB-A, CRACC, and CD2.
  • the NK cell receptor is 2B4.
  • the NK cell receptor is NTB-A.
  • the NK cell receptor is CRACC.
  • the NK cell receptor is CD2.
  • the intracellular signaling domain from the NK cell receptor comprises the amino acid sequence of one of SEQ ID NOs: 7-10 or an amino acid sequence that is at least 80% identical to one of SEQ ID NOs: 7-10.
  • the transmembrane domain comprises a transmembrane domain of a natural NK cell receptor.
  • the transmembrane domain of the natural NK cell receptor is selected from the group consisting of Natural Killer Group 2D (NKG2D); Natural Killer Cell P46-Related Protein (NKp46); and DNAX Accessory Molecule-1 (DNAM1).
  • NSG2D Natural Killer Group 2D
  • NKp46 Natural Killer Cell P46-Related Protein
  • DNAM1 DNAX Accessory Molecule-1
  • the transmembrane domain comprises the amino acid sequence of one of SEQ ID NOs: 29-31 or 117-118 or an amino acid sequence that is at least 80% identical to one of SEQ ID NOs: 29-31 or 117-118.
  • the extracellular binding domain is an antibody, an antigen-binding fragment thereof, a F(ab) fragment, a F(ab′) fragment, a single chain variable fragment (scFv), or a single-domain antibody (sdAb).
  • the extracellular binding domain comprises an scFv.
  • the extracellular binding domain specifically binds to a tumor-associated antigen.
  • the tumor-associated antigen is CD19.
  • the tumor-associated antigen is CD33.
  • the extracellular binding domain comprises the amino acid sequence of one of SEQ ID NOs: 35-36 or an amino acid sequence that is at least 80% identical to one of SEQ ID NOs: 35-36.
  • the polypeptide further comprises a signal peptide located N-terminal to the extracellular binding domain.
  • the signal peptide is a CD8 signal peptide.
  • the signal peptide comprises the amino acid sequence of SEQ ID NO: 38 or an amino acid sequence that is at least 80% identical to SEQ ID NO: 38.
  • the polypeptide further comprises a detectable marker distal to the extracellular binding domain.
  • the detectable marker is 3 ⁇ FLAG.
  • the detectable marker comprises the amino acid sequence of SEQ ID NO: 40 or an amino acid sequence that is at least 80% identical to SEQ ID NO: 40.
  • the polypeptide further comprises a linker domain distal to the extracellular binding domain and/or proximal to the signal peptide and/or detectable marker.
  • the linker comprises the amino acid sequence of SEQ ID NO: 42 or an amino acid sequence that is at least 80% identical to SEQ ID NO: 42.
  • the polypeptide further comprises a spacer domain located between the extracellular binding domain and the transmembrane domain.
  • the spacer domain comprises a CD8 hinge domain.
  • the spacer comprises the amino acid sequence of SEQ ID NO: 44 or an amino acid sequence that is at least 80% identical to SEQ ID NO: 44.
  • the polypeptide comprises the amino acid sequence of one of SEQ ID NOs: 90-105 or SEQ ID NOs: 110-114 or an amino acid sequence that is at least 80% identical to one of SEQ ID NOs: 90-105 or SEQ ID NOs: 110-114.
  • a chimeric antigen receptor (CAR) polypeptide for expression in natural killer (NK) cells comprising: (a) an extracellular binding domain; (b) a transmembrane domain; and (c) an intracellular domain comprising at least one of the following: (i) an intracellular signaling domain from a NK cell membrane-bound signaling adaptor protein; and/or (ii) an intracellular co-stimulatory domain from a co-stimulatory receptor.
  • CAR chimeric antigen receptor
  • the polypeptide comprises from N-terminus to C-terminus: (a) the extracellular binding domain; (b) the transmembrane domain; and (c) the intracellular domain.
  • the polypeptide comprises from C-terminus to N-terminus: (a) the extracellular binding domain; (b) the transmembrane domain; and (c) the intracellular domain.
  • the NK cell membrane-bound signaling adaptor protein is CD3 ⁇ or Fc ⁇ R1.
  • the intracellular signaling domain from the NK cell membrane-bound signaling adaptor protein comprises the amino acid sequence of one of SEQ ID NOs: 11-12 or an amino acid sequence that is at least 80% identical to one of SEQ ID NOs: 11-12.
  • the co-stimulatory receptor is 4-1BB and/or IL2 receptor beta (IL2RB).
  • the intracellular co-stimulatory domain from the co-stimulatory receptor comprises the amino acid sequence of one of SEQ ID NOs: 15-16 or an amino acid sequence that is at least 80% identical to one of SEQ ID NOs: 15-16.
  • the intracellular domain further comprises at least one self-cleaving peptide.
  • the self-cleaving peptide is T2A, P2A, E2A, or F2A.
  • the self-cleaving peptide comprises the amino acid sequence of one of SEQ ID NOs: 19-20 or an amino acid sequence that is at least 80% identical to one of SEQ ID NOs: 19-20.
  • the intracellular domain further comprises a cytokine.
  • the cytokine is IL-15 or IL-21.
  • the cytokine comprises the amino acid sequence of one of SEQ ID NOs: 23-24 or an amino acid sequence that is at least 80% identical to one of SEQ ID NOs: 23-24.
  • the intracellular domain further comprises at least one self-cleaving peptide and at least one cytokine.
  • the cytokine is adjacent and distal to the self-cleaving peptide, such that the cytokine is separated from the polypeptide by the self-cleaving peptide.
  • the transmembrane domain comprises a transmembrane domain of CD8.
  • the transmembrane domain comprises the amino acid sequence of SEQ ID NO: 32 or an amino acid sequence that is at least 80% identical to SEQ ID NO: 32.
  • the extracellular binding domain is an antibody, an antigen-binding fragment thereof, a F(ab) fragment, a F(ab′) fragment, a single chain variable fragment (scFv), or a single-domain antibody (sdAb).
  • the extracellular binding domain comprises a scFv.
  • the extracellular binding domain specifically binds to a tumor-associated antigen.
  • the tumor-associated antigen is CD19.
  • the tumor-associated antigen is CD33.
  • the extracellular binding domain comprises the amino acid sequence of one of SEQ ID NOs: 35-36 or an amino acid sequence that is at least 80% identical to one of SEQ ID NOs: 35-36.
  • the polypeptide further comprises a signal peptide located N-terminal to the extracellular binding domain.
  • the signal peptide is a CD8 signal peptide.
  • the signal peptide comprises the amino acid sequence of SEQ ID NO: 38 or an amino acid sequence that is at least 80% identical to SEQ ID NO: 38.
  • the polypeptide further comprises a detectable marker distal to the extracellular binding domain.
  • the detectable marker is 3 ⁇ FLAG.
  • the detectable marker comprises the amino acid sequence of SEQ ID NO: 40 or an amino acid sequence that is at least 80% identical to SEQ ID NO: 40.
  • the polypeptide further comprises a linker domain distal to the extracellular binding domain and/or proximal to the signal peptide and/or detectable marker.
  • the linker comprises the amino acid sequence of SEQ ID NO: 42 or an amino acid sequence that is at least 80% identical to SEQ ID NO: 42.
  • the polypeptide further comprises a spacer domain located between the extracellular binding domain and the transmembrane domain.
  • the spacer domain comprises a CD8 hinge domain.
  • the spacer comprises the amino acid sequence of SEQ ID NO: 44 or an amino acid sequence that is at least 80% identical to SEQ ID NO: 44.
  • the polypeptide comprises the amino acid sequence of one of SEQ ID NOs: 80-89 or SEQ ID NOs: 106-109 or an amino acid sequence that is at least 80% identical to one of SEQ ID NOs: 80-89 or SEQ ID NOs: 106-109.
  • polypeptide as described herein is a polynucleotide encoding a polypeptide as described herein.
  • the polynucleotide comprises one of SEQ ID NOs: 45-79, or a nucleic acid sequence that is at least 80% identical to one of SEQ ID NOs: 45-79.
  • a vector comprising a polynucleotide as described herein.
  • the vector comprises a lentiviral vector.
  • a lentivirus comprising a polypeptide as described herein, a polynucleotide as described herein, or a vector as described herein.
  • a cell or population thereof comprising a polypeptide as described herein, a polynucleotide as described herein, a vector as described herein, or a lentivirus as described herein.
  • the cell comprises an immune cell.
  • the immune cell comprises a natural killer (NK) cell.
  • NK natural killer
  • composition comprising a polypeptide as described herein, a polynucleotide as described herein, a vector as described herein, a lentivirus as described herein, or a cell as described herein, and a pharmaceutically acceptable carrier.
  • a method of increasing the activation of an NK cell or population thereof comprising contacting the cell or population thereof with a polypeptide as described herein, a polynucleotide as described herein, a vector as described herein, or a lentivirus as described herein.
  • contacting the NK cell or population thereof with the polypeptide, polynucleotide, vector, or lentivirus increases the activity of the NK cell by at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 100%, at least 200%, at least 300%, at least 400%, or at least 500% compared to prior to contacting with the polypeptide, polynucleotide, vector, or lentivirus.
  • the increased activation of the NK cell or population thereof comprises increased expression of a cytokine or granzyme selected from the group consisting of TNF ⁇ , IFN ⁇ , GM-CSF, and Granzyme B.
  • the increased activation of the NK cell or population thereof results in an increased specific lysis of a target cell.
  • the target cell expresses a surface antigen that binds specifically to the extracellular binding domain of the polypeptide.
  • the target cell is a cancer cell.
  • the target cell is a cell infected by a virus or bacteria.
  • a method of treating a subject in need of a CAR-based therapy comprising administering to the subject a therapeutically effective amount of the CAR-based therapy selected from the group consisting of: a polypeptide as described herein, a polynucleotide as described herein, a vector as described herein, a lentivirus as described herein, a cell or population thereof as described herein, and a pharmaceutical composition as described herein.
  • the subject has cancer or has been diagnosed with cancer.
  • the subject has or has been diagnosed with adrenal cancer, anal cancer, appendix cancer, bile duct cancer, bladder cancer, bone cancer, brain cancer, breast cancer, cervical cancer, colorectal cancer, gallbladder cancer, gestational trophoblastic disease, head and neck cancer, Hodgkin lymphoma, intestinal cancer, kidney cancer, leukemia, liver cancer, lung cancer, melanoma, Merkel cell carcinoma, mesothelioma, multiple myeloma, neuroendocrine tumors, Non-Hodgkin lymphoma, oral cancer, ovarian cancer, pancreatic cancer, prostate cancer, sinus cancer, skin cancer, a sarcoma, a soft tissue sarcoma, spinal cancer, stomach cancer, testicular cancer, throat cancer, a tumor, thyroid cancer, uterine cancer, vaginal cancer or vulvar cancer.
  • the administration of the CAR-based therapy results in increased specific lysis of cancer cells targeted by the CAR.
  • the subject has an infectious disease or has been diagnosed with an infectious disease.
  • the infectious disease is a viral or bacterial disease.
  • the administration of the CAR-based therapy results in increased specific lysis of infected cells targeted by the CAR.
  • a method of making a therapeutic composition comprising introducing a nucleic acid encoding a polypeptide as described herein, a polynucleotide as described herein, a vector as described herein, or a lentivirus as described herein to an NK cell under conditions permitting expression of the polypeptide in the cell.
  • the NK cell prior to introducing the nucleic acid, polynucleotide, vector, or lentivirus, the NK cell is removed from a subject in need of the therapeutic composition.
  • the NK cell after introducing the nucleic acid, polynucleotide, vector, or lentivirus, the NK cell is returned to the subject.
  • FIG. 1 is a line graph showing cytotoxicity of CD19 NK CARs against a CD19 expressing A549 cell line.
  • FIG. 2 is a bar graph showing cytotoxicity of CD19 NK CARs against Raji cell line (Calcein-AM assay).
  • FIG. 3 is a bar graph showing cytotoxicity of CD19 NK CARs against Raji cell line (Calcein-AM assay).
  • FIG. 4 A is a line graph showing cytotoxicity of CD19 NK CARs against Nalm6-GFP-luciferase cell line (Bioluminescence assay).
  • FIG. 4 B is a line graph showing cytotoxicity of NK CARs against Nalm6-GFP-luciferase cell line (Bioluminescence assay).
  • FIG. 5 is a bar graph showing cytotoxicity of CD19 NK CARs against Raji cell line (Calcein-AM assay).
  • FIG. 6 A is a line graph showing cytotoxicity of CD19 NK CARs against Nalm6-GFP-luciferase cell line (Bioluminescence assay).
  • FIG. 6 B is a line graph showing cytotoxicity of NK CARs against Nalm6-GFP-luciferase cell line (Bioluminescence assay).
  • FIG. 7 is a bar graph showing cytotoxicity of CD19 NK CARs against Raji cell line (Calcein-AM assay).
  • FIG. 8 is a line graph showing cytotoxicity of CD19 NK CARs against Nalm6-GFP-luciferase cell line (Bioluminescence assay).
  • FIG. 9 is a bar graph showing cytotoxicity of CD19 NK CARs against Raji cell line (Calcein-AM assay).
  • FIG. 10 is a line graph showing cytotoxicity of CD19 NK CARs against Nalm6-GFP-luciferase cell line (Bioluminescence assay).
  • FIG. 11 is a bar graph showing release of cytokine TNF-alpha by different CD19 NK CAR cells.
  • FIG. 12 is a bar graph showing release of cytokine IFN-gamma by different CD19 NK CAR cells.
  • FIG. 13 is a bar graph showing release of cytokine GM-CSF by different CD19 NK CAR cells.
  • FIG. 14 is a bar graph showing release of Granzyme B by different CD19 NK CAR cells.
  • FIG. 15 is a schematic of Group I and Group II CD19 NK CAR constructs.
  • FIG. 16 is a schematic of Group III and Group IV CD19 NK CAR constructs.
  • FIG. 17 is a schematic of NK CAR constructs.
  • FIG. 18 is a schematic of CD33 NK CAR constructs.
  • FIG. 19 is a bar graph showing cytotoxicity of CD33 NK CARs against a U937 cell line.
  • FIG. 20 A- 20 E is a series of 24 h FACS plots of CD33 NK CAR cells at an effector to target ratio of 1:1.
  • FIG. 21 A- 21 D is a series of 24 h FACS plots of CD33 NK CAR cells at an effector to target ratio of 1:4.
  • FIG. 22 A- 22 E is a series of 48 h FACS plots of CD33 NK CAR cells at an effector to target ratio of 1:1.
  • FIG. 23 A- 23 D is a series of 48 h FACS plots of CD33 NK CAR cells at an effector to target ratio of 1:4.
  • FIG. 24 A is a bar graph summarizing 24 h and 48 h FACS data of CD33 NK CAR cells at an effector to target ratio of 1:1.
  • FIG. 24 B is a bar graph summarizing 24 h and 48 h FACS data of CD33 NK CAR cells at an effector to target ratio of 1:4.
  • This technology relates to Chimeric Antigen Receptor (CAR) constructs that can be expressed in Natural Killer (NK) cells, and their use to engineer or modify NK cells to target cancer cells expressing a given cell surface marker or tumor antigen, or cells infected with a pathogen.
  • CAR constructs designed, for example, to target T cells to cells expressing a given marker or tumor antigen can function to target NK cells to the same target cells, but the efficiency of such activity is poor given the differences in intracellular signaling in NK cells versus T cells.
  • CAR constructs designed for function in NK cells can provide superior results.
  • described herein are CAR constructs that can be used for engineering NK cells to target and kill cells expressing a given cell surface marker or tumor antigen. The following describes the compositions, methods and considerations involved in engineering, preparing and using CAR-NK cells for the treatment of cancer and infectious disease.
  • NK cell CAR polypeptides comprising intracellular signaling domains, intracellular costimulatory domains, and/or transmembrane domains from NK-associated polypeptides.
  • NK Natural Killer
  • polynucleotides, vectors, or cells expressing such NK CAR polypeptides and pharmaceutical compositions comprising such NK CAR polypeptides, polynucleotides, vectors, or cells.
  • methods of using such NK CAR polypeptides for example to treat various diseases and disorders, such as cancer or infectious diseases.
  • NK CAR polypeptides that comprise at least one of the following domains: an extracellular binding domain, a transmembrane domain, an intracellular signaling domain, an intracellular co-stimulatory domain, a detectable marker, a self-cleaving peptide, and/or a cytokine, or any combination thereof.
  • Specific CARs described herein are not to be construed as limitations, but rather exemplifications applying the principles and technology described.
  • NK CAR polypeptides that comprise an extracellular binding domain, a transmembrane domain, and at least one intracellular signaling domain. For example, the following combinations are contemplated herein (see e.g., Table 7):
  • TM indicates transmembrane domain.
  • IS indicates intracellular signaling domain.
  • IC indicates intracellular co-stimulatory domain.
  • DM indicates detectable marker.
  • SP indicates self-cleaving peptide.
  • Cy indicates cytokine.
  • an NK-CAR polypeptide can comprise an extracellular binding domain, a signal peptide, a linker domain, a spacer domain, a transmembrane domain, an intracellular signaling domain, an intracellular co-stimulatory domain, a detectable marker, a self-cleaving peptide, and/or a cytokine, as described further herein.
  • a signal peptide a linker domain, a spacer domain, a transmembrane domain, an intracellular signaling domain, an intracellular co-stimulatory domain, a detectable marker, a self-cleaving peptide, and/or a cytokine, as described further herein.
  • NK CAR polypeptides are described further herein.
  • NK CAR polypeptides comprising at least one intracellular domain.
  • intracellular domains can include, but are not limited to: intracellular signaling domains, intracellular co-stimulatory domains, self-cleaving peptides, cytokines, and detectable markers.
  • An NK CAR polypeptide can comprise any combination of intracellular signaling domains, intracellular co-stimulatory domains, self-cleaving peptides, cytokines, and detectable markers, as exemplified in Table 7.
  • the CAR polypeptide comprises 1, 2, 3, 4, 5, or more intracellular domains, e.g., selected from at least one intracellular signaling domain, at least one intracellular co-stimulatory domain, at least one self-cleaving peptide, at least one cytokine, and/or at least one detectable marker.
  • the CAR polypeptide comprises one intracellular domain.
  • the CAR polypeptide comprises two intracellular domains.
  • the CAR polypeptide comprises three intracellular domains.
  • the CAR polypeptide comprises four intracellular domains.
  • the CAR polypeptide comprises five intracellular domains. In some embodiments of any of the aspects, the CAR polypeptide comprises six intracellular domains. In embodiments comprising multiple intracellular domains, the multiple intracellular domains can be different individual intracellular domains or multiple copies of the same intracellular domain, or a combination of the foregoing.
  • Non-limiting examples of intracellular domains for use in the NK CAR polypeptides described herein include: (a) an intracellular signaling domain from an NK cell receptor; (b) an intracellular signaling domain from an NK cell membrane-bound signaling adaptor protein; and/or (c) an intracellular co-stimulatory domain from a co-stimulatory receptor.
  • the CAR polypeptide comprises: (a) an intracellular signaling domain from an NK cell receptor; (b) an intracellular signaling domain from an NK cell membrane-bound signaling adaptor protein; and (c) an intracellular co-stimulatory domain from a co-stimulatory receptor.
  • the CAR polypeptide comprises: (a) an intracellular signaling domain from an NK cell receptor.
  • the CAR polypeptide comprises: (b) an intracellular signaling domain from an NK cell membrane-bound signaling adaptor protein.
  • the CAR polypeptide comprises: (c) an intracellular co-stimulatory domain from a co-stimulatory receptor.
  • the CAR polypeptide comprises: (a) an intracellular signaling domain from an NK cell receptor; and (b) an intracellular signaling domain from an NK cell membrane-bound signaling adaptor protein. In some embodiments of any of the aspects, the CAR polypeptide comprises: (a) an intracellular signaling domain from an NK cell receptor; and (c) an intracellular co-stimulatory domain from a co-stimulatory receptor. In some embodiments of any of the aspects, the CAR polypeptide comprises: (b) an intracellular signaling domain from an NK cell membrane-bound signaling adaptor protein; and (c) an intracellular co-stimulatory domain from a co-stimulatory receptor.
  • the intracellular signaling domain(s) of the NK CAR polypeptides described herein are responsible for activation of at least one of the normal effector functions of the immune cell in which the CAR has been placed.
  • effector function refers to a specialized function of a cell. Effector function of a natural killer (NK) cell, for example, can be cytolytic activity.
  • intracellular signaling domain refers to the portion of a polypeptide which transduces the effector function signal (e.g., from the extracellular biding domain specifically binding its cognate antigen) and directs the cell to perform a specialized function. While usually the entire intracellular signaling domain can be employed, in many cases it is not necessary to use the entire chain.
  • intracellular signaling domain is thus meant to include any truncated portion of the intracellular signaling domain sufficient to transduce the effector function signal.
  • the CAR polypeptide comprises 1, 2, 3, 4, 5, or more intracellular signaling domains. In some embodiments of any of the aspects, the CAR polypeptide comprises three intracellular signaling domains. In embodiments comprising multiple intracellular signaling domains, the multiple intracellular signaling domains can be different individual intracellular signaling domains or multiple copies of the same intracellular signaling domain, or a combination of the foregoing.
  • the CAR polypeptide comprises an intracellular signaling domain from an NK cell receptor and/or an intracellular signaling domain from an NK cell membrane-bound signaling adaptor protein.
  • the NK cell receptor or NK cell membrane-bound signaling adaptor protein e.g., from which the at least one intracellular signaling domain is derived is selected from the group consisting of.
  • the intracellular signaling domain from the NK cell receptor or from the NK cell membrane-bound signaling adaptor protein comprises an immunoreceptor tyrosine-based activation motif (ITAM), a conserved sequence of four amino acids repeated twice, which can initiate a variety of signaling pathways and subsequently NK cell activation.
  • ITAM immunoreceptor tyrosine-based activation motif
  • the intracellular signaling domain from the NK cell receptor or from the NK cell membrane-bound signaling adaptor protein comprises an immunoreceptor tyrosine-based switch motif (ITSMs), which can lead to activation or inhibition depending on the type of adaptor protein bound.
  • IRSMs immunoreceptor tyrosine-based switch motif
  • the intracellular signaling domain of a CAR polypeptide as described herein comprises one of SEQ ID NOs: 7-12, or an amino acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the sequence of one of SEQ ID NOs: 7-12, that maintains the same functions as one of SEQ ID NOs: 7-12 (e.g., intracellular signaling upon activation of the CAR polypeptide by binding its cognate antigen).
  • SEQ ID NOs: 7-12 or an amino acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the
  • the intracellular signaling domain of a CAR polypeptide as described herein comprises one of SEQ ID NOs: 7-12, or an amino acid sequence that is at least 95% identical to the sequence of one of SEQ ID NOs: 7-12 that maintains the same function.
  • the intracellular signaling domain of a CAR polypeptide as described herein is encoded by a nucleic acid sequence comprising one of SEQ ID NOs: 1-6 or a sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to one of SEQ ID NOs: 1-6 that maintains the same function or a codon-optimized version of one of SEQ ID NOs: 1-6.
  • the intracellular signaling domain of a CAR polypeptide as described herein is encoded by a nucleic acid sequence comprising one of SEQ ID NOs: 1-6 or a sequence that is at least 95% identical to one of SEQ ID NOs: 1-6 that maintains the same function.
  • cytoplasmic signaling sequences within the cytoplasmic signaling portion of the NK CAR polypeptides described herein may be linked to each other in a random or specified order.
  • a short oligo- or polypeptide linker preferably between 2 and 10 amino acids in length may form the linkage.
  • a glycine-serine doublet provides a particularly suitable linker.
  • Chimeric Antigen Receptors for modification of NK cells can include variants and/or domains of naturally occurring NK cell receptors.
  • the NK CAR polypeptide can comprise an intracellular signaling domain from an NK cell receptor.
  • the term “NK cell receptor” refers to a polypeptide, expressed by an NK cell, comprising an extracellular domain that interacts with ligands outside of the cell; an NK cell receptor further comprises a transmembrane domain and at least one intracellular signaling domain, examples of which are described further herein.
  • the NK cell receptor can be an activating receptor, an inhibitory receptor, a chemotactic receptor, an adhesion receptor, or a cytokine receptor, depending on the type of ligand and the type of intracellular signal transduced by the intracellular signaling domain upon binding of the ligand.
  • the NK CAR polypeptide described herein comprises an NK activating cell receptor.
  • Non-limiting examples of NK activating cell receptors or domain(s) thereof that can be adapted or modified for use in a NK CAR polypeptide as described herein include: NKp46, CD16, hNKp30, hNKp44, hNKp80, mNKR-P1C, NKG2D, mNKG2D-S, hKIR-S, mAct Ly49, CD94/NKG2C, CRACC, Ly9, CD84, NTBA, and 2B4; see e.g., Vivier et al. Science 331(6013):44-9 (2011), the content of which is incorporated herein by reference in its entirety.
  • Non-limiting examples of NK activating receptors and their corresponding adaptors are provided in Table 10.
  • an NK CAR polypeptide comprises an intracellular signaling domain of an activating receptor or adaptor protein listed in Table 10.
  • Receptor Adaptor(s) NKp46 CD3 ⁇ , FcR ⁇ CD16 CD3 ⁇ , FcR ⁇ h NKp30 CD3 ⁇ , FcR ⁇ h NKp44 DAP12 h NKp80 — m NKR-P1C FcR ⁇ NKG2D DAP10 m NKG2D-S DAP12 h KIR-S DAP12 m Act. Ly49 DAP12, DAP10 CD94/NKG2C DAP12 CRACC SAP, EAT2 Ly9 SAP CD84 SAP, EAT2 NTBA SAP 2B4 SAP, EAT2, ERT
  • the NK cell receptor or domain(s) thereof that can be adapted or modified for use in a NK CAR polypeptide as described herein is a member of the signaling lymphocyte activation molecule (SLAM) family of immune cell receptors.
  • the SLAM family is closely related to the CD2 family of the immunoglobulin (Ig) superfamily of molecules.
  • Non-limiting examples of SLAM family members include SLAM, CD48, CD229, 2B4, CD84, NTB-A, CRACC, BLAME, and CD2F-10.
  • the NK cell receptor is a member of the CD2 family.
  • the NK cell receptor is selected from the group consisting of: 2B4, NTB-A, CRACC, and CD2.
  • the NK cell receptor or domain(s) thereof that can be adapted or modified for use in a NK CAR polypeptide as described herein is Natural Killer Cell Receptor 2B4.
  • the NK Cell Type I Receptor Protein 2B4 is also referred to interchangeably as CD244, Natural Killer Cell Receptor 2B4 (NKR2B4), Signaling Lymphocytic Activation Molecule Family Member 4 (SLAMF4), NK Cell Activation-Inducing Ligand (NAIL), or Nmrk.
  • 2B4 is a cell surface receptor expressed on natural killer (NK) cells (and some T cells) that mediates non-major histocompatibility complex (MHC) restricted killing.
  • the natural ligand of 2B4 is CD48, which is expressed on hematopoietic cells.
  • the interaction between NK-cell and target cells via the 2B4 receptor modulates NK-cell cytolytic activity.
  • spliced transcript variants encoding different isoforms have been described for the 2B4 gene.
  • the intracellular signaling domain of 2B4 stimulates NK cell cytotoxicity, production of IFN-gamma, and granule exocytosis.
  • SLAM family receptors can comprise immunoreceptor tyrosine-based switch motifs (ITSMs) with the consensus sequence T-X-Y-X-X-[VI], which have overlapping specificity for activating and inhibitory SH2 domain-containing binding partners.
  • ITSMs immunoreceptor tyrosine-based switch motifs
  • the ITSMs can mediate the interaction with the SH2 domain of the adaptor proteins SH2D1A (SAP) and SH2D1B (EAT-2).
  • 2B4 comprises SEQ ID NO: 123 or an amino acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 123, that maintains the same function as SEQ ID NO: 123 (e.g., intracellular signaling in response to extracellular ligand binding; ITSM functionality).
  • SEQ ID NO: 123 or an amino acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 123, that maintains the same function as SEQ ID NO: 123 (e.g., intracellular signaling in response
  • the intracellular signaling domain of an NK-CAR as described herein comprises an intracellular portion of 2B4 (e.g., SEQ ID NO: 123).
  • the intracellular signaling domain comprises SEQ ID NO: 7 (i.e., residues 251-370 of SEQ ID NO: 123) or an amino acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 7 that maintains the same function as SEQ ID NO: 7 (e.g., intracellular signaling in response to extracellular ligand binding; ITSM functionality).
  • the ITSMs of 2B4 include residues 269-274 (ITSM 1), 295-300, (ITSM 2), 315-320 (ITSM 3), and 340-345 (ITSM 4) of SEQ ID NO: 123, with tyrosine phosphorylation sites at residues 271, 297, 317, and 342 of SEQ ID NO: 123.
  • an intracellular signaling domain which comprises a sequence substantially similar (e.g., at least 70% identical) to the intracellular signaling domain of 2B4 (e.g., residues 251-370 of SEQ ID NO: 123; SEQ ID NO: 7), does not comprise mutations in residues 269-274, 295-300, 315-320, or 340-345 of SEQ ID NO: 123, does not comprise mutations in residues 271, 297, 317, or 342 of SEQ ID NO: 123, or comprises tyrosines at residues 271, 297, 317, or 342 of SEQ ID NO: 123.
  • natural killer cell receptor 2B4 isoform 2 precursor [ Homo sapiens ], NCBI Reference Sequence: NP_001160135.1, 370 amino acids (aa); bold text indicates ITSMs and double-underlined text indicates phosphorylation sites.
  • SEQ ID NOs: 1 (polynucleotide) and 7 (amino acid) provide an exemplary 2B4 intracellular signaling domain (e.g., residues 251-370 of 2B4; see e.g., SEQ ID NO: 123 for an exemplary full-length 2B4 polypeptide sequence).
  • the NK cell receptor or domain(s) thereof that can be adapted or modified for use in a NK CAR polypeptide as described herein is CD2-Like Receptor Activating Cytotoxic Cells (CRACC).
  • CRACC is also referred to interchangeably as SLAM family member 7 (SLAMF7), CD319, CS1, Membrane Protein FOAP-12, CD2 Subset 1, Protein 19A, Novel LY9 (Lymphocyte Antigen 9) Like Protein, or 19A24 Protein.
  • SLAMF7 SLAM family member 7
  • CD319, CS1, Membrane Protein FOAP-12 CD2 Subset 1
  • Protein 19A Novel LY9 (Lymphocyte Antigen 9) Like Protein
  • 19A24 Protein CD2-Like Receptor Activating Cytotoxic Cells
  • CRACC is also referred to interchangeably as SLAM family member 7 (SLAMF7), CD319, CS1, Membrane Protein FOAP-12, CD2 Subset 1, Protein 19A, Novel LY9 (L
  • CRACC can associate with the small cytoplasmic adapter proteins, SH2D1A/SAP and/or SH2D1B/EAT-2.
  • CRACC comprises cytoplasmic tyrosine-based motifs, immunoreceptor tyrosine-based switch motifs (ITSMs), which resemble those found in the NK cell receptor 2B4.
  • IRSMs immunoreceptor tyrosine-based switch motifs
  • CRACC comprises SEQ ID NO: 124 or an amino acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 124, that maintains the same function as SEQ ID NO: 124 (e.g., intracellular signaling in response to extracellular ligand binding; ITSM functionality).
  • SEQ ID NO: 124 or an amino acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 124, that maintains the same function as SEQ ID NO: 124 (e.g., intracellular signaling in response
  • the intracellular signaling domain of an NK-CAR as described herein comprises an intracellular portion of CRACC (e.g., SEQ ID NO: 124).
  • the intracellular signaling domain comprises SEQ ID NO: 8 (i.e., residues 248-335 of SEQ ID NO: 124) or an amino acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 8, that maintains the same function as SEQ ID NO: 8 (e.g., intracellular signaling in response to extracellular ligand binding; ITSM functionality).
  • CRACC comprises an ITSM-like motif (e.g., residues 282-287 of SEQ ID NO: 124) and an ITSM (e.g., residues 302-307 of SEQ ID NO: 124), with tyrosine phosphorylation sites at residues 284 and 304 of SEQ ID NO: 124.
  • ITSM-like motif e.g., residues 282-287 of SEQ ID NO: 124
  • ITSM e.g., residues 302-307 of SEQ ID NO: 124
  • an intracellular signaling domain which comprises a sequence substantially similar (e.g., at least 70% identical) to the intracellular signaling domain of CRACC (e.g., residues 248-335 of SEQ ID NO: 124; SEQ ID NO: 8), does not comprise mutations in residues 282-287 or 302-307 of SEQ ID NO: 124, does not comprise mutations in residues 284 or 304 of SEQ ID NO: 124, or comprises tyrosines at residues 284 or 304 of SEQ ID NO: 124.
  • CRACC e.g., residues 248-335 of SEQ ID NO: 124; SEQ ID NO: 8
  • CRACC (SLAM family member 7) isoform a precursor [ Homo sapiens ], NCBI Reference Sequence: NP_067004.3, 335 aa; bold text indicates the ITSM-like motif and ITSM, respectively, and double-underlined text indicates phosphorylation sites.
  • SEQ ID NOs: 8 amino acid
  • an exemplary CRACC intracellular signaling domain e.g., residues 248-335 of CRACC; see e.g., SEQ ID NO: 124 for an exemplary full-length 2B4 polypeptide sequence.
  • the NK cell receptor or domain(s) thereof that can be adapted or modified for use in a NK CAR polypeptide as described herein is Natural Killer-, T- And B-Cell Antigen (NTB-A).
  • NTB-A is also referred to interchangeably as NK-T-B-Ag, SLAM Family Member 6 (SLAMF6), CD352, Ly108, NTBA, KALI, KALIb, or SF2000.
  • SLAMF6 SLAM Family Member 6
  • NTB-A is expressed on NK cells, as well as T and B lymphocytes.
  • NTB-A undergoes tyrosine phosphorylation and associates with the Src homology 2 domain-containing protein (SH2D1A) as well as with SH2 domain-containing phosphatases (SHPs). NTB-A can function as a coreceptor in the process of NK cell activation.
  • SH2D1A Src homology 2 domain-containing protein
  • SHPs SH2 domain-containing phosphatases
  • NTB-A comprises SEQ ID NO: 126 or an amino acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 126, that maintains the same function as SEQ ID NO: 126 (e.g., intracellular signaling in response to extracellular ligand binding; ITSM functionality).
  • SEQ ID NO: 126 or an amino acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 126, that maintains the same function as SEQ ID NO: 126 (e.g., intracellular signaling in
  • the intracellular signaling domain of an NK-CAR as described herein comprises an intracellular portion of NTB-A (e.g., SEQ ID NO: 126).
  • the intracellular signaling domain comprises SEQ ID NO: 10 (i.e., residues 248-331 of SEQ ID NO: 126) or an amino acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 10, that maintains the same function as SEQ ID NO: 10 (e.g., intracellular signaling in response to extracellular ligand binding; ITSM functionality).
  • NTB-A comprises two ITSMs at residues 282-287 and 306-311 of SEQ ID NO: 126, with tyrosine phosphorylation sites at residues 284 and 308 of SEQ ID NO: 126.
  • an intracellular signaling domain which comprises a sequence substantially similar (e.g., at least 70% identical) to the intracellular signaling domain of NTB-A (e.g., residues 248-331 of SEQ ID NO: 126; SEQ ID NO: 10), does not comprise mutations in residues 282-287 or 306-311 of SEQ ID NO: 126, or does not comprise mutations in residues 284 or 308 of SEQ ID NO: 126, or comprises tyrosines at residues 284 or 308 of SEQ ID NO: 126.
  • NTB-A (SLAM family member 6) isoform 2 precursor [ Homo sapiens ], NCBI Reference Sequence: NP_443163.1, 331 aa; bold text indicates the ITSMs, and double-underlined text indicates phosphorylation sites.
  • SEQ ID NOs: 4 (polynucleotide) and 10 (amino acid) provide an exemplary NTB-A intracellular signaling domain (e.g., residues 248-331 of NTB-A; see e.g., SEQ ID NO: 126 for an exemplary full-length NTB-A polypeptide sequence)
  • the NK cell receptor or domain(s) thereof that can be adapted or modified for use in a NK CAR polypeptide as described herein is cluster of differentiation 2 (CD2).
  • CD2 is also referred to interchangeably as Lymphocyte-Function Antigen-2 (LFA-2), P50, Sheep Red Blood Cell Receptor (SRBC), T11, Leu-5, Erythrocyte Receptor, Rosette Receptor, or LFA-3 Receptor.
  • LFA-2 Lymphocyte-Function Antigen-2
  • P50 Sheep Red Blood Cell Receptor
  • SRBC Sheep Red Blood Cell Receptor
  • T11 Leu-5
  • Erythrocyte Receptor Rosette Receptor
  • LFA-3 Receptor LFA-3 Receptor
  • CD2 itself has no enzymatic activity but transmits signals in part via interactions with CD3zeta.
  • CD2 recruits CD16 to the NK cell immunological synapse in spontaneous (e.g., antibody-independent) NK cell cytotoxicity; see e.g., Christian B et al., CD2 Immunobiology. Front Immunol. 2020; 11: 1090, the content of which is incorporated herein by reference in its entirety.
  • CD2 comprises SEQ ID NO: 125 or an amino acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 125, that maintains the same function as SEQ ID NO: 125 (e.g., intracellular signaling in response to extracellular ligand binding).
  • the intracellular signaling domain of an NK-CAR as described herein comprises an intracellular portion of CD2 (e.g., SEQ ID NO: 125).
  • the intracellular signaling domain comprises SEQ ID NO: 9 (i.e., residues 236-251 of SEQ ID NO: 125) or an amino acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 9, that maintains the same function as SEQ ID NO: 9 (e.g., intracellular signaling in response to extracellular ligand binding).
  • SEQ ID NO: 9 i.e., residues 236-251 of SEQ ID NO: 125
  • amino acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to S
  • T-cell surface antigen CD2 isoform 2 precursor [ Homo sapiens ], NCBI Reference Sequence: NP_001758.2, 351 aa SEQ ID NO: 125 MSFPCKFVASFLLIFNVSSKGAVSKEITNALETWGALGQDINLDIPSFQMSDDIDDIKWEKTSDKK KIAQFRKEKETFKEKDTYKLFKNGTLKIKHLKTDDQDIYKVSIYDTKGKNVLEKIFDLKIQERVS KPKISWTCINTTLTCEVMNGTDPELNLYQDGKHLKLSQRVITHKWTTSLSAKFKCTAGNKVSKE SSVEPVSCPEKGLDIYLIIGICGGGSLLMVFVALLVFYITKRKKQRSRRNDEELETRAHRVATEER GRKPHQIPASTPQNPATSQHPPPPPGHRSQAPSHRPPPPGHRVQHQPQKRPPAPSGTQVHQQKGPP LPRPRVQPKPPHGAAENSLSPSSN
  • SEQ ID NOs: 3 polynucleotide
  • 9 amino acid
  • an exemplary CD2 intracellular signaling domain e.g., residues 236-351 of CD2; see e.g., SEQ ID NO: 125 for an exemplary full-length CD2 polypeptide sequence.
  • the CAR polypeptide comprises an intracellular signaling domain from an NK cell membrane-bound signaling adaptor protein.
  • NK cell membrane-bound signaling adaptor protein also referred to interchangeably as an “adaptor protein,” refers to a polypeptide, expressed by an NK cell and associated with the cell membrane, that specifically interacts with an NK cell receptor and transduces the receptor's signal through the adaptor's intracellular signaling domain.
  • the NK CAR polypeptides described herein comprise an intracellular region of an adaptor protein that associates with an NK activating cell receptor, which often does not comprise its own intracellular signaling domain.
  • Non-limiting examples of NK adaptor proteins or domain(s) thereof that can be adapted or modified for use in a NK CAR polypeptide as described herein include CD3zeta, FcR ⁇ (which can comprise Fc ⁇ RI ⁇ ), DAP12, DAP10, SAP, EAT2, and ERT.
  • the NK cell membrane-bound signaling adaptor protein is Fc ⁇ RI (e.g., Fc ⁇ RI ⁇ ) or CD3zeta.
  • the NK cell membrane-bound signaling adaptor protein or domain(s) thereof that can be adapted or modified for use in a NK CAR polypeptide as described herein is high-affinity IgE receptor (Fc ⁇ RI).
  • Fc ⁇ RI is also referred to as Fc epsilon RI.
  • Fc ⁇ RI is the high-affinity receptor for the Fc region of immunoglobulin E (IgE), an antibody isotype involved in allergies and parasite immunity.
  • Fc ⁇ RI is a tetrameric receptor complex, consisting of one alpha (Fc ⁇ RI ⁇ —antibody binding site), one beta (Fc ⁇ RI ⁇ —which amplifies the downstream signal), and two gamma chains (Fc ⁇ RI ⁇ —the site where the downstream signal initiates) connected by two disulfide bridges on mast cells and basophils.
  • the NK cell adaptor protein is Fc ⁇ RI ⁇ , which is also referred to interchangeably as Fc-Epsilon RI-Gamma or FCER1G.
  • Fc ⁇ RI ⁇ can also associate with Fc ⁇ RIIIa (CD16a) to form a low affinity receptor for IgG.
  • Fc ⁇ RI ⁇ comprises SEQ ID NO: 127 or an amino acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 127, that maintains the same function as SEQ ID NO: 127 (e.g., intracellular signaling; ITAM functionality).
  • the intracellular signaling domain of an NK-CAR as described herein comprises an intracellular portion of Fc ⁇ RI ⁇ (e.g., SEQ ID NO: 127).
  • the intracellular signaling domain comprises SEQ ID NO: 12 (i.e., residues 45-86 of SEQ ID NO: 127) or an amino acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 12, that maintains the same function as SEQ ID NO: 12 (e.g., intracellular signaling; ITAM functionality).
  • SEQ ID NO: 12 i.e., residues 45-86 of SEQ ID NO: 12
  • an amino acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 12, that
  • Fc ⁇ RI ⁇ comprises an ITAM at residues 62 to 82 of SEQ ID NO: 127, with tyrosine phosphorylation sites at residues 65 and 76 of SEQ ID NO: 127.
  • an intracellular signaling domain which comprises a sequence substantially similar (e.g., at least 70% identical) to the intracellular signaling domain of Fc ⁇ RI ⁇ (e.g., residues 45-86 of SEQ ID NO: 127; SEQ ID NO: 12), does not comprise mutations in residues 62-82 of SEQ ID NO: 127, does not comprise mutations in residues 65 or 76 of SEQ ID NO: 127, or comprises tyrosines at residues 65 or 76 of SEQ ID NO: 127.
  • SEQ ID NOs: 6 (polynucleotide) and 12 (amino acid) provide an exemplary FceR intracellular signaling domain (e.g., residues 45-86 of FceRI; see e.g., SEQ ID NO: 127 for an exemplary full-length FceRI polypeptide sequence).
  • the NK cell membrane-bound signaling adaptor protein or domain(s) thereof that can be adapted or modified for use in a NK CAR polypeptide as described herein is CD3-zeta (CD3 ⁇ ).
  • CD3-zeta is also referred to interchangeably as CD247, T-Cell Surface Glycoprotein CD3 Zeta Chain, TCRZ, or IMD25.
  • CD3-zeta comprises three ITAMs, which when phosphorylated creates multiple docking sites for the protein kinase ZAP70 leading to ZAP70 phosphorylation and its conversion into a catalytically active enzyme.
  • CD3-zeta can act as an adaptor protein to transduce intracellular signaling for NK activating receptors NKp46, CD16, or hNKp30.
  • CD3-zeta comprises SEQ ID NO: 128 or an amino acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 128, that maintains the same function as SEQ ID NO: 128 (e.g., intracellular signaling; ITAM functionality).
  • the intracellular signaling domain of an NK-CAR as described herein comprises an intracellular portion of CD3-zeta (e.g., SEQ ID NO: 128).
  • the intracellular signaling domain comprises SEQ ID NO: 11 (i.e., residues 52-163 of SEQ ID NO: 128) or an amino acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 11, that maintains the same function as SEQ ID NO: 11 (e.g., intracellular signaling; ITAM functionality).
  • SEQ ID NO: 11 i.e., residues 52-163 of SEQ ID NO: 1278 or an amino acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 11, that
  • CD3-zeta comprises ITAMs at residues 69-89, 107-127, and 138-158 of SEQ ID NO: 128, with tyrosine or serine/threonine phosphorylation sites at residues 72, 83, 110, 122, 141, and 152 of SEQ ID NO: 128.
  • an intracellular signaling domain which comprises a sequence substantially similar (e.g., at least 70% identical) to the intracellular signaling domain of CD3-zeta (e.g., residues 52-163 of SEQ ID NO: 128; SEQ ID NO: 11), does not comprise mutations in residues 69-89, 107-127, or 138-158 of SEQ ID NO: 128, or does not comprise mutations in residues 72, 83, 110, 122, 141, or 152 of SEQ ID NO: 128, or comprises tyrosines at residues 72, 83, 110, 122, 141, or 152 of SEQ ID NO: 128.
  • glutamine-65 (bold-italicized) in SEQ ID NO: 128 can be changed to lysine-65.
  • SEQ ID NOs: 5 polynucleotide
  • 11 amino acid
  • an exemplary CD3z intracellular signaling domain e.g., residues 52-163 of CD3z; see e.g., SEQ ID NO: 128 for an exemplary full-length CD3z polypeptide sequence.
  • the term “co-stimulatory receptor” refers to a polypeptide, expressed by an NK cell, comprising an extracellular domain that interacts with a co-stimulatory ligand outside of the cell; the co-stimulatory receptor typically further comprises a transmembrane domain and intracellular signaling domains, examples of which are described further herein.
  • the NK cell can be fully activated once signals are transduced by both the activating receptor and the co-stimulatory receptor, each of which optionally transduces its signal through an adaptor protein.
  • the co-stimulatory receptor or domain(s) thereof that can be adapted or modified for use in a NK CAR polypeptide as described herein is 4-1BB and/or IL2 receptor beta (IL2RB).
  • the CAR polypeptide comprises the co-stimulatory domain of 4-1BB.
  • the CAR polypeptide comprises the co-stimulatory domain of IL-2RB.
  • the CAR polypeptide comprises the co-stimulatory domains of 4-1BB and IL-2RB.
  • the CAR polypeptide comprises 1, 2, 3, 4, 5, or more co-stimulatory domains. In some embodiments of any of the aspects, the CAR polypeptide comprises three co-stimulatory domains. In embodiments comprising multiple co-stimulatory domains, the multiple co-stimulatory domains can be different individual co-stimulatory domains or multiple copies of the same co-stimulatory domain, or a combination of the foregoing.
  • the co-stimulatory domain of a CAR polypeptide as described herein comprises one of SEQ ID NOs: 15-16, or an amino acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the sequence of one of SEQ ID NO: 15-16, that maintains the same functions as SEQ ID NOs: 15-16 (e.g., co-stimulation).
  • the co-stimulatory domain of a CAR polypeptide as described herein is encoded by a nucleic acid sequence comprising one of SEQ ID NOs: 13-14, or a sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to one of SEQ ID NOs: 13-14 that maintains the same function or a codon-optimized version of one of SEQ ID NOs: 13-14.
  • the co-stimulatory receptor or domain(s) thereof that can be adapted or modified for use in a NK CAR polypeptide as described herein is 4-1BB.
  • 4-1BB is also referred to interchangeably as CD137, tumor necrosis factor receptor superfamily member 9 (TNFRSF9), or Induced by Lymphocyte Activation (ILA).
  • TRAF adaptor proteins have been shown to bind to 4-1BB and transduce the signals leading to activation of NF-kappaB.
  • 4-1BB expression on human NK cells associates with phenotypic markers of activation and proinflammatory cytokine secretion.
  • the cytoplasmic domain of 4-1BB has been shown to interact with a leucine-rich repeat (LRR)-containing protein, (LRR-1), with LRR-1 acting as a negative regulator of 4-1BB.
  • LRR leucine-rich repeat
  • 4-1BB comprises SEQ ID NO: 129 or an amino acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 129, that maintains the same function as SEQ ID NO: 129 (e.g., co-stimulation).
  • the co-stimulatory domain of an NK-CAR as described herein comprises an intracellular portion of 4-1BB (e.g., SEQ ID NO: 129).
  • the co-stimulatory domain comprises SEQ ID NO: 15 (i.e., residues 214-255 of SEQ ID NO: 129) or an amino acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 15 that maintains the same function as SEQ ID NO: 15 (e.g., co-stimulation).
  • 4-1BB tumor necrosis factor receptor superfamily member 9 precursor
  • Homo sapiens NCBI Reference Sequence: NP_001552.2, 255 aa.
  • SEQ ID NOs: 13 (polynucleotide) and 15 (amino acid) provide an exemplary 4-1BB intracellular co-stimulatory domain (e.g., residues 214-255 of 4-1BB; see e.g., SEQ ID NO: 129 for an exemplary full-length 4-1BB polypeptide sequence).
  • the co-stimulatory receptor or domain(s) thereof that can be adapted or modified for use in a NK CAR polypeptide as described herein is Interleukin 2 Receptor Subunit Beta (IL-2RB).
  • IL-2RB is also referred to interchangeably as CD122, Interleukin-15 Receptor Subunit Beta, P75, or IMD63.
  • the interleukin 2 receptor is present in three forms with respect to ability to bind interleukin 2.
  • the low affinity form is a monomer of the alpha subunit and is not involved in signal transduction.
  • the intermediate affinity form consists of an alpha/beta subunit heterodimer, while the high affinity form consists of an alpha/beta/gamma subunit heterotrimer. Both the intermediate and high affinity forms of the receptor are involved in receptor-mediated endocytosis and transduction of mitogenic signals from interleukin 2. IL-2 can enhance NK cell responses toward infection in vivo and can activate NK cells in vitro.
  • IL-2RB comprises SEQ ID NO: 130 or an amino acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 130, that maintains the same function as SEQ ID NO: 130 (e.g., co-stimulation).
  • the co-stimulatory domain of an NK-CAR as described herein comprises an intracellular portion of IL-2RB (e.g., SEQ ID NO: 130).
  • the intracellular signaling domain comprises SEQ ID NO: 16 (i.e., residues 266-337 and 530-551 of SEQ ID NO: 130) or an amino acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 16 that maintains the same function as SEQ ID NO: 16 (e.g., co-stimulation).
  • SEQ ID NO: 16 i.e., residues 266-337 and 530-551 of SEQ ID NO: 130
  • an amino acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to
  • interleukin-2 receptor subunit beta precursor [ Homo sapiens ], NCBI Reference Sequence: NP_000869.1, 551 aa.
  • SEQ ID NO: 130 MAAPALSWRLPLLILLLPLATSWASAAVNGTSQFTCFYNSRANISCVWSQ DGALQDTSCQVHAWPDRRRWNQTCELLPVSQASWACNLILGAPDSQKLTT VDIVTLRVLCREGVRWRVMAIQDFKPFENLRLMAPISLQVVHVETHRCNI SWEISQASHYFERHLEFEARTLSPGHTWEEAPLLTLKQKQEWICLETLTP DTQYEFQVRVKPLQGEFTTWSPWSQPLAFRTKPAALGKDTIPWLGHLLVG LSGAFGFIILVYLLINCRNTGPWLKKVLKCNTPDPSKFFSQLSSEHGGDV QKWLSSPFPSSSFSPGGLAPEISPLEVLERDKVTQLLLQDKVPEPASLS SNHSLTSCF
  • SEQ ID NOs: 14 (polynucleotide) and 16 (amino acid) provide an exemplary IL-2RB intracellular co-stimulatory domain (e.g., residues 266-337 and 530-551 of IL-2RB; see e.g., SEQ ID NO: 130 for an exemplary full-length IL-2B polypeptide sequence).
  • NK CAR polypeptides comprising a self-cleaving peptide.
  • self-cleaving peptide refers to a short amino acid sequence (e.g., approximately 18-22 aa) that can catalyze its own cleavage.
  • a CAR polypeptide as described herein comprises intracellular signaling domain(s) and/or co-stimulatory domain(s) that are physically linked to another polypeptide (e.g., a cytokine) through a self-cleaving peptide domain.
  • the self-cleaving peptide allows the nucleic acids of a first polypeptide (e.g., an NK CAR) and a second polypeptide (and/or third polypeptide, etc.; e.g., at least one cytokine) to be present in the same vector, but after translation the self-cleaving peptide cleaves the translated polypeptide into the multiple separate polypeptides.
  • a first polypeptide e.g., an NK CAR
  • second polypeptide and/or third polypeptide, etc.; e.g., at least one cytokine
  • a CAR polypeptide as described herein comprises 1, 2, 3, 4, 5, or more self-cleaving peptides.
  • the CAR polypeptide or system comprises one self-cleaving peptide, e.g., in between a first polypeptide and a second polypeptide.
  • the CAR polypeptide or system comprises two self-cleaving peptides, e.g., in between a first polypeptide and a second polypeptide, and in between a second polypeptide and a third polypeptide.
  • the multiple self-cleaving peptides can be different individual self-cleaving peptides or multiple copies of the same self-cleaving peptide, or a combination of the foregoing.
  • the self-cleaving peptide belongs to the 2A peptide family.
  • 2A peptides include P2A, E2A, F2A and T2A (see e.g., Table 8).
  • F2A is derived from foot-and-mouth disease virus 18;
  • E2A is derived from equine rhinitis A virus;
  • P2A is derived from porcine teschovirus-1 2A;
  • T2A is derived from thosea asigna virus 2A.
  • the N-terminal end of the 2A peptide comprises the sequence “GSG” (Gly-Ser-Gly).
  • the N-terminal end of the 2A peptide does not comprise the sequence “GSG” (Gly-Ser-Gly).
  • the 2A-peptide-mediated cleavage commences after protein translation. The cleavage is triggered by breaking of peptide bond between the Proline (P) and Glycine (G) in the C-terminal region of the 2A peptide.
  • the molecular mechanism of 2A-peptide-mediated cleavage involves ribosomal “skipping” of glycyl-prolyl peptide bond formation rather than true proteolytic cleavage.
  • Different 2A peptides have different efficiencies of self-cleaving, with P2A being the most efficient and F2A the least efficient. Therefore, up to 50% of F2A-linked proteins can remain in the cell as a fusion protein.
  • the self-cleaving peptide of a CAR polypeptide as described herein comprises one of SEQ ID NOs: 19-20, 132-134, or an amino acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the sequence of one of SEQ ID NOs: 19-20, 132-134, that maintains the same functions as one of SEQ ID NOs: 19-20, 132-134 (e.g., self-cleavage).
  • the self-cleaving peptide of a CAR polypeptide as described herein is encoded by a nucleic acid sequence comprising one of SEQ ID NOs: 17, 18, or a nucleic acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to one of SEQ ID NOs: 17 or 18 that maintains the same function or a codon-optimized version of one of SEQ ID NOs: 17 or 18.
  • P2A SEQ ID NO: 17 GGCAGCGGCGCCACCAACTTCTCTTTACTGAAGCAAGCTGGCGACGTGGA GGAGAATCCCGGTCCC, T2A SEQ ID NO: 18 GGCAGCGGAAGAGCCGAGGGAAGAGGCTCTTTACTGACTTGTGGCGACGT GGAAGAGAATCCCGGCCCC,
  • NK CAR polypeptides comprising at least one cytokine.
  • cytokine refers to a small protein that mediates and/or regulates a biological or cellular function or process (e.g. immunity, inflammation, and hematopoiesis).
  • the term “cytokine” as used herein includes “lymphokines,” “chemokines,” “monokines,” and “interleukins”. Examples of cytokines that modulate NK cell functions include, but are not limited to, IL-10, IL-12, IL-15, IL-18, IL-21, IFN- ⁇ , GM-CSF, TGF- ⁇ , TNF- ⁇ , and IFN- ⁇ .
  • cytokine as used herein is meant to also include cytokine variants comprising one or more amino acid mutations in the amino acid sequences of the corresponding wild-type cytokine.
  • the at least one cytokine is linked to the NK CAR polypeptide using at least one self-cleaving peptide as described herein. Any combination of self-cleaving peptide and cytokine can be used. Use of a self-cleaving peptide allows the cytokine to be cleaved from the end of the NK CAR polypeptide. If the cytokine comprises a signal peptide, then the cytokine can be secreted from the cell, to act on the cell that secreted it or on nearby cells.
  • a CAR polypeptide as described herein comprises 1, 2, 3, 4, 5, or more cytokines. In some embodiments of any of the aspects, the CAR polypeptide or system comprises one cytokine. In some embodiments of any of the aspects, the CAR polypeptide or system comprises two cytokines. In embodiments comprising multiple cytokines, the multiple cytokines can be different individual cytokines or multiple copies of the same cytokine, or a combination of the foregoing.
  • the intracellular domain of the NK CAR comprises at least one self-cleaving peptide and at least one cytokine. In some embodiments of any of the aspects, the intracellular domain of the NK CAR comprises one self-cleaving peptide and one cytokine. In some embodiments of any of the aspects, the cytokine is adjacent and distal to (i.e., farther from the transmembrane domain compared to) the self-cleaving peptide, such that the cytokine is separated from the polypeptide by the self-cleaving peptide. In some embodiments of any of the aspects, the intracellular domain of the NK CAR comprises two self-cleaving peptides and two cytokines.
  • the first self-cleaving peptide is adjacent and proximal to (i.e., closer to the transmembrane domain compared to) the first cytokine
  • the second self-cleaving peptide is adjacent and in between the first and second cytokines, such that both cytokines are separated from the polypeptide by the self-cleaving peptides.
  • the NK CAR polypeptide comprises IL-15 or IL-21. In some embodiments of any of the aspects, the NK CAR polypeptide comprises IL-15. In some embodiments of any of the aspects, the NK CAR polypeptide comprises IL-21. In some embodiments of any of the aspects, the NK CAR polypeptide comprises IL-15 and IL-21. IL-15 is constitutively expressed by a large number of cell types and tissues, including monocytes, macrophages, dendritic cells (DC), keratinocytes, fibroblasts, myocytes, and nerve cells.
  • DC dendritic cells
  • IL-15 binds to and signals through a complex composed of IL-2/IL-15 receptor beta chain (CD122) and the common gamma chain (gamma-C, CD132). IL-15 induces the proliferation of natural killer cells.
  • Interleukin-21 IL-21
  • IL-21 is naturally expressed by activated human CD4+ T cells, T follicular cells, and NK T cells.
  • the IL-21 receptor IL-21R
  • IL-21 induces cell division/proliferation in NK cells and cytotoxic T cells.
  • inclusion of IL-15 and/or IL-21 can increase the proliferation of an NK cell expressing an NK CAR comprising a cytokine, or a nearby NK cell.
  • the cytokine of a CAR polypeptide as described herein comprises one of SEQ ID NOs: 23, 24, or an amino acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the sequence of one of SEQ ID NOs: 23 or 24, that maintains the same functions as one of SEQ ID NOs: 23 or 24 (e.g., promoting NK cell proliferation).
  • the cytokine of a CAR polypeptide as described herein is encoded by a nucleic acid sequence comprising one of SEQ ID NOs: 21, 22, or a nucleic acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to one of SEQ ID NOs: 21 or 22 that maintains the same function or a codon-optimized version of one of SEQ ID NOs: 21 or 22.
  • SEQ ID NOs: 21 and 23 provide polynucleotide and amino acid sequences for an exemplary IL-15 cytokine (e.g., isoform 1; see e.g., interleukin-15 isoform 1 preproprotein [ Homo sapiens ], NCBI Reference Sequence: NP_000576.1, 162 aa).
  • IL-15 cytokine e.g., isoform 1; see e.g., interleukin-15 isoform 1 preproprotein [ Homo sapiens ], NCBI Reference Sequence: NP_000576.1, 162 aa.
  • SEQ ID NOs: 22 and 24 provide polynucleotide and amino acid sequences for an exemplary IL-21 cytokine (e.g., isoform 1; e.g., residues 8-162 of IL-21 (155 aa); see e.g., interleukin-21 isoform 1 precursor [ Homo sapiens ], NCBI Reference Sequence: NP_068575.1, 162 aa).
  • IL-21 cytokine e.g., isoform 1; e.g., residues 8-162 of IL-21 (155 aa); see e.g., interleukin-21 isoform 1 precursor [ Homo sapiens ], NCBI Reference Sequence: NP_068575.1, 162 aa).
  • NK CAR polypeptides comprising a transmembrane domain.
  • the CAR can be designed to comprise a transmembrane domain that is fused to the extracellular binding domain and/or the intracellular domain of the CAR.
  • the CAR polypeptide comprises 1, 2, 3, 4, 5, or more transmembrane domains.
  • each CAR polypeptide comprises one transmembrane domain.
  • the multiple transmembrane domains can be different individual transmembrane domains or multiple copies of the same transmembrane domain, or a combination of the foregoing.
  • the transmembrane domain can be derived either from a natural or from a synthetic source. Where the source is natural, the domain can be derived from any membrane-bound or transmembrane protein.
  • the CAR polypeptide described herein comprises at least the transmembrane region(s) of a transmembrane protein selected from the group consisting of: NKG2D, NKp46, DNAM, CD8, the alpha or beta or zeta chain of the T-cell receptor, CD28, CD23zeta, CD28, 4-1BB, CD3 epsilon, CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137, and CD154.
  • an NK CAR polypeptide comprises a transmembrane domain of an activating receptor listed in Table 10.
  • the transmembrane domain can be synthetic, in which case it will comprise predominantly hydrophobic residues such as leucine and valine.
  • a triplet of phenylalanine, tryptophan and valine will be found at each end of a synthetic transmembrane domain.
  • a short oligo- or polypeptide linker preferably between 2 and 10 amino acids in length may form the linkage between the transmembrane domain and the intracellular signaling domain of the CAR.
  • a glycine-serine doublet provides a particularly suitable linker.
  • the NK CAR comprises the transmembrane domain from the group consisting of Natural Killer Group 2D (NKG2D); Natural Killer Cell P46-Related Protein (NKp46); DNAX Accessory Molecule-1 (DNAM1); and CD8.
  • the transmembrane domain comprises a transmembrane domain of a natural NK cell receptor.
  • the transmembrane domain of the natural NK cell receptor is selected from the group consisting of Natural Killer Group 2D (NKG2D); Natural Killer Cell P46-Related Protein (NKp46); and DNAX Accessory Molecule-1 (DNAM1).
  • the transmembrane domain comprises a transmembrane domain of CD8. In some embodiments of any of the aspects, the transmembrane domain further comprises a portion of the adjacent intracellular domain from the same NK cell receptor. As a non-limiting example, the NKp46 or DNAM1 transmembrane domains further comprise a portion of the adjacent intracellular domain from NKP46 or DNAM1, respectively. Inclusion of the intracellular domain can increase the signaling of the NK CAR since such receptors can activate NK cells by signaling through their own cytoplasmic tail. See e.g., Bryceson et al., 2006, Blood 107: 159-166. In some embodiments of any of the aspects, the transmembrane domain can be selected or modified by amino acid substitution to avoid binding of such domains to the transmembrane domains of the same or different surface membrane proteins to minimize interactions with other members of the receptor complex.
  • the transmembrane domain of a CAR polypeptide as described herein comprises one of SEQ ID NOs: 29-32 or 117-118, or an amino acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the sequence of one of SEQ ID NO: 29-32 or 117-118, that maintains the same functions as SEQ ID NOs: 29-32 or 117-118 (e.g., localizes to the cell membrane).
  • the transmembrane domain of a CAR polypeptide as described herein is encoded by a nucleic acid sequence comprising one of SEQ ID NOs: 25-28 or 115-116, or a sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to one of SEQ ID NOs: 25-28 or 115-116 that maintains the same function, or a codon-optimized version of one of SEQ ID NOs: 25-28 or 115-116.
  • the transmembrane domain of a CAR polypeptide as described herein further comprises an intracellular signaling domain from the same protein as the transmembrane domain, and comprises one of SEQ ID NOs: 30-31, or an amino acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the sequence of one of SEQ ID NO: 30-31, that maintains the same functions as SEQ ID NOs: 30-31 (e.g., localizes to the cell membrane and/or intracellular signaling).
  • the transmembrane domain of a CAR polypeptide as described herein is encoded by a nucleic acid sequence further comprising an intracellular signaling domain from the same protein as the transmembrane domain, and comprising one of SEQ ID NOs: 26-27, or a sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to one of SEQ ID NOs: 26-27 that maintains the same function, or a codon-optimized version of one of SEQ ID NOs: 26-27.
  • the transmembrane domain of a CAR polypeptide as described herein does not further comprise an intracellular signaling domain from the same protein as the transmembrane domain, and comprises one of SEQ ID NOs: 29, 32, 117, 118, or an amino acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the sequence of one of SEQ ID NO: 29 or 32 or 117-118, that maintains the same functions as SEQ ID NOs: 29, 32, 117, or 118 (e.g., localizes to the cell membrane).
  • the transmembrane domain of a CAR polypeptide as described herein is encoded by a nucleic acid sequence that does not further comprise an intracellular signaling domain from the same protein as the transmembrane domain, and comprises one of SEQ ID NOs: 25, 28, 115, 116, or a sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to one of SEQ ID NOs: 25, 28, 115, or 116 that maintains the same function, or a codon-optimized version of one of SEQ ID NOs: 25, 28, 115, or 116.
  • the NK CAR polypeptide comprises at least the transmembrane domain of the NK cell receptor NKG2D.
  • NKG2D is also referred to interchangeably as CD314, Killer Cell Lectin-Like Receptor Subfamily K Member 1 (KLRK1), NK Cell Receptor D, or D12S2489E.
  • KLRK1 Killer Cell Lectin-Like Receptor Subfamily K Member 1
  • NK Cell Receptor D or D12S2489E.
  • NKG2D is a transmembrane protein belonging to the NKG2 family of C-type lectin-like receptors. NKG2D is characterized by a type II membrane orientation (has an extracellular C terminus) and the presence of a C-type lectin domain.
  • NKG2D is an activating NK receptor that signals through the adaptor protein DAP10.
  • NKG2D comprises SEQ ID NO: 135 or an amino acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 135, that maintains the same function as SEQ ID NO: 135 (e.g., localizes to the cell membrane and/or intracellular signaling).
  • an NK-CAR as described herein comprises a transmembrane domain of NKG2D (e.g., SEQ ID NO: 135).
  • the transmembrane domain comprises SEQ ID NO: 29 (i.e., residues 52-72 of SEQ ID NO: 135) or an amino acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 29, that maintains the same function as SEQ ID NO: 29 (e.g., localizes to the cell membrane).
  • NKG2-D type II integral membrane protein UniProtKB - P26718 (NKG2D_HUMAN), 216 aa SEQ ID NO: 135 MGWIRGRRSRHSWEMSEFHNYNLDLKKSDFSTRWQKQRCPVVKSKCRENA SPFFFCCFIAVAMGIRFIIMVAIWSAVFLNSLFNQEVQIPLTESYCGPCP KNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVK SYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYI ENCSTPNTYICMQRTV,
  • SEQ ID NOs: 25 and 29 provide polynucleotide and amino acid sequences for an exemplary NKG2D transmembrane domain (e.g., residues 52-72 of NKG2D; see e.g., SEQ ID NO: 135 for an exemplary full-length NKG2D polypeptide sequence).
  • the NK CAR polypeptide comprises at least the transmembrane domain of the NK cell receptor NKp46.
  • NKp46 is also referred to interchangeably as Natural Cytotoxicity Triggering Receptor 1 (NCR1), CD335, and Lymphocyte Antigen 94 Homolog (LY94).
  • NCR1 Natural Cytotoxicity Triggering Receptor 1
  • CD335 CD335, CD335, and Lymphocyte Antigen 94 Homolog
  • NKp46 is a 46 kDa type I membrane glycoprotein that is expressed on resting and activated NK cells. Its extracellular region contains two C2-type, Ig-like domains. The transmembrane domain contains a positively charged amino acid (Arg) which could be involved in stabilizing its association with CD3 ⁇ .
  • Arg positively charged amino acid
  • NCR natural cytotoxicity receptors
  • Nkp46 comprises SEQ ID NO: 136 or an amino acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 136, that maintains the same function as SEQ ID NO: 136 (e.g., localizes to the cell membrane and/or intracellular signaling).
  • an NK-CAR as described herein comprises a transmembrane domain of NKp46 (e.g., SEQ ID NO: 136).
  • the transmembrane domain comprises SEQ ID NO: 117 (i.e., residues 259-279 of SEQ ID NO: 136) or an amino acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 117, that maintains the same function as SEQ ID NO: 117 (e.g., localizes to the cell membrane).
  • SEQ ID NO: 117 i.e., residues 259-279 of SEQ ID NO: 1366
  • amino acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to
  • an NK-CAR as described herein comprises a transmembrane domain of NKp46 and an intracellular signaling domain of NKp46 (e.g., SEQ ID NO: 136).
  • the transmembrane and intracellular signaling domains comprises SEQ ID NO: 30 (i.e., residues 259-304 of SEQ ID NO: 136) or an amino acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 30, that maintains the same function as SEQ ID NO: 30 (e.g., localizes to the cell membrane and/or intracellular signaling).
  • an NK-CAR as described herein comprises an intracellular signaling domain of NKp46 (e.g., SEQ ID NO: 136).
  • the intracellular signaling domain comprises residues 280-304 of SEQ ID NO: 136 or an amino acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to a sequence comprising residues 280-304 of SEQ ID NO: 136, that maintains the same function as residues 280-304 of SEQ ID NO: 136 (e.g., intracellular signaling).
  • SEQ ID NOs: 26 and 30 provide polynucleotide and amino acid sequences for an exemplary NKp46 transmembrane and intracellular domain (e.g., residues 259-304 of NKp46; see e.g., SEQ ID NO: 136 for an exemplary full-length NKp46 polypeptide sequence).
  • NKp46 e.g., residues 259-279 of SEQ ID NO: 136; nucleotides (nt) 1-63 of SEQ ID NO: 26; SEQ ID NO: 115); unformatted text indicates sequence encoding the intracellular signaling domain of NKp46 (see e.g., residues 280-304 of SEQ ID NO: 136).
  • SEQ ID NO: 26 ATGGGACTGGCCTTTCTGGTGCTGGTGGCTCTGGTGTGGTTTCTGGTGGA GGACTGGCTGAGC AGAAAGAGGACCAGAGAGAGCCAGCAGAGCCAGCA CATGGGAGGGCAGAAGGAGACTGAACACCCAGACCCTG;
  • SEQ ID NO: 30 bolded text indicates an exemplary transmembrane region of NKp46 (see e.g., residues 259-279 of SEQ ID NO: 136; amino acids (aa) 1-21 of SEQ ID NO: 30; SEQ ID NO: 117); unformatted text indicates the intracellular signaling domain of NKp46 (see e.g., residues 280-304 of SEQ ID NO: 136).
  • SEQ ID NOs: 115 and 117 provide polynucleotide and amino acid sequences for an exemplary NKp46 transmembrane domain (e.g., residues 259-279 of NKp46).
  • the NK CAR polypeptide comprises at least the transmembrane domain of the NK cell receptor DNAM1.
  • DNAM1 is also referred to interchangeably as DNAX Accessory Molecule-1, CD226, T Lineage-Specific Activation Antigen 1 Antigen (TLiSA1), or Platelet And T Cell Activation Antigen 1 (PTA1).
  • DNAM1 is a glycoprotein expressed on the surface of NK cells, platelets, monocytes and a subset of T cells. It is a member of the Ig-superfamily containing 2 Ig-like domains of the V-set.
  • DNAM1 is involved in intercellular adhesion, lymphocyte signaling, cytotoxicity and lymphokine secretion mediated by cytotoxic T-lymphocyte (CTL) and NK cells.
  • CTL cytotoxic T-lymphocyte
  • DNAM-1 is associated with LFA-1 in NK cells, is phosphorylated by a PKC, and binds to CD155 and CD112. Antibodies to DNAM-1 inhibit NK-cell cytotoxicity toward tumor cells.
  • DNAM1 comprises SEQ ID NO: 137 or an amino acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 137, that maintains the same function as SEQ ID NO: 137 (e.g., localizes to the cell membrane and/or intracellular signaling).
  • an NK-CAR as described herein comprises a transmembrane domain of DNAM1 (e.g., SEQ ID NO: 137).
  • the transmembrane domain comprises SEQ ID NO: 118 (i.e., residues 255-275 of SEQ ID NO: 137) or an amino acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 118, that maintains the same function as SEQ ID NO: 118 (e.g., localizes to the cell membrane).
  • SEQ ID NO: 118 i.e., residues 255-275 of SEQ ID NO: 137
  • amino acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to S
  • an NK-CAR as described herein comprises a transmembrane domain of DNAM1 and an intracellular signaling domain of DNAM1 (e.g., SEQ ID NO: 137).
  • the transmembrane and intracellular signaling domains comprise SEQ ID NO: 31 (i.e., residues 255-336 of SEQ ID NO: 137) or an amino acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 31, that maintains the same function as SEQ ID NO: 31 (e.g., localizes to the cell membrane and/or intracellular signaling).
  • an NK-CAR as described herein comprises an intracellular signaling domain of DNAM1 (e.g., SEQ ID NO: 136).
  • the intracellular signaling domain comprises residues 276-336 of SEQ ID NO: 137 or an amino acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to a sequence comprising residues 276-336 of SEQ ID NO: 137, that maintains the same function as residues 276-336 of SEQ ID NO: 137 (e.g., intracellular signaling).
  • SEQ ID NOs: 27 and 31 provide polynucleotide and amino acid sequences for an exemplary DNAM1 transmembrane and intracellular domain (e.g., residues 255-336 of DNAM1; see e.g., SEQ ID NO: 137 for an exemplary full-length DNAM1 polypeptide sequence).
  • SEQ ID NOs: 116 and 118 provide polynucleotide and amino acid sequences for an exemplary DNAM1 transmembrane domain (e.g., residues 255-275 of SEQ ID NO: 137); unformatted text indicates the intracellular signaling domain of DNAM1 (see e.g., residues 276-336 of SEQ ID NO: 137).
  • the NK CAR polypeptide comprises at least the transmembrane domain of CD8.
  • CD8 forms a dimer, consisting of a pair of CD8 chains. The most common form of CD8 is composed of a CD8- ⁇ and CD8- ⁇ chain.
  • the NK CAR polypeptide comprises at least the transmembrane domain of CD8alpha.
  • CD8alpha is also referred to interchangeably as CD8a, T-Lymphocyte Differentiation Antigen T8/Leu-2, or MAL.
  • CD8 plays a role in T cell signaling and aiding with cytotoxic T cell antigen interactions. CD8 is predominantly expressed on the surface of cytotoxic T cells, but can also be found on natural killer cells, cortical thymocytes, and dendritic cells.
  • CD8 comprises SEQ ID NO: 138 or an amino acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 138, that maintains the same function as SEQ ID NO: 138 (e.g., localizes to the cell membrane and/or intracellular signaling).
  • an NK-CAR as described herein comprises a transmembrane domain of CD8 (e.g., SEQ ID NO: 138).
  • the transmembrane domain comprises SEQ ID NO: 32 (i.e., residues 183-206 of SEQ ID NO: 138) or an amino acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 32, that maintains the same function as SEQ ID NO: 32 (e.g., localizes to the cell membrane).
  • SEQ ID NO: 32 i.e., residues 183-206 of SEQ ID NO: 138
  • an amino acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO
  • SEQ ID NO: 138 T-cell surface glycoprotein CD8 alpha chain, UniProtKB-P01732 (CD8A_HUMAN), 235 aa MALPVTALLLPLALLLHAARPSQFRVSPLDRTWNLGETVELKCQVLLSNP TSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVL TLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAP TIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSL VITLYCNHRNRRRVCKCPRPVVKSGDKPSLSARYV
  • SEQ ID NOs: 28 and 32 provide polynucleotide and amino acid sequences for an exemplary CD8 transmembrane domain (e.g., residues 183-206 of CD8; see e.g., SEQ ID NO: 138 for an exemplary full-length CD8a polypeptide sequence).
  • NK CAR polypeptides comprising at least one extracellular domain (also referred to herein as an ectodomain).
  • extracellular domains can include, but are not limited to: extracellular binding domains, signal peptides, linker domains, detectable markers, and spacer domains.
  • An NK CAR polypeptide can comprise any combination of extracellular binding domains, signal peptides, linker domains, detectable markers, and spacer domains. For example, the following combinations are contemplated herein (see e.g., Table 8):
  • the CAR polypeptide comprises 1, 2, 3, 4, 5, or more extracellular domains. In some embodiments of any of the aspects, the CAR polypeptide comprises five extracellular domains. In some embodiments of any of the aspects, the CAR polypeptide comprises four extracellular domains. In embodiments comprising multiple extracellular domains, the multiple extracellular domains can be different individual extracellular domains or multiple copies of the same extracellular domain, or a combination of the foregoing.
  • a NK CAR polypeptide as described herein comprises an extracellular binding domain.
  • the extracellular binding domain recognizes and binds to a tumor antigen or to a cell surface marker expressed on a tumor cell.
  • a CAR polypeptide as described herein comprises at least 1, at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, or at least 10 extracellular binding domains.
  • the CAR polypeptide or system comprises one extracellular binding domain.
  • the CAR polypeptide comprises two extracellular binding domains. In embodiments comprising multiple extracellular binding domains, the multiple extracellular binding domains can be different individual extracellular binding domains or multiple copies of the same extracellular binding domains, or a combination of the foregoing.
  • the extracellular binding domain is an antibody, an antigen-binding fragment thereof, a F(ab) fragment, a F(ab′) fragment, a single chain variable fragment (scFv), or a single-domain antibody (sdAb).
  • the extracellular binding domain is monovalent, bivalent, or multivalent.
  • the extracellular binding domain comprises a human, humanized, or chimeric antibody construct.
  • a recombinant humanized antibody can be further optimized to decrease potential immunogenicity, while maintaining functional activity, for therapy in humans.
  • functional activity means a polypeptide capable of displaying one or more known functional activities associated with a recombinant antibody or antibody reagent thereof as described herein. Such functional activities include, e.g. the ability to bind to a target.
  • Antibody reagents specific for the targets and/or markers described herein, e.g., tumor antigens are known in the art.
  • the extracellular binding domain can be an antibody reagent comprising one or more (e.g., one, two, three, four, five, or six) CDRs of any one of the antibodies described herein or known in the art.
  • an antibody reagent specific for a target and/or marker described herein e.g., that binds specifically to a tumor antigen as described herein
  • an antibody reagent specific for a target and/or marker described herein can be an antibody reagent comprising the three heavy chain CDRs of any one of the antibodies described herein or known in the art.
  • an antibody reagent specific for a target and/or marker described herein e.g., that binds specifically to a tumor antigen as described herein
  • an antibody reagent specific for a target and/or marker described herein can be an antibody reagent comprising the VH and/or VL domains of any one of the antibodies described herein or known in the art.
  • an antibody reagent specific for a target and/or marker described herein e.g., that binds specifically to a tumor antigen as described herein
  • Such antibody reagents are specifically contemplated for use in the methods and/or compositions described herein.
  • antibody variable domain refers to the portions of the light and heavy chains of antibody molecules that include amino acid sequences of Complementarity Determining Regions (CDRs; i.e., CDR1, CDR2, and CDR3), and Framework Regions (FRs).
  • CDRs Complementarity Determining Regions
  • FRs Framework Regions
  • VH refers to the variable domain of the heavy chain.
  • VL refers to the variable domain of the light chain.
  • the amino acid positions assigned to CDRs and FRs may be defined according to Kabat (Sequences of Proteins of Immunological Interest (National Institutes of Health, Bethesda, Md., 1987 and 1991)). Amino acid numbering of antibodies or antigen binding fragments is also according to that of Kabat.
  • antigen-binding fragment or “antigen-binding domain”, which are used interchangeably herein are used to refer to one or more fragments of a full length antibody that retain the ability to specifically bind to a target of interest.
  • binding fragments encompassed within the term “antigen-binding fragment” of a full length antibody include (i) a Fab fragment, a monovalent fragment consisting of the VL, VH, CL and CH1 domains; (ii) a F(ab′)2 fragment, a bivalent fragment including two Fab fragments linked by a disulfide bridge at the hinge region; (iii) an Fd fragment consisting of the VH and CH1 domains; (iv) an Fv fragment consisting of the VL and VH domains of a single arm of an antibody, (v) a dAb fragment (Ward et al., (1989) Nature 341:544-546; which is incorporated by reference herein in its entirety), which consists of a VH or VL
  • linker refers to a chemical or peptide structure that covalently joins two polypeptide moieties.
  • a VH domain and a VL domain of an antibody can be joined by a peptide linker to form a VH/VL single chain antigen binding domain (e.g., as an scFv).
  • Lengths of linkers can be varied to modify the ability of linked domains to form, e.g., intramolecular or intermolecular dimers.
  • a diabody includes a short linker peptide between VH and VL domains, usually 5 amino acids, that will not permit the VH and VL domains to pair to form an antigen-binding domain; expression of two different VH-VL constructs with this short linker arrangement in a cell permits the VH domain of a first VH-VL polypeptide chain to dimerize with the VL domain of the second VH-VL polypeptide chain, and the corresponding VL domain of the first VH-VL polypeptide chain to dimerize with the VH domain of the second VH-VL polypeptide chain, thereby generating a bispecific construct.
  • VH and VL domains are separated by a longer peptide linker, most often 15-20 amino acids, the VH domain and the VL domain on the same polypeptide chain can dimerize to form an scFv.
  • linkers are described further herein.
  • the extracellular binding domain comprises an scFv. In some embodiments of any of the aspects, the extracellular binding domain comprises an scFv that specifically binds to a tumor antigen. In some embodiments of any of the aspects, the extracellular binding domain of a CAR polypeptide as described herein specifically binds to any tumor antigen, including those described herein. In some embodiments of any of the aspects, the extracellular binding domain comprises any known antibody, an antigen-binding fragment thereof, a F(ab) fragment, a F(ab′) fragment, a single chain variable fragment (scFv), or a single-domain antibody (sdAb) that binds to a tumor antigen or epitope as described herein.
  • scFv single chain variable fragment
  • sdAb single-domain antibody
  • Non-limiting examples of tumor antigens that can be targeted include EphA2, HER2, AXL, GD2, Glypican-3, 5T4, 8H9, ⁇ v ⁇ 6 integrin, BCMA, B7-H3, B7-H6, CAIX, CA9, CD19, CD20, CD22, kappa light chain, CD30, CD33, CD38, CD44, CD44v6, CD44v7/8, CD70, CD123, CD138, CD171, CEA, CSPG4, EGFR, EGFRvIII, EGP2, EGP40, EPCAM, ERBB3, ERBB4, ErbB3/4, FAP, FAR, FBP, fetal AchR, Folate Receptor a, GD2, GD3, HLA-AI MAGE A1, HLA-A2, IL1 1Ra, IL13Ra2, KDR, Lambda, Lewis-Y, MCSP, Mesothelin, Muc1, Muc16, NCAM, NKG2D ligands
  • Additional tumor-selective molecules that can be targeted include any membrane protein or biomarker that is expressed or overexpressed in tumor cells including, but not limited to, integrins (e.g., integrin ⁇ v ⁇ , ⁇ 5 ⁇ 1), EGF Receptor Family (e.g., EGFR2, Erbb2/HER2/neu, Erbb3, Erbb4), proteoglycans (e.g., heparan sulfate proteoglycans), disialogangliosides (e.g., GD2, GD3), B7-H3 (aka CD276), cancer antigen 125 (CA-125), epithelial cell adhesion molecule (EpCAM), vascular endothelial growth factor receptors 1 and 2 (VEGFR-1, VEGFR-2), CD52, carcinoembryonic antigen (CEA), tumor associated glycoproteins (e.g., TAG-72), cluster of differentiation 19 (CD19), CD20, CD22, CD30, CD
  • tumor antigens include the following: Differentiation antigens such as MART-1/MelanA (MART-I), gp100 (Pmel 17), tyrosinase, TRP-1, TRP-2 and tumor-specific multilineage antigens such as MAGE-1, MAGE-3, BAGE, GAGE-1, GAGE-2, p15; overexpressed embryonic antigens such as CEA; overexpressed oncogenes and mutated tumor-suppressor genes such as p53, Ras, HER-2/neu; unique tumor antigens resulting from chromosomal translocations; such as BCR-ABL, E2A-PRL, H4-RET, IGH-IGK, MYL-RAR; and viral antigens, such as the Epstein Barr virus antigens EBVA and the human papillomavirus (HPV) antigens E6 and E7.
  • Differentiation antigens such as MART-1/MelanA (MART-I), g
  • the tumor antigen is a tumor antigen described in International Application PCT/US2015/020606 or US Patent Applications US20170209492 or US20170335281, the contents of each of which are herein incorporated by reference in their entireties.
  • the tumor antigen is chosen from one or more of: CD19; CD123; CD22; CD30; CD171; CS-1 (also referred to as CD2 subset 1, CRACC, SLAMF7, CD319, and 19A24); C-type lectin-like molecule-1 (CLL-1 or CLECL1); CD33; epidermal growth factor receptor variant III (EGFRvIII); ganglioside G2 (GD2); ganglioside GD3 (aNeu5Ac(2-8)aNeu5Ac(2-3)bDGalp(1-4)bDGlcp(1-1)Cer); TNF receptor family member B cell maturation (BCMA); Tn antigen ((Tn Ag) or (GalNAc ⁇ -Ser/Thr)); prostate-specific membrane antigen (PSMA); Receptor tyrosine kinase-like orphan receptor 1 (RORI); Fms-Like Tyrosine Kinase 3 (FLT3); Tumor-associated glycoprotein 72 (
  • the tumor antigen is GFRa4 (see e.g., Spinasanta, “The Endocrine Society's 97th Annual Meeting & Expo: Targeted Therapies in Medullary Thyroid Cancer” Mar. 13, 2015).
  • the extracellular binding domain comprises an antibody or extracellular binding domain (e.g., antigen-binding domain) thereof selected from the group consisting of: 20-(74)-(74) (milatuzumab; veltuzumab), 20-2b-2b, 3F8, 74-(20)-(20) (milatuzumab; veltuzumab), 8H9, A33, AB-16B5, abagovomab, abciximab, abituzumab, ABP 494 (cetuximab biosimilar), abrilumab, ABT-700, ABT-806, Actimab-A (actinium Ac-225 lintuzumab), actoxumab, adalimumab, ADC-1013, ADCT-301, ADCT-402, adecatumumab, aducanumab, afelimomab, AFM13, afutu
  • an antibody or extracellular binding domain
  • the extracellular binding domain comprises an anti-CD19 antibody, e.g., an anti-CD19 scFV.
  • CD19 is also referred to interchangeably as B-Lymphocyte Surface Antigen B4 or T-Cell Surface Antigen Leu-12. Since CD19 is a marker of B cells, the protein has been used to diagnose cancers that arise from this type of cell—notably B cell lymphomas, acute lymphoblastic leukemia (ALL), and chronic lymphocytic leukemia (CLL). The majority of B cell malignancies express normal to high levels of CD19.
  • Non-limiting examples of anti-CD19 antibodies include A3B1, FMC63, FMC63-28Z, SEQ ID NO: 35; see e.g., U.S. Pat. Nos. 10,221,245, 8,906,682, 10,421,810, 10,639,329, the contents of each of which are incorporated herein by reference in their entireties.
  • the extracellular binding domain comprises an anti-CD33 antibody, e.g., an anti-CD33 scFV.
  • CD33 is also referred to interchangeably as Sialic Acid-Binding Ig-Like Lectin 3 (SIGLEC3) or Gp67.
  • SIGLEC3 Sialic Acid-Binding Ig-Like Lectin 3
  • Gp67 Gp67.
  • CD33 is a myeloid-specific sialic acid-binding receptor expressed on the blasts of approximately 90% of acute myelogenous leukemia (AML) patients and on AML stem cells.
  • anti-CD33 antibodies include SEQ ID NO: 36, gemtuzumab, vadastuximab, 2H12; see e.g., U.S. Pat. Nos. 7,557,189, 9,815,901, 10,556,951, 10,787,514, the contents of each of which are incorporated herein by reference in their entireties.
  • the CAR polypeptide described herein can be engineered to include the appropriate extracellular binding domain (e.g., antigen binding moiety) that is specific to the desired antigen target.
  • the appropriate extracellular binding domain e.g., antigen binding moiety
  • CD19 is the desired antigen that is to be targeted
  • an antibody for CD19 or an extracellular binding domain e.g., antigen-binding fragment
  • an antibody for CD33 or an extracellular binding domain e.g., antigen-binding fragment thereof can be used as the extracellular binding domain for incorporation into a CAR polypeptide as described herein.
  • the extracellular binding domain of a CAR polypeptide as described herein comprises one of SEQ ID NOs: 35-36, or an amino acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the sequence of one of SEQ ID NOs: 35-36, that maintains the same functions as one of SEQ ID NOs: 35-36 (e.g., tumor antigen binding).
  • SEQ ID NOs: 35-36 or an amino acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the sequence of one of SEQ ID NOs: 35-36,
  • the extracellular binding domain of a CAR polypeptide as described herein is encoded by a nucleic acid sequence comprising SEQ ID NOs: 33-34 or a sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to one of SEQ ID NOs: 33-34 that maintains the same function or a codon-optimized version of one of SEQ ID NOs: 33-34.
  • SEQ ID NOs: 33 and 35 provide polynucleotide and amino acid sequences for an exemplary anti-CD19 scFv.
  • SEQ ID NOs: 34 and 36 provide polynucleotide and amino acid sequences for an exemplary anti-CD33 scFv.
  • the extracellular binding domain can target antigens involved in diseases other than cancer (e.g., infectious disease, etc.). As such, in some embodiments of any of the aspects, the extracellular binding domain can target a viral antigen. In some embodiments of any of the aspects, the extracellular binding domain can target a bacterial antigen. In some embodiments of any of the aspects, the viral target antigen is a viral surface antigen, such as a viral glycoprotein.
  • Non-limiting examples of viral glycoproteins include: respiratory syncytial virus (RSV) F protein (e.g., site II of F protein); herpesvirus glycoprotein B (gB); Hepatitis B virus (HBV) surface antigen (HBsAg); human immunodeficiency virus (HIV) glycoprotein 120 (gp120) (e.g., gp120 CD4 binding site (CD4bs); gp120 third variable region (V3)); influenza virus hemagglutinin (HE; e.g., HE stalk; e.g., group 1 (G1) or group 2 (G2) HE stalk); and the like.
  • RSV respiratory syncytial virus
  • F protein e.g., site II of F protein
  • gB herpesvirus glycoprotein B
  • HBV Hepatitis B virus
  • HSV human immunodeficiency virus
  • gp120 gp120 CD4 binding site
  • V3 third variable region
  • the bacterial target antigen is a bacterial surface antigen, such as a bacterial surface protein, lipid, or polysaccharide (i.e., exopolysaccharide).
  • bacterial surface antigens include: Staphylococcus species protein A; Staphylococcus species cell wall teichoic acid; lipopolysaccharide (LPS) (e.g., Pseudomonas aeruginosa serotype 011 LPS); alginate (e.g., Pseudomonas aeruginosa extracellular slime alginate); Clostridium difficile cell wall polysaccharide 2 (PsII); and the like.
  • the extracellular binding domain can target its antigen using a biotinylated antigen-specific molecule, e.g., instead of an scFv.
  • NK CAR polypeptides as described herein comprise a signal peptide, which can also be referred to as a signal, signal sequence, leader sequence, leader peptide, targeting signal, localization signal, localization sequence, or transit peptide.
  • signal peptide refers to an amino-terminal sequence of a polypeptide that designates newly synthesized proteins toward the secretory pathway.
  • the signal peptide typically consists of 13 to 36 rather hydrophobic amino acids.
  • Signal peptides have a common structure: a short, positively charged amino-terminal region (n-region); a central hydrophobic region (h-region); and a more polar carboxy-terminal region (c-region) containing the site that is cleaved by the signal peptidase.
  • n-region a short, positively charged amino-terminal region
  • h-region a central hydrophobic region
  • c-region more polar carboxy-terminal region
  • type II membrane-bound proteins Although most type I membrane-bound proteins have signal peptides, the majority of type II and multi-spanning membrane-bound proteins are targeted to the secretory pathway by their first transmembrane domain, which biochemically resembles a signal sequence except that it is not cleaved.
  • a NK CAR polypeptide as described herein comprises 1, 2, 3, 4, 5, or more signal peptides.
  • the CAR polypeptide or system comprises one signal peptide, e.g., at the N-terminus of the polypeptide, preceding all other extracellular domains.
  • the multiple signal peptides can be different individual signal peptides or multiple copies of the same signal peptide, or a combination of the foregoing.
  • the signal peptide is a CD8a signal peptide.
  • the signal peptide comprises SEQ ID NO: 38 or an amino acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the sequence of SEQ ID NO: 38 that maintains the same functions as SEQ ID NO: 38 (targeting of a transmembrane protein to the secretory pathway and the cell membrane).
  • the signal peptide of a CAR polypeptide as described herein is encoded by a nucleic acid sequence comprising SEQ ID NO: 37 or a sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 37 that maintains the same function or a codon-optimized version of SEQ ID NO: 37.
  • SEQ ID NOs: 37 and 38 provide polynucleotide and amino acid sequences for an exemplary CD8 signal peptide.
  • NK CAR polypeptides comprising at least one detectable marker.
  • the term “detectable marker” refers to a moiety that, when attached to the CAR polypeptide, confers detectability upon that polypeptide or another molecule to which the polypeptide binds.
  • the CAR polypeptide comprises 1, 2, 3, 4, 5, or more detectable markers.
  • the CAR polypeptide or system comprises one detectable marker. In embodiments comprising multiple detectable markers, the multiple detectable markers can be different individual detectable markers or multiple copies of the same detectable markers, or a combination of the foregoing.
  • the detectable marker comprises an affinity tag.
  • affinity tags include Strep-tags, chitin binding proteins (CBP), maltose binding proteins (MBP), glutathione-S-transferase (GST), FLAG-tags, HA-tags, Myc-tags, poly(His)-tags as well as derivatives thereof.
  • the detectable marker is 3 ⁇ FLAG (i.e., the FLAG motif, DYKDDDDK, SEQ ID NO: 131, repeated three times).
  • the detectable marker of a CAR polypeptide as described herein comprises one of SEQ ID NOs: 40, 122, 131, or an amino acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the sequence of one of SEQ ID NOs: 40, 122, or 131, that maintains the same functions as one of SEQ ID NOs: 40, 122, or 131 (e.g., detection of the CAR polypeptide).
  • the detectable marker of a CAR polypeptide as described herein is encoded by a nucleic acid sequence comprising one of SEQ ID NOs: 39, 121, or a sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to one of SEQ ID NOs: 39 or 121 that maintains the same function or a codon-optimized version of one of SEQ ID NOs: 39 or 121.
  • SEQ ID NOs: 39, 40, 121, and 122 provide polynucleotide and amino acid sequences for an exemplary FLAG tag (e.g., 3 ⁇ Flag).
  • an exemplary FLAG tag e.g., 3 ⁇ Flag
  • fluorescent moieties can be used as detectable markers, but detectable markers also include, for example, isotopes, fluorescent proteins and peptides, enzymes, components of a specific binding pair, chromophores, affinity tags as described herein or known in the art, antibodies, colloidal metals (i.e. gold) and quantum dots.
  • Detectable markers can be either directly or indirectly detectable. Directly detectable markers do not require additional reagents or substrates in order to generate detectable signal. Examples include isotopes and fluorophores. Indirectly detectable markers require the presence or action of one or more co-factors or substrates.
  • Examples include enzymes such as ⁇ -galactosidase which is detectable by generation of colored reaction products upon cleavage of substrates such as the chromogen X-gal (5-bromo-4-chloro-3-indoyl- ⁇ -D-galactopyranoside), horseradish peroxidase which is detectable by generation of a colored reaction product in the presence of the substrate diaminobenzidine and alkaline phosphatase which is detectable by generation of colored reaction product in the presence of nitroblue tetrazolium and 5-bromo-4-chloro-3-indolyl phosphate.
  • substrates such as the chromogen X-gal (5-bromo-4-chloro-3-indoyl- ⁇ -D-galactopyranoside)
  • horseradish peroxidase which is detectable by generation of a colored reaction product in the presence of the substrate diaminobenzidine
  • alkaline phosphatase which is detectable
  • the detectable marker can be located anywhere within a CAR polypeptide as described herein. In one embodiment, the detectable marker is located between any domain of a CAR polypeptide as described herein, but is not found within a functional domain and does not disrupt the function of a domain. In some embodiments of any of the aspects, the detectable marker is located adjacent to and N-terminal of the extracellular binding domain. Such a marker can be used to detect the expression of the CAR polypeptide, including the cell surface expression. In some embodiments of any of the aspects, the detectable marker is located adjacent to one of the extracellular domains. In some embodiments of any of the aspects, the detectable marker is located adjacent to the transmembrane domain. In some embodiments of any of the aspects, the detectable marker is located adjacent to one of the intracellular domains.
  • CAR polypeptides as described herein especially those that are administered to a subject or those that are part of a pharmaceutical composition, do not comprise detectable markers that are immunogenic. In some embodiments of any of the aspects, CAR polypeptides as described herein do not comprise GFP, mCherry, HA 1, or any other immunogenic markers.
  • linker domain refers to an oligo- or polypeptide region from about 2 to 100 amino acids in length, which links together any of the sequences of the domains as described herein.
  • linkers can include or be composed of flexible residues such as glycine and serine so that the adjacent protein domains are free to move relative to one another. Longer linkers may be used when it is desirable to ensure that two adjacent domains do not sterically interfere with one another. Linkers can be cleavable (e.g., designed to comprise a substrate for a particular protease enzyme) or non-cleavable.
  • an NK CAR polypeptide as described herein comprises 1, 2, 3, 4, 5, or more linker domains(s).
  • the NK CAR polypeptide comprises one linker domain.
  • the multiple linker domains can be different individual linker domains or multiple copies of the same linker domain, or a combination of the foregoing.
  • the linker peptide can be positioned between any two domains as described herein: e.g., between the detectable marker and the spacer domain, and/or between a VH/VL single chain antigen binding domain (e.g., as in an scFv).
  • the linker domain is distal to (i.e., farther from the transmembrane domain compared to) the extracellular binding domain. In some embodiments of any of the aspects, the linker domain is proximal to (i.e., closer to the transmembrane domain compared to) the signal peptide and/or detectable marker.
  • a linker domain can comprise 1 amino acid or more, 5 amino acids or more, 10 amino acids or more, 15 amino acids or more, 20 amino acids or more, 25 amino acids or more, 30 amino acids or more, 35 amino acids or more, 40 amino acids or more, 45 amino acids or more, 50 amino acids or more and beyond.
  • a linker domain can comprise less than 50 amino acids, less than 45 amino acids, less than 40 amino acids, less than 35 amino acids, less than 30 amino acids, less than 30 amino acids, less than 25 amino acids, less than 20 amino acids, less than 15 amino acids or less than 10 amino acids.
  • the linker domain comprises from about 5 amino acids to about 50 amino acids.
  • the linker domain can comprise from about 5 amino acids to about 45 amino acids, from about 5 amino acids to about 40 amino acids, from about 5 amino acids to about 35 amino acids, from about 10 amino acids to 30 amino acids, or from about 15 amino acids to about 25 amino acids.
  • linker domains include those that consist of glycine and serine residues, the so-called Gly-Ser polypeptide linkers.
  • Gly-Ser polypeptide linker refers to a peptide that consists of glycine and serine residues.
  • the linker domain comprises the amino acid sequence (Gly x Ser) n , where x is 2, 3, 4 or 5, and n is 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10, e.g., SEQ ID NOs: 42, 120, 139-176 (see e.g., Table 9).
  • the linker domain of a CAR polypeptide as described herein comprises one of SEQ ID NOs: 42, 120, 139-176, or an amino acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the sequence of one of SEQ ID NOs: 42, 120, 139-176, that maintains the same functions as one of SEQ ID NOs: 42, 120, 139-176 (e.g., flexible linker between domains of the CAR polypeptide).
  • the detectable marker of a CAR polypeptide as described herein is encoded by a nucleic acid sequence comprising one of SEQ ID NOs: 41, 119, or a sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to one of SEQ ID NOs: 41 or 119 that maintains the same function or a codon-optimized version of one of SEQ ID NOs: 41 or 119.
  • SEQ ID NOs: 41, 42, 119, and 120 provide polynucleotide and amino acid sequence for an exemplary linker.
  • SEQ ID NO: 41 GGTGGAGGCGGTTCG;
  • SEQ ID NO: 42 GGGGS;
  • a NK CAR polypeptide as described herein comprises a spacer domain.
  • the spacer domain is located between the extracellular binding domain and the transmembrane domain.
  • the spacer domain is C-terminal of the extracellular binding domain and N-terminal of the transmembrane domain.
  • the spacer domain is N-terminal of the extracellular binding domain and C-terminal of the transmembrane domain.
  • the spacer domain comprises a hinge domain.
  • a CAR polypeptide as described herein comprises 1, 2, 3, 4, 5, or more hinge domains.
  • the CAR polypeptide or system comprises one hinge domain.
  • the multiple hinge domains can be different individual hinge domains or multiple copies of the same hinge domain, or a combination of the foregoing.
  • the hinge domain comprises an immunoglobulin G (IgG)-based hinge or a derivative of the CD8a extracellular domain. Incorporation of a hinge domain has been shown to improve the expansion of chimeric antigen receptor T cells and to increase the antitumor efficacy of CAR T cells (see e.g., Qin et al., Journal of Hematology & Oncology volume 10, Article number: 68 (2017); Stoiber et al., Cells. 2019 May; 8(5): 472). Hinge domains can be derived from IgG subclasses (such as IgGI and IgG4), IgD and CD8 domains, of which IgGI has been most extensively used.
  • IgG subclasses such as IgGI and IgG4
  • a hinge domain preferably provides the following four aspects: (1) reduced binding affinity to the Fc ⁇ receptor, thereby reducing or eliminating off-target activation; (2) enhanced flexibility for the extracellular binding domain (e.g., scFv), thereby relieving the spatial constraints between tumor antigens and CARs, in turn promoting synapse formation between the NK CAR cells and target cells; for example, to overcome steric hindrance in a MUC1-specific CAR, a flexible and elongated hinge of the IgD isotype can be inserted; (3) reduced distance between an extracellular binding domain (e.g., scFv) and the target antigen or epitope, for example, an anti-CD22 CAR needs a hinge domain to exert optimal cytotoxicity; and (4) facilitated detection of CAR expression using anti-Fc reagents.
  • the hinge domain promotes CAR dimerization.
  • the hinge domain comprises a CD8 hinge domain. In some embodiments of any of the aspects, the hinge domain comprises a CD8a hinge domain. In some embodiments of any of the aspects, the hinge domain of a CAR polypeptide as described herein comprises SEQ ID NO: 44, or an amino acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the sequence of SEQ ID NO: 44, that maintains the same functions as SEQ ID NO: 44 (e.g., displaying the extracellular binding region).
  • the hinge domain of a CAR polypeptide as described herein is encoded by a nucleic acid sequence comprising SEQ ID NO: 43 or a sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 43 that maintains the same function or a codon-optimized version of SEQ ID NO: 43.
  • SEQ ID NOs: 43 and 44 provide polynucleotide and amino acid sequences for an exemplary CD8a hinge domain (e.g., residues 138-182 of CD8a; see e.g., SEQ ID NO: 138 for an exemplary full-length CD8a polypeptide sequence).
  • NK CAR polypeptides comprising any combination of the domains as described herein.
  • a chimeric antigen receptor (CAR) polypeptide for expression in natural killer (NK) cells comprising: (a) an extracellular binding domain; (b) a transmembrane domain; and (c) an intracellular domain comprising at least one of the following: (i) an intracellular signaling domain from an NK cell receptor; (ii) an intracellular signaling domain from an NK cell membrane-bound signaling adaptor protein; and/or (iii) an intracellular co-stimulatory domain from a co-stimulatory receptor.
  • a chimeric antigen receptor (CAR) polypeptide for expression in natural killer (NK) cells comprising: (a) an extracellular binding domain; (b) a transmembrane domain; and (c) an intracellular domain comprising at least one of the following: (i) an intracellular signaling domain from a NK cell membrane-bound signaling adaptor protein; and/or (ii) an intracellular co-stimulatory domain from a co-stimulatory receptor.
  • CAR chimeric antigen receptor
  • a chimeric antigen receptor (CAR) polypeptide for expression in natural killer (NK) cells comprising: (a) an extracellular binding domain; (b) a transmembrane domain; and (c) an intracellular domain comprising at least one signaling domain from a NK cell receptor.
  • CAR chimeric antigen receptor
  • the polypeptide comprises from N-terminus to C-terminus: (a) the extracellular binding domain; (b) the transmembrane domain; and (c) the intracellular domain; such a polypeptide can also be referred to as a type I transmembrane protein.
  • a CAR that is a type I transmembrane protein firther comprises an N-terminal signal peptide.
  • Non-limiting examples of such type I transmembrane protein CARs include CC002, CC003, CC004, CC005, CC007, CC008, CC013, CC016, CC017, CC018, CC024, CC026, CC027, CC029, CC030, CC032, CC033, CC034, CC035, CC037, CC038, CC039, CC103, CC104, CC108, CC118, CC124, CC130, CC135, which correspond to SEQ ID NOs: 80-90, 92-93, 95-96, 98-101, 103-110, and 112-113, respectively.
  • the polypeptide comprises from C-terminus to N-terminus: (a) the extracellular binding domain; (b) the transmembrane domain; and (c) the intracellular domain; such a polypeptide can also be referred to as a type II transmembrane protein.
  • a CAR that is a type II transmembrane protein does not necessarily comprise an N-terminal signal peptide.
  • Non-limiting examples of such type II transmembrane protein CARs include CC025, CC028, CC031, CC036, CC125, CC136, which correspond to SEQ ID NOs: 91, 94, 97, 102, 111, 114, respectively.
  • the polypeptide is selected from the group consisting of Group Ic (e.g., CC005, CC007, CC008, or CC108), Group IIa (e.g., CC024, CC025, CC124, CC125), or Group IV (e.g., CC027, CC030, CC034, CC038, or CC130).
  • Group Ic e.g., CC005, CC007, CC008, or CC108
  • Group IIa e.g., CC024, CC025, CC124, CC125
  • Group IV e.g., CC027, CC030, CC034, CC038, or CC130.
  • the polypeptide is selected from the group consisting of Group Ic (e.g., CC005, CC007, CC008, or CC108), Group IIa (e.g., CC024, CC025, CC124, CC125), or Group IVd (e.g., CC030 or CC130).
  • the polypeptide is selected from the group consisting of Group Ic (e.g., comprising cytokines, including C007, CC008, or CC108), Group IIa (e.g., CC024, CC025, CC124, CC125), or Group IVd (e.g., CC030 or CC130).
  • a CAR polypeptide comprises one of SEQ ID NOs: 80-114 (see e.g., Table 6), or a sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the sequence of one of 80-114 maintains the same functions (e.g., antigen-binding and intracellular signaling).
  • Table 6 shows exemplary CAR polypeptides and the specific order of their extracellular, transmembrane, and intracellular domains.
  • TM Construct and Domain Amino Acid SEQ ID NOs
  • CC002 80 38 40 42 35 44 32 15 CC003 81 38 42 35 44 32 15 11 CC004 82 38 40 42 35 44 32 15 11 CC005 83 38 40 42 35 44 32 15 12 CC007 84 38 40 42 35 44 32 15 12 19 23 CC008 85 38 40 42 35 44 32 15 12 19 23 20 24 CC013 86 38 40 42 35 44 32 15 16 5 CC016 87 38 40 42 35 44 32 16 13 5 CC017 88 38 40 42 35 44 32 13 16 12 CC018 89 38 40 42 35 44 32 16 13 12 CC024 90 38 40 42 35 44 29 7 CC025 91 40 42
  • a Group I NK CAR polypeptide comprising: (a) an extracellular binding domain; (b) a transmembrane domain; and (c) an intracellular domain comprising at least one of the following: (i) an intracellular signaling domain from an NK cell membrane-bound signaling adaptor protein; and/or (ii) an intracellular co-stimulatory domain from a co-stimulatory receptor.
  • the transmembrane domain comprises the transmembrane domain of CD8a.
  • a Group Ia NK CAR polypeptide comprising: (a) an extracellular binding domain; (b) a transmembrane domain; and (c) an intracellular domain comprising an intracellular co-stimulatory domain from a co-stimulatory receptor.
  • the transmembrane domain comprises the transmembrane domain of CD8a.
  • the co-stimulatory receptor is 4-1BB.
  • the Group Ia NK CAR polypeptide is used as a control or a reference.
  • a Group 1b NK CAR polypeptide comprising: (a) an extracellular binding domain; (b) a transmembrane domain; and (c) an intracellular domain comprising: (i) an intracellular signaling domain from a NK cell membrane-bound signaling adaptor protein; and (ii) an intracellular co-stimulatory domain from a co-stimulatory receptor.
  • the transmembrane domain comprises the transmembrane domain of CD8a.
  • the co-stimulatory receptor is 4-1BB.
  • the adaptor protein is CD3-zeta.
  • the Group 1b NK CAR polypeptide is used as a control or a reference.
  • a Group Ic NK CAR polypeptide comprising: (a) an extracellular binding domain; (b) a transmembrane domain; and (c) an intracellular domain comprising: (i) an intracellular signaling domain from a NK cell membrane-bound signaling adaptor protein; and (ii) an intracellular co-stimulatory domain from a co-stimulatory receptor.
  • the transmembrane domain comprises the transmembrane domain of CD8a.
  • the co-stimulatory receptor is 4-1BB.
  • the adaptor protein is Fc ⁇ RI.
  • the Group Ic NK CAR polypeptide further comprises at least one cytokine (e.g., IL-15 and/or IL-21) and at least one self-cleaving peptide.
  • a Group Id NK CAR polypeptide comprising: (a) an extracellular binding domain; (b) a transmembrane domain; and (c) an intracellular domain comprising: (i) an intracellular signaling domain from a NK cell membrane-bound signaling adaptor protein; and (ii) two intracellular co-stimulatory domains from co-stimulatory receptors.
  • the transmembrane domain comprises the transmembrane domain of CD8a.
  • the two co-stimulatory receptors are 4-1BB and IL2RB.
  • the adaptor protein is CD3-zeta.
  • a Group Ie NK CAR polypeptide comprising: (a) an extracellular binding domain; (b) a transmembrane domain; and (c) an intracellular domain comprising: (i) an intracellular signaling domain from a NK cell membrane-bound signaling adaptor protein; and (ii) two intracellular co-stimulatory domains from co-stimulatory receptors.
  • the transmembrane domain comprises the transmembrane domain of CD8a.
  • the two co-stimulatory receptors are 4-1BB and IL2RB.
  • the adaptor protein is Fc ⁇ RI.
  • a Group I NK CAR polypeptide comprises one of SEQ ID NOs: 80-89 or 106-109, or a sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the sequence of one of 80-89 or 106-109 maintains the same functions (e.g., antigen-binding and intracellular signaling).
  • a Group I NK CAR polynucleotide comprises one of SEQ ID NOs: 45-54 or 71-74, or a sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the sequence of one of SEQ ID NOs: 45-54 or 71-74 that as a polypeptide maintains the same functions, or a codon-optimized version of one of SEQ ID NOs: 45-54 or 71-74.
  • Non-limiting examples of Group I NK CARs that are specific to CD19 include CC002, CC003, CC004, CC005, CC007, CC008, CC013, CC016, CC017, or CC018, which correspond to polynucleotide SEQ ID NOs: 45-54 and polypeptide SEQ ID NOs: 80-89, respectively. It should be understood that other NK CARs can be generated by switching the CD-19-binding domain for a different tumor antigen- or cell-surface protein-binding domain.
  • the CC002 construct comprises the following domains from N terminus to C terminus: CD8 signal peptide—3*Flag—linker (e.g., GGGGS, SEQ ID NO: 42)—anti-CD19 scFv—CD8a hinge domain—CD8 transmembrane domain—4-1BB. See e.g., SEQ ID NO: 45 or SEQ ID NO: 80.
  • the CC003 construct comprises the following domains from N terminus to C terminus: CD8 signal peptide—linker (e.g., GGGGS, SEQ ID NO: 42)—anti-CD19 scFv—CD8a hinge domain—CD8 transmembrane domain—4-1BB—CD3z. See e.g., SEQ ID NO: 46 or SEQ ID NO: 81.
  • the CC004 construct comprises the following domains from N terminus to C terminus: CD8 signal peptide—3*Flag—linker (e.g., GGGGS, SEQ ID NO: 42)—anti-CD19 scFv—CD8a hinge domain—CD8 transmembrane domain—4-1BB—CD3z. See e.g., SEQ ID NO: 47 or SEQ ID NO: 82.
  • CD8 signal peptide 3*Flag—linker (e.g., GGGGS, SEQ ID NO: 42)—anti-CD19 scFv—CD8a hinge domain—CD8 transmembrane domain—4-1BB—CD3z. See e.g., SEQ ID NO: 47 or SEQ ID NO: 82.
  • the CC005 construct comprises the following domains from N terminus to C terminus: CD8 signal peptide—3*Flag—linker (e.g., GGGGS, SEQ ID NO: 42)—anti-CD19 scFv—CD8a hinge domain—CD8 transmembrane domain—4-1BB—Fc ⁇ R cytoplasmic domain. See e.g., SEQ ID NO: 48 or SEQ ID NO: 83.
  • the CC007 construct comprises the following domains from N terminus to C terminus: CD8 signal peptide—3*Flag—linker (e.g., GGGGS, SEQ ID NO: 42)—anti-CD19 scFv—CD8a hinge domain—CD8 transmembrane domain—4-1BB—Fc ⁇ R cytoplasmic domain—P2A peptide—IL15 isoform 1. See e.g., SEQ ID NO: 49 or SEQ ID NO: 84.
  • CD8 signal peptide 3*Flag—linker (e.g., GGGGS, SEQ ID NO: 42)—anti-CD19 scFv—CD8a hinge domain—CD8 transmembrane domain—4-1BB—Fc ⁇ R cytoplasmic domain—P2A peptide—IL15 isoform 1.
  • linker e.g., GGGGS, SEQ ID NO: 42
  • anti-CD19 scFv CD8a hinge domain
  • the CC008 construct comprises the following domains from N terminus to C terminus: CD8 signal peptide—3*Flag—linker (e.g., GGGGS, SEQ ID NO: 42)—anti-CD19 scFv—CD8a hinge domain—CD8 transmembrane domain—4-1BB—Fc ⁇ R cytoplasmic domain—P2A peptide—IL15 isoform 1—T2A—IL-21 isoform 1. See e.g., SEQ ID NO: 50 or SEQ ID NO: 85.
  • CD8 signal peptide 3*Flag—linker (e.g., GGGGS, SEQ ID NO: 42)—anti-CD19 scFv—CD8a hinge domain—CD8 transmembrane domain—4-1BB—Fc ⁇ R cytoplasmic domain—P2A peptide—IL15 isoform 1—T2A—IL-21 isoform 1. See e.g., SEQ ID NO: 50 or SEQ ID NO: 85.
  • the CC013 construct comprises the following domains from N terminus to C terminus: CD8 signal peptide—3*Flag—linker (e.g., GGGGS, SEQ ID NO: 42)—anti-CD19 scFv—CD8a hinge domain—CD8 transmembrane domain—4-1BB—IL2RB cytoplasmic domain—CD3z. See e.g., SEQ ID NO: 51 or SEQ ID NO: 86.
  • the CC016 construct comprises the following domains from N terminus to C terminus: CD8 signal peptide—3*Flag—linker (e.g., GGGGS, SEQ ID NO: 42)—anti-CD19 scFv—CD8a hinge domain—CD8 transmembrane domain—IL2RB cytoplasmic domain—4-1BB—CD3z. See e.g., SEQ ID NO: 52 or SEQ ID NO: 87.
  • the CC017 construct comprises the following domains from N terminus to C terminus: CD8 signal peptide—3*Flag—linker (e.g., GGGGS, SEQ ID NO: 42)—anti-CD19 scFv—CD8a hinge domain—CD8 transmembrane domain—4-1BB—IL2RB cytoplasmic domain—Fc ⁇ R cytoplasmic domain. See e.g., SEQ ID NO: 53 or SEQ ID NO: 88.
  • CD8 signal peptide 3*Flag—linker (e.g., GGGGS, SEQ ID NO: 42)—anti-CD19 scFv—CD8a hinge domain—CD8 transmembrane domain—4-1BB—IL2RB cytoplasmic domain—Fc ⁇ R cytoplasmic domain.
  • linker e.g., GGGGS, SEQ ID NO: 42
  • anti-CD19 scFv CD8a hinge domain
  • CD8 transmembrane domain CD8 transmembr
  • the CC018 construct comprises the following domains from N terminus to C terminus: CD8 signal peptide—3*Flag—linker (e.g., GGGGS, SEQ ID NO: 42)—anti-CD19 scFv—CD8a hinge domain—CD8 transmembrane domain—IL2RB cytoplasmic domain—4-1BB—Fc ⁇ R cytoplasmic domain. See e.g., SEQ ID NO: 54 or SEQ ID NO: 89.
  • CD8 signal peptide 3*Flag—linker (e.g., GGGGS, SEQ ID NO: 42)—anti-CD19 scFv—CD8a hinge domain—CD8 transmembrane domain—IL2RB cytoplasmic domain—4-1BB—Fc ⁇ R cytoplasmic domain.
  • linker e.g., GGGGS, SEQ ID NO: 42
  • anti-CD19 scFv CD8a hinge domain
  • CD8 transmembrane domain IL2RB
  • Non-limiting examples of Group I NK CARs that are specific to CD33 include CC103, CC104, CC108, or CC118, which correspond to polynucleotide SEQ ID NOs: 71-74 and polypeptide SEQ ID NOs: 106-109, respectively. It should be understood that other NK CARs can be generated by switching the CD-33-binding domain for a different tumor antigen- or cell-surface protein-binding domain.
  • the CC103 construct comprises the following domains from N terminus to C terminus: CD8 signal peptide—linker (e.g., GGGGS, SEQ ID NO: 42)—anti-CD33 scFv—CD8a hinge domain—CD8 transmembrane domain—4-1BB—CD3z. See e.g., SEQ ID NO: 71 or SEQ ID NO: 106.
  • the CC104 construct comprises the following domains from N terminus to C terminus: CD8 signal peptide—3*Flag—linker (e.g., GGGGS, SEQ ID NO: 42)—anti-CD33 scFv—CD8a hinge domain—CD8 transmembrane domain—4-1BB—CD3z. See e.g., SEQ ID NO: 72 or SEQ ID NO: 107.
  • the CC108 construct comprises the following domains from N terminus to C terminus: CD8 signal peptide—3*Flag—linker (e.g., GGGGS, SEQ ID NO: 42)—anti-CD33 scFv—CD8a hinge domain—CD8 transmembrane domain—4-1BB—Fc ⁇ R cytoplasmic domain—P2A peptide—IL15 isoform 1—T2A—IL-21 isoform 1. See e.g., SEQ ID NO: 73 or SEQ ID NO: 108.
  • CD8 signal peptide 3*Flag—linker (e.g., GGGGS, SEQ ID NO: 42)—anti-CD33 scFv—CD8a hinge domain—CD8 transmembrane domain—4-1BB—Fc ⁇ R cytoplasmic domain—P2A peptide—IL15 isoform 1—T2A—IL-21 isoform 1. See e.g., SEQ ID NO: 73 or SEQ ID NO:
  • the CC118 construct comprises the following domains from N terminus to C terminus: CD8 signal peptide—3*Flag—linker (e.g., GGGGS, SEQ ID NO: 42)—anti-CD33 scFv—CD8a hinge domain—CD8 transmembrane domain—IL2RB cytoplasmic domain—4-1BB—Fc ⁇ R cytoplasmic domain. See e.g., SEQ ID NO: 74 or SEQ ID NO: 109.
  • CD8 signal peptide 3*Flag—linker (e.g., GGGGS, SEQ ID NO: 42)—anti-CD33 scFv—CD8a hinge domain—CD8 transmembrane domain—IL2RB cytoplasmic domain—4-1BB—Fc ⁇ R cytoplasmic domain.
  • linker e.g., GGGGS, SEQ ID NO: 42
  • anti-CD33 scFv CD8a hinge domain
  • CD8 transmembrane domain IL2RB
  • Group II-IV NK CAR polypeptide comprising: (a) an extracellular binding domain; (b) a transmembrane domain; and (c) an intracellular domain comprising at least one signaling domain from a NK cell receptor.
  • Group II NK CAR polypeptide comprising: (a) an extracellular binding domain; (b) a transmembrane domain; and (c) an intracellular domain comprising at least one signaling domain from a NK cell receptor; wherein the transmembrane domain comprises the transmembrane domain of NKG2D.
  • the NK cell receptor comprises 2B4 (e.g., Group IIa).
  • the NK cell receptor comprises NTB-A (e.g., Group IIb).
  • the NK cell receptor comprises CD2 (e.g., Group IIc).
  • the NK cell receptor comprises CRACC (e.g., Group IId).
  • Group III NK CAR polypeptide comprising: (a) an extracellular binding domain; (b) a transmembrane domain; and (c) an intracellular domain comprising at least one signaling domain from a NK cell receptor; wherein the transmembrane domain comprises the transmembrane domain of NKp46.
  • the NK CAR further comprises the intracellular signaling domain of NKp46.
  • the NK cell receptor comprises 2B4 (e.g., Group IIIa).
  • the NK cell receptor comprises NTB-A (e.g., Group IIIb).
  • the NK cell receptor comprises CD2 (e.g., Group IIIc).
  • the NK cell receptor comprises CRACC (e.g., Group IIId).
  • Group IV NK CAR polypeptide comprising: (a) an extracellular binding domain; (b) a transmembrane domain; and (c) an intracellular domain comprising at least one signaling domain from a NK cell receptor; wherein the transmembrane domain comprises the transmembrane domain of DNAM1.
  • the NK CAR further comprises the intracellular signaling domain of DNAM1.
  • the NK cell receptor comprises 2B4 (e.g., Group IVa).
  • the NK cell receptor comprises NTB-A (e.g., Group IVb).
  • the NK cell receptor comprises CD2 (e.g., Group IVc).
  • the NK cell receptor comprises CRACC (e.g., Group IVd).
  • a Group II-IV NK CAR polypeptide comprises one of SEQ ID NOs: 90-105 or 110-114, or a sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the sequence of one of 90-105 or 110-114 maintains the same functions (e.g., antigen-binding and intracellular signaling).
  • a Group II-IV NK CAR polynucleotide comprises one of SEQ ID NOs: 55-70 or 75-79, or a sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the sequence of one of SEQ ID NOs: 55-70 or 75-79 that as a polypeptide maintains the same functions, or a codon-optimized version of one of SEQ ID NOs: 55-70 or 75-79.
  • Non-limiting examples of Group II-IV NK CARs that are specific to CD19 include CC024, CC025, CC026, CC027, CC028, CC029, CC030, CC031, CC032, CC033, CC034, CC035, CC036, CC037, CC038, or CC039, which correspond to polynucleotide SEQ ID NOs: 55-70 and polypeptide SEQ ID NOs: 90-105, respectively. It should be understood that other NK CARs can be generated by switching the CD-19-binding domain for a different tumor antigen- or cell-surface protein-binding domain.
  • the CC024 construct comprises the following domains from N terminus to C terminus: CD8 signal peptide—3*Flag—linker (e.g., GGGGS, SEQ ID NO: 42)—anti-CD19 scFv—CD8a hinge domain—NKG2D transmembrane domain—2B4 cytoplasmic domain. See e.g., SEQ ID NO: 55 or SEQ ID NO: 90.
  • CD8 signal peptide 3*Flag—linker (e.g., GGGGS, SEQ ID NO: 42)—anti-CD19 scFv—CD8a hinge domain—NKG2D transmembrane domain—2B4 cytoplasmic domain. See e.g., SEQ ID NO: 55 or SEQ ID NO: 90.
  • the CC025 construct (e.g., reverse domain order of CC024, except not including the CD8 signal peptide) comprises the following domains from N terminus to C terminus: 2B4 cytoplasmic domain—NKG2D transmembrane domain—CD8a hinge domain—anti-CD19 scFv—linker (e.g., GGGGS, SEQ ID NO: 42)—3*Flag. See e.g., SEQ ID NO: 56 or SEQ ID NO: 91.
  • the CC026 construct comprises the following domains from N terminus to C terminus: CD8 signal peptide—3*Flag—linker (e.g., GGGGS, SEQ ID NO: 42)—anti-CD19 scFv—CD8a hinge domain—NKp46 transmembrane and cytoplasmic domains—CD2 cytoplasmic domain. See e.g., SEQ ID NO: 57 or SEQ ID NO: 92.
  • CD8 signal peptide 3*Flag—linker (e.g., GGGGS, SEQ ID NO: 42)—anti-CD19 scFv—CD8a hinge domain—NKp46 transmembrane and cytoplasmic domains—CD2 cytoplasmic domain. See e.g., SEQ ID NO: 57 or SEQ ID NO: 92.
  • the CC027 construct comprises the following domains from N terminus to C terminus: CD8 signal peptide—3*Flag—linker (e.g., GGGGS, SEQ ID NO: 42)—anti-CD19 scFv—CD8a hinge domain—DNAM1 transmembrane and cytoplasmic domains—2B4 cytoplasmic domain. See e.g., SEQ ID NO: 58 or SEQ ID NO: 93.
  • the CC028 construct (e.g., reverse domain order of CC039, except not including the CD8 signal peptide) comprises the following domains from N terminus to C terminus: NTB-A cytoplasmic domain—NKG2D transmembrane domain—CD8a hinge domain—anti-CD19 scFv—linker (e.g., GGGGS, SEQ ID NO: 42)—3*Flag. See e.g., SEQ ID NO: 59 or SEQ ID NO: 94.
  • the CC029 construct comprises the following domains from N terminus to C terminus: CD8 signal peptide—3*Flag—linker (e.g., GGGGS, SEQ ID NO: 42)—anti-CD19 scFv—CD8a hinge domain—NKp46 transmembrane and cytoplasmic domains—NTB-A cytoplasmic domain. See e.g., SEQ ID NO: 60 or SEQ ID NO: 95.
  • the CC030 construct comprises the following domains from N terminus to C terminus: CD8 signal peptide—3*Flag—linker (e.g., GGGGS, SEQ ID NO: 42)—anti-CD19 scFv—CD8a hinge domain—DNAM1 transmembrane and cytoplasmic domains—CRACC cytoplasmic domain. See e.g., SEQ ID NO: 61 or SEQ ID NO: 96.
  • the CC031 construct (e.g., reverse domain order of CC037, except not including the CD8 signal peptide) comprises the following domains from N terminus to C terminus: CD2 cytoplasmic domain—NKG2D transmembrane domain—CD8a hinge domain—anti-CD19 scFv—linker (e.g., GGGGS, SEQ ID NO: 42)—3*Flag. See e.g., SEQ ID NO: 62 or SEQ ID NO: 97.
  • the CC032 construct comprises the following domains from N terminus to C terminus: CD8 signal peptide—3*Flag—linker (e.g., GGGGS, SEQ ID NO: 42)—anti-CD19 scFv—CD8a hinge domain—NKp46 transmembrane and cytoplasmic domains—2B4 cytoplasmic domain. See e.g., SEQ ID NO: 63 or SEQ ID NO: 98.
  • the CC033 construct comprises the following domains from N terminus to C terminus: CD8 signal peptide—3*Flag—linker (e.g., GGGGS, SEQ ID NO: 42)—anti-CD19 scFv—CD8a hinge domain—NKp46 transmembrane and cytoplasmic domains—CRACC cytoplasmic domain. See e.g., SEQ ID NO: 64 or SEQ ID NO: 99.
  • the CC034 construct comprises the following domains from N terminus to C terminus: CD8 signal peptide—3*Flag—linker (e.g., GGGGS, SEQ ID NO: 42)—anti-CD19 scFv—CD8a hinge domain—DNAM1 transmembrane and cytoplasmic domains—CD2 cytoplasmic domain. See e.g., SEQ ID NO: 65 or SEQ ID NO: 100.
  • the CC035 construct comprises the following domains from N terminus to C terminus: CD8 signal peptide—3*Flag—linker (e.g., GGGGS, SEQ ID NO: 42)—anti-CD19 scFv—CD8a hinge domain—NKG2D transmembrane domain—CRACC cytoplasmic domain. See e.g., SEQ ID NO: 66 or SEQ ID NO: 101.
  • CD8 signal peptide 3*Flag—linker (e.g., GGGGS, SEQ ID NO: 42)—anti-CD19 scFv—CD8a hinge domain—NKG2D transmembrane domain—CRACC cytoplasmic domain. See e.g., SEQ ID NO: 66 or SEQ ID NO: 101.
  • the CC036 (e.g., reverse domain order of CC035, except not including the CD8 signal peptide) construct comprises the following domains from N terminus to C terminus: CRACC cytoplasmic domain—NKG2D transmembrane domain—CD8a hinge domain—anti-CD19 scFv—linker (e.g., GGGGS, SEQ ID NO: 42)—3*Flag. See e.g., SEQ ID NO: 67 or SEQ ID NO: 102.
  • the CC037 construct comprises the following domains from N terminus to C terminus: CD8 signal peptide—3*Flag—linker (e.g., GGGGS, SEQ ID NO: 42)—anti-CD19 scFv—CD8a hinge domain—NKG2D transmembrane domain—CD2 cytoplasmic domain. See e.g., SEQ ID NO: 68 or SEQ ID NO: 103.
  • CD8 signal peptide 3*Flag—linker (e.g., GGGGS, SEQ ID NO: 42)—anti-CD19 scFv—CD8a hinge domain—NKG2D transmembrane domain—CD2 cytoplasmic domain. See e.g., SEQ ID NO: 68 or SEQ ID NO: 103.
  • the CC038 construct comprises the following domains from N terminus to C terminus: CD8 signal peptide—3*Flag—linker (e.g., GGGGS, SEQ ID NO: 42)—anti-CD19 scFv—CD8a hinge domain—DNAM1 transmembrane and cytoplasmic domains—NTB-A cytoplasmic domain. See e.g., SEQ ID NO: 69 or SEQ ID NO: 104.
  • the CC039 construct comprises the following domains from N terminus to C terminus: CD8 signal peptide—3*Flag—linker (e.g., GGGGS, SEQ ID NO: 42)—anti-CD19 scFv—CD8a hinge domain—NKG2D transmembrane domain—NTB-A cytoplasmic domain. See e.g., SEQ ID NO: 70 or SEQ ID NO: 105.
  • CD8 signal peptide 3*Flag—linker (e.g., GGGGS, SEQ ID NO: 42)—anti-CD19 scFv—CD8a hinge domain—NKG2D transmembrane domain—NTB-A cytoplasmic domain. See e.g., SEQ ID NO: 70 or SEQ ID NO: 105.
  • Non-limiting examples of Group II-IV NK CARs that are specific to CD33 include CC124, CC125, CC130, CC135, or CC136, which correspond to polynucleotide SEQ ID NOs: 75-79 and polypeptide SEQ ID NOs: 110-114, respectively. It should be understood that other NK CARs can be generated by switching the CD-33-binding domain for a different tumor antigen- or cell-surface protein-binding domain.
  • the CC124 construct comprises the following domains from N terminus to C terminus: CD8 signal peptide—3*Flag—linker (e.g., GGGGS, SEQ ID NO: 42)—anti-CD33 scFv—CD8a hinge domain—NKG2D transmembrane domain—2B4 cytoplasmic domain. See e.g., SEQ ID NO: 75 or SEQ ID NO: 110.
  • CD8 signal peptide 3*Flag—linker (e.g., GGGGS, SEQ ID NO: 42)—anti-CD33 scFv—CD8a hinge domain—NKG2D transmembrane domain—2B4 cytoplasmic domain. See e.g., SEQ ID NO: 75 or SEQ ID NO: 110.
  • the CC125 construct (e.g., reverse domain order of CC124, except not including the CD8 signal peptide) comprises the following domains from N terminus to C terminus: 2B4 cytoplasmic domain—NKG2D transmembrane domain—CD8a hinge domain—anti-CD33 scFv—linker (e.g., GGGGS, SEQ ID NO: 42)—3*Flag. See e.g., SEQ ID NO: 76 or SEQ ID NO: 111.
  • the CC130 construct comprises the following domains from N terminus to C terminus: CD8 signal peptide—3*Flag—linker (e.g., GGGGS, SEQ ID NO: 42)—anti-CD33 scFv—CD8a hinge domain—DNAM1 transmembrane and cytoplasmic domains—CRACC cytoplasmic domain. See e.g., SEQ ID NO: 77 or SEQ ID NO: 112.
  • the CC135 construct comprises the following domains from N terminus to C terminus: CD8 signal peptide—3*Flag—linker (e.g., GGGGS, SEQ ID NO: 42)—anti-CD33 scFv—CD8a hinge domain—NKG2D transmembrane domain—CRACC cytoplasmic domain. See e.g., SEQ ID NO: 78 or SEQ ID NO: 113.
  • CD8 signal peptide 3*Flag—linker (e.g., GGGGS, SEQ ID NO: 42)—anti-CD33 scFv—CD8a hinge domain—NKG2D transmembrane domain—CRACC cytoplasmic domain. See e.g., SEQ ID NO: 78 or SEQ ID NO: 113.
  • the CC136 construct (e.g., reverse domain order of CC135, except not including the CD8 signal peptide) comprises the following domains from N terminus to C terminus: CRACC cytoplasmic domain—NKG2D transmembrane domain—CD8a hinge domain—anti-CD33 scFv—linker (e.g., GGGGS, SEQ ID NO: 42)—3*Flag. See e.g., SEQ ID NO: 79 or SEQ ID NO: 114.
  • a CAR polynucleotide comprises one of SEQ ID NOs: 45-79 (see e.g., Table 5), or a sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the sequence of one of SEQ ID NOs: 45-79, that as a polypeptide maintains the same functions (e.g., antigen-binding and intracellular signaling; see e.g., SEQ ID NOs: 80-114).
  • Table 5 shows exemplary CAR polynucleotides and the specific order of their extracellular, transmembrane, and intracellular domains.
  • the CAR polynucleotide is a codon-optimized version of SEQ ID NOs: 145-79.
  • the vector or nucleic acid described herein is codon-optimized, e.g., the native or wild-type sequence of the nucleic acid sequence has been altered or engineered to include alternative codons such that altered or engineered nucleic acid encodes the same polypeptide expression product as the native/wild-type sequence, but will be transcribed and/or translated at an improved efficiency in a desired expression system.
  • the expression system is an organism other than the source of the native/wild-type sequence (or a cell obtained from such organism).
  • the vector and/or nucleic acid sequence described herein is codon-optimized for expression in a mammal or mammalian cell, e.g., a mouse, a murine cell, or a human cell. In some embodiments of any of the aspects, the vector and/or nucleic acid sequence described herein is codon-optimized for expression in a human cell. In some embodiments of any of the aspects, the vector and/or nucleic acid sequence described herein is codon-optimized for expression in a yeast or yeast cell. In some embodiments of any of the aspects, the vector and/or nucleic acid sequence described herein is codon-optimized for expression in a bacterial cell. In some embodiments of any of the aspects, the vector and/or nucleic acid sequence described herein is codon-optimized for expression in an E. coli cell.
  • one or more of the genes described herein is expressed in a recombinant expression vector or plasmid.
  • the term “vector” refers to a polynucleotide sequence suitable for transferring transgenes into a host cell.
  • a vector can also include a viral particle that carries such a polynucleotide sequence.
  • Vectors include, for example, plasmids, mini-chromosomes, phage, naked DNA and the like. See, for example, U.S. Pat. Nos.
  • vectors are capable of autonomous replication in a host cell into which they are introduced (e.g., bacterial vectors having a bacterial origin of replication and episomal mammalian vectors).
  • vectors are capable of directing the expression of genes to which they are operatively linked. Such vectors are referred to herein as “expression vectors”.
  • expression vectors of utility in recombinant DNA techniques are often in the form of plasmids.
  • plasmid and “vector” are used interchangeably as the plasmid is the most commonly used form of vector.
  • the technology described herein is intended to include other forms of expression vectors, such as viral vectors (e.g., replication defective retroviruses, adenoviruses and adeno-associated viruses), which serve equivalent functions and facilitate delivery of recombinant constructs to, e.g., NK cells.
  • viral vectors e.g., replication defective retroviruses, adenoviruses and adeno-associated viruses
  • a cloning vector is one which is able to replicate in a host cell or becomes integrated into the genome in a host cell, and which is further characterized by one or more endonuclease restriction sites at which the vector may be cut in a determinable fashion and into which a desired DNA sequence can be ligated such that the new recombinant vector retains its ability to replicate in the host cell.
  • replication of the desired sequence can occur many times as the plasmid increases in copy number within the host cell such as a host bacterium or just a single time per host before the host reproduces by mitosis.
  • replication can occur actively during a lytic phase or passively during a lysogenic phase.
  • An expression vector is one into which a desired DNA sequence can be inserted by restriction and ligation such that it is operably joined to regulatory sequences and can be expressed as an RNA transcript.
  • Vectors can further contain one or more marker sequences suitable for use in the identification of cells which have or have not been transformed or transfected with the vector.
  • Markers include, for example, genes encoding proteins which increase or decrease either resistance or sensitivity to antibiotics or other compounds, genes which encode enzymes whose activities are detectable by standard assays known in the art (e.g., ⁇ -galactosidase, luciferase or alkaline phosphatase), and genes which visibly affect the phenotype of transformed or transfected cells, hosts, colonies or plaques (e.g., green fluorescent protein).
  • the vectors used herein are capable of autonomous replication and expression of the structural gene products present in the DNA segments to which they are operably joined.
  • a coding sequence and regulatory sequences are said to be “operably” joined when they are covalently linked in such a way as to place the expression or transcription of the coding sequence under the influence or control of the regulatory sequences.
  • two DNA sequences are said to be operably joined if induction of a promoter in the 5′ regulatory sequences results in the transcription of the coding sequence and if the nature of the linkage between the two DNA sequences does not (1) result in the introduction of a frame-shift mutation, (2) interfere with the ability of the promoter region to direct the transcription of the coding sequences, or (3) interfere with the ability of the corresponding RNA transcript to be translated into a protein.
  • a promoter region would be operably joined to a coding sequence if the promoter region were capable of effecting transcription of that DNA sequence such that the resulting transcript can be translated into the desired protein or polypeptide.
  • a variety of transcription control sequences can be used to direct its expression.
  • the promoter can be a native promoter, i.e., the promoter of the gene in its endogenous context, which provides normal regulation of expression of the gene.
  • the promoter can be constitutive, i.e., the promoter is unregulated allowing for continual transcription of its associated gene.
  • conditional promoters also can be used, such as promoters controlled by the presence or absence of a molecule.
  • regulatory sequences needed for gene expression can vary between species or cell types, but in general can include, as necessary, 5′ non-transcribed and 5′ non-translated sequences involved with the initiation of transcription and translation respectively, such as a TATA box, capping sequence, CAAT sequence, and the like.
  • 5′ non-transcribed regulatory sequences will include a promoter region which includes a promoter sequence for transcriptional control of the operably joined gene.
  • Regulatory sequences can also include enhancer sequences or upstream activator sequences as desired.
  • the vectors of the invention may optionally include 5′ leader or signal sequences. The choice and design of an appropriate vector is within the ability and discretion of one of ordinary skill in the art.
  • the promoter is a eukaryotic or human constitutive promoter, including but not limited to EF-1alpha, SFFV, CMV, and the like.
  • the vector comprises a human elongation factor-1 alpha (EF-1alpha) promoter, which is a constitutive promoter of human origin that can be used to drive ectopic gene expression in various in vitro and in vivo contexts.
  • the vector comprises a silencing-prone spleen focus forming virus (SFFV) promoter, which can result in a higher level of constitutive transgene expression compared with CMV or EF1 ⁇ promoters.
  • the vector comprises a Kozak sequence (e.g., GCCGCCACC), which is a nucleic acid motif that functions as the protein translation initiation site in eukaryotic mRNA transcripts.
  • RNA heterologous DNA
  • the vector is a lentiviral vector.
  • lentivirus refers to a genus of the Retroviridae family. Lentiviruses are unique among the retroviruses in being able to infect non-dividing cells; they can deliver a significant amount of genetic information into the DNA of the host cell, so they provide one of the most efficient methods of a gene delivery to, e.g., mammalian cells. HIV, SIV, and FIV are all examples of lentiviruses.
  • lentiviral vector refers to a vector derived from at least a portion of a lentivirus genome, including especially a self-inactivating lentiviral vector as provided in Milone et al., Mol. Ther. 17(8): 1453-1464 (2009).
  • Other examples of lentivirus vectors that may be used in the clinic include but are not limited to, e.g., the LENTIVECTOR® gene delivery technology from Oxford BioMedica, the LENTIMAXTM vector system from Lentigen and the like. Nonclinical types of lentiviral vectors are also available and would be known to one skilled in the art.
  • the lentiviral vector comprises a central polypurine tract (cPPT).
  • cPPT central polypurine tract
  • a central polypurine tract/central termination sequence creates a “DNA flap” that increases nuclear importation of the viral genome during target-cell infection.
  • the cPPT/CTS element improves vector integration and transduction efficiency.
  • the lentiviral vector comprises a woodchuck hepatitis virus posttranscriptional regulatory element (WPRE), which prevents poly(A) site read-through, promotes RNA processing and maturation, and increases nuclear export of RNA. In genomic transcripts, it enhances vector packaging and increases titer. In transduced target cells, the WPRE boosts transgene expression by facilitating mRNA transcript maturation.
  • WPRE woodchuck hepatitis virus posttranscriptional regulatory element
  • the vector comprises a selectable marker, e.g., for selectively amplifying the vector in bacteria.
  • selectable marker genes for use in bacteria include antibiotic resistance genes conferring resistance to ampicillin, tetracycline and kanamycin.
  • the tetracycline (tet) and ampicillin (amp) resistance marker genes can be obtained from any of a number of commercially available vectors including pBR322 (available from New England BioLabs, Beverly, Mass., cat. no. 303-3s).
  • the tet coding sequence is contained within nucleotides 86-476; the amp gene is contained within nucleotides 3295-4155.
  • the nucleotide sequence of the kanamycin (kan) gene is available from vector pACYC 177, from New England BioLabs, Cat no. 401-L, GenBank accession No. X06402.
  • one or more of the recombinantly expressed genes can be integrated into the genome of the cell.
  • a nucleic acid molecule that encodes an NK CAR polypeptide as described herein can be introduced into a cell or cells using methods and techniques that are standard in the art.
  • nucleic acid molecules can be introduced by standard protocols such as transformation including chemical transformation and electroporation, transduction, particle bombardment, etc.
  • Expressing the nucleic acid molecule encoding the NK CAR polypeptide as described herein also may be accomplished by integrating the nucleic acid molecule into the genome.
  • a cell or population thereof comprising at least one NK CAR polypeptide as described herein.
  • a cell e.g., an NK cell
  • a cell engineered to express a CAR, wherein the CAR NK cell exhibits an antitumor property.
  • a cell is transformed with the CAR and the CAR is expressed on the cell surface.
  • the cell e.g., NK cell
  • the cell is transduced with a viral vector encoding a CAR.
  • the viral vector is a retroviral vector.
  • the viral vector is a lentiviral vector.
  • the cell may stably express the CAR.
  • the cell e.g., NK cell
  • a nucleic acid e.g., mRNA, cDNA, DNA, encoding a CAR.
  • the cell may transiently express the CAR.
  • the cell comprises an immune cell.
  • the immune cell comprises a natural killer (NK) cell, a CD4+ T cell, a CD8+ T cell, or a regulatory T cell (Treg).
  • the immune cell comprises a natural killer (NK) cell.
  • the cells are isolated from a subject.
  • isolated signifies that the cells are placed into conditions other than their natural environment. The term “isolated” does not preclude the later use of these cells thereafter in combinations or mixtures with other cells.
  • an immune cell e.g., NK cell
  • an immune cell is: (a) isolated from the subject; (b) genetically modified to express a CAR polypeptide as described herein; and (c) administered to the subject.
  • the cells are isolated from a first subject and administered to a second subject.
  • the immune cells are first differentiated from a somatic cell sample from the subject and then genetically modified to express a CAR polypeptide as described herein.
  • the immune cells e.g., NK cells
  • the immune cells are differentiated from induced pluripotent stem cells derived from an individual, e.g., from an individual to whom the CAR-expressing NK cells as described herein will be administered.
  • methods of genetically modifying a cell to express a CAR can comprise but are not limited to: transfection or electroporation of a cell with a vector encoding a CAR; transduction with a viral vector (e.g., retrovirus, lentivirus) encoding a CAR; gene editing using zinc finger nucleases (ZFNs), transcription activator-like effector nucleases (TALENs), meganuclease-TALENs, or CRISPR-Cas; or any other methods known in the art of genetically modifying a cell to express a CAR.
  • a viral vector e.g., retrovirus, lentivirus
  • ZFNs zinc finger nucleases
  • TALENs transcription activator-like effector nucleases
  • meganuclease-TALENs or CRISPR-Cas
  • the methods described herein relate to treating a subject having or diagnosed as having a disease or disorder (e.g., cancer, infectious disease, etc.) with a NK CAR polypeptide as described herein.
  • a disease or disorder e.g., cancer, infectious disease, etc.
  • Subjects having such a disease or disorder can be identified by a physician using current methods of diagnosis for cancer or infectious disease. Symptoms and/or complications which characterize these conditions and aid in diagnosis are known in the art.
  • a family history of cancer or infectious disease, or exposure to risk factors for cancer or infectious disease can also aid in determining if a subject is likely to have such a disease or disorder, or in making a diagnosis of cancer or infectious disease.
  • compositions described herein can be administered to a subject having or diagnosed as having cancer or infectious disease.
  • the methods described herein comprise administering an effective amount of a composition as described herein, e.g. a CAR polypeptide as described herein to a subject in order to alleviate a symptom of cancer or infectious disease.
  • a composition as described herein e.g. a CAR polypeptide as described herein
  • Alleviating a symptom is ameliorating any condition or symptom associated with the cancer or infectious disease. As compared with an equivalent untreated control, such reduction is by at least 5%, 10%, 20%, 40%, 50%, 60%, 80%, 90%, 95%, 99% or more as measured by any standard technique.
  • An agent can be administered intravenously by injection or by gradual infusion over time.
  • agents useful in the methods and compositions described herein can be administered intravenously, intraperitoneally, intramuscularly, subcutaneously, intracavity, intratumorally, and can be delivered by peristaltic means, if desired, or by other means known by those skilled in the art.
  • Local administration e.g., directly to the site of a tumor or lesion is specifically contemplated.
  • compositions containing at least one agent can be conventionally administered in a unit dose, for example.
  • unit dose when used in reference to a therapeutic composition refers to physically discrete units suitable as unitary dosage for the subject, each unit containing a predetermined quantity of active material calculated to produce the desired therapeutic effect in association with the required physiologically acceptable diluent, i.e., carrier, or vehicle.
  • compositions are administered in a manner compatible with the dosage formulation, and in a therapeutically effective amount.
  • the quantity to be administered and timing depends on the subject to be treated, capacity of the subject's system to utilize the active ingredient, and degree of therapeutic effect desired.
  • the term “effective amount” as used herein refers to the amount of CAR-expressing NK cells as described herein needed to alleviate at least one or more symptom of the disease or disorder, and relates to a sufficient amount of pharmacological composition to provide the desired effect.
  • the term “therapeutically effective amount” therefore refers to an amount of CAR-expressing NK cells as described herein that is sufficient to provide a particular anti-tumor effect (or anti-infectious disease effect) when administered to a typical subject.
  • an effective amount as used herein, in various contexts, would also include an amount sufficient to delay the development of a symptom of the disease, alter the course of a symptom disease (for example but not limited to, slowing the progression of a symptom of the disease), or reverse a symptom of the disease. Thus, it is not generally practicable to specify an exact “effective amount”. However, for any given case, an appropriate “effective amount” can be determined by one of ordinary skill in the art using only routine experimentation.
  • Effective amounts, toxicity, and therapeutic efficacy can be determined by standard procedures in cell cultures or experimental animals, e.g., for determining the minimal effective dose and/or maximal tolerated dose.
  • the dosage can vary depending upon the dosage form employed and the route of administration utilized (e.g., systemic vs intratumoral).
  • a therapeutically effective dose can be estimated initially from cell culture assays.
  • a dose can be formulated in animal models to achieve a dosage range between the minimal effective dose and the maximal tolerated dose.
  • the effects of any particular dosage can be monitored by a suitable bioassay, e.g., assay for tumor growth and/or size among others.
  • the dosage can be determined by a physician and adjusted, as necessary, to suit observed effects of the treatment.
  • a pharmaceutical composition comprising the cells, e.g., NK CAR cells, described herein may be administered at a dosage of 10 2 to 10 10 cells/kg body weight, preferably 10 5 to 10 6 cells/kg body weight, including all integer values within those ranges.
  • the number of cells will depend upon the ultimate use for which the composition is intended as will the type of cells included therein.
  • the cells are generally in a volume of a liter or less, can be 500 mLs or less, even 250 mLs or 100 mLs or less.
  • the density of the desired cells is typically greater than 10 6 cells/ml and generally is greater than 10 7 cells/ml, generally 10 8 cells/ml or greater.
  • the clinically relevant number of immune cells can be apportioned into multiple infusions that cumulatively equal or exceed 10 5 , 10 6 , 10 7 , 10 8 , 10 9 , 10 10 , 10 11 , or 10 12 cells.
  • lower numbers of cells in the range of 10 6 /kilogram (10 6 -10 11 per patient) may be administered.
  • the dosage can be from about 1 ⁇ 10 5 cells to about 1 ⁇ 10 8 cells per kg of body weight.
  • the dosage can be from about 1 ⁇ 10 6 cells to about 1 ⁇ 10 7 cells per kg of body weight.
  • the dosage can be about 1 ⁇ 10 6 cells per kg of body weight.
  • CAR expressing cell compositions may be administered multiple times at dosages within these ranges.
  • the cells may be allogeneic, syngeneic, xenogeneic, or autologous to the patient undergoing therapy.
  • the treatment may also include administration of mitogens (e.g., PHA) or lymphokines, cytokines, and/or chemokines (e.g., IL-10, IL-12, IL-15, IL-18, IL-21, IFN- ⁇ , GM-CSF, TGF- ⁇ , TNF- ⁇ , and IFN- ⁇ etc.) as described herein to enhance induction of the immune response.
  • one dose of cells can be administered.
  • the dose of cells can be repeated, e.g., once, twice, or more.
  • the dose of cells can be administered on, e.g., a daily, weekly, or monthly basis.
  • the dose can be administered intravenously.
  • the intravenous administration can be an infusion occurring over a period of from about 10 minutes to about 3 hours. In some embodiments, the intravenous administration can be an infusion occurring over a period of from about 30 minutes to about 90 minutes.
  • the dose can be administered about weekly. In some embodiments, the dose can be administered weekly. In some embodiments, the dose can be administered weekly for from about 12 weeks to about 18 weeks. In some embodiments the dose can be administered about every 2 weeks. In some embodiments the dose can be administered about every 3 weeks. In some embodiments, a total of from about 2 to about 10 doses are administered. In some embodiments, a total of 4 doses are administered. In some embodiments, a total of 5 doses are administered. In some embodiments, a total of 6 doses are administered. In some embodiments, a total of 7 doses are administered. In some embodiments, a total of 8 doses are administered. In some embodiments, the administration occurs for a total of from about 4 weeks to about 12 weeks.
  • the administration occurs for a total of about 6 weeks. In some embodiments, the administration occurs for a total of about 8 weeks. In some embodiments, the administration occurs for a total of about 12 weeks. In some embodiments, the initial dose can be from about 1.5 to about 2.5 fold greater than subsequent doses.
  • Treatment according to the methods described herein can reduce levels of a marker or symptom of a condition, e.g. by at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80% or at least 90% or more.
  • the dosage of a composition as described herein can be determined by a physician and adjusted, as necessary, to suit observed effects of the treatment. With respect to duration and frequency of treatment, it is typical for skilled clinicians to monitor subjects in order to determine when the treatment is providing therapeutic benefit, and to determine whether to increase or decrease dosage, increase or decrease administration frequency, discontinue treatment, resume treatment, or make other alterations to the treatment regimen.
  • the dosage ranges for the administration of a CAR composition or NK CAR cell composition, according to the methods described herein depend upon, for example, the form of the CAR composition, its potency, and the extent to which symptoms, markers, or indicators of a condition described herein are desired to be reduced, for example the percentage reduction desired for the disease or disorder (e.g., cancer or infectious disease).
  • the dosage should not be so large as to cause adverse side effects, such as autoimmunity.
  • the dosage will vary with the age, condition, and sex of the patient and can be determined by one of skill in the art.
  • the dosage can also be adjusted by the individual physician in the event of any complication.
  • the efficacy of a CAR composition in, e.g. the treatment of a condition described herein can be determined by the skilled clinician. However, a treatment is considered “effective treatment,” as the term is used herein, if one or more of the signs or symptoms of a condition described herein are altered in a beneficial manner, other clinically accepted symptoms are improved, or even ameliorated, or a desired response is induced e.g., by at least 10% following treatment according to the methods described herein. Efficacy can be assessed, for example, by measuring a marker, indicator, symptom, and/or the incidence of a condition treated according to the methods described herein or any other measurable parameter appropriate, e.g. tumor size.
  • Treatment includes any treatment of a disease in an individual or an animal (some non-limiting examples include a human or an animal) and includes: (1) inhibiting the disease, e.g., preventing a worsening of symptoms (e.g. pain or inflammation); or (2) relieving the severity of the disease, e.g., causing regression of symptoms.
  • An effective amount for the treatment of a disease means that amount which, when administered to a subject in need thereof, is sufficient to result in effective treatment as that term is defined herein, for that disease.
  • Efficacy of an agent can be determined by assessing physical indicators of a condition or desired response, (e.g., tumor size, or pathogen titer, or antibody titer). It is well within the ability of one skilled in the art to monitor efficacy of administration and/or treatment by measuring any one of such parameters, or any combination of parameters. Efficacy can be assessed in animal models of a condition described herein, for example treatment of cancer. When using an experimental animal model, efficacy of treatment is evidenced when a statistically significant change in a marker is observed, e.g. tumor size, pathogen titer, or antibody titer.
  • In vitro and animal model assays are provided herein which allow the assessment of a given dose of a CAR composition.
  • the efficacy of a given dosage combination can also be assessed in an animal model, e.g. a specific cancer animal model.
  • a pharmaceutical composition comprising the at least one CAR polypeptide, CAR polynucleotide, CAR vector, or CAR-comprising cell as described herein, which are collectively referred to as a “CAR composition”.
  • the pharmaceutical composition can comprise any combination of CAR polypeptides described herein.
  • the technology described herein relates to a pharmaceutical composition
  • a pharmaceutical composition comprising a CAR composition as described herein, and optionally a pharmaceutically acceptable carrier.
  • the active ingredients of the pharmaceutical composition comprise the CAR polypeptide as described herein.
  • Pharmaceutically acceptable carriers and diluents include saline, aqueous buffer solutions, solvents and/or dispersion media. The use of such carriers and diluents is well known in the art.
  • materials which can serve as pharmaceutically-acceptable carriers include: (1) sugars, such as lactose, glucose and sucrose; (2) starches, such as corn starch and potato starch; (3) cellulose, and its derivatives, such as sodium carboxymethyl cellulose, methylcellulose, ethyl cellulose, microcrystalline cellulose and cellulose acetate; (4) powdered tragacanth; (5) malt; (6) gelatin; (7) lubricating agents, such as magnesium stearate, sodium lauryl sulfate and talc; (8) excipients, such as cocoa butter and suppository waxes; (9) oils, such as peanut oil, cottonseed oil, safflower oil, sesame oil, olive oil, corn oil and soybean oil; (10) glycols, such as propylene glycol; (11) polyols, such as glycerin, sorbitol, mannitol and polyethylene glycol (PEG); (12) esters, such as e
  • wetting agents, coloring agents, release agents, coating agents, sweetening agents, flavoring agents, perfuming agents, preservative and antioxidants can also be present in the formulation.
  • excipient e.g. the CAR polypeptide as described herein.
  • the pharmaceutical composition comprising a CAR composition as described herein can be a parenteral dose form. Since administration of parenteral dosage forms typically bypasses the patient's natural defenses against contaminants, parenteral dosage forms are preferably sterile or capable of being sterilized prior to administration to a patient. Examples of parenteral dosage forms include, but are not limited to, solutions ready for injection, dry products ready to be dissolved or suspended in a pharmaceutically acceptable vehicle for injection, suspensions ready for injection, and emulsions. In addition, controlled-release parenteral dosage forms can be prepared for administration of a patient, including, but not limited to, DUROS®-type dosage forms and dose-dumping.
  • Suitable vehicles that can be used to provide parenteral dosage forms of CAR compositions as disclosed within are well known to those skilled in the art. Examples include, without limitation: sterile water; water for injection USP; saline solution; glucose solution; aqueous vehicles such as but not limited to, sodium chloride injection, Ringer's injection, dextrose Injection, dextrose and sodium chloride injection, and lactated Ringer's injection; water-miscible vehicles such as, but not limited to, ethyl alcohol, polyethylene glycol, and propylene glycol; and non-aqueous vehicles such as, but not limited to, corn oil, cottonseed oil, peanut oil, sesame oil, ethyl oleate, isopropyl myristate, and benzyl benzoate.
  • compositions comprising CAR compositions can also be formulated to be suitable for oral administration, for example as discrete dosage forms, such as, but not limited to, tablets (including without limitation scored or coated tablets), pills, caplets, capsules, chewable tablets, powder packets, cachets, troches, wafers, aerosol sprays, or liquids, such as but not limited to, syrups, elixirs, solutions or suspensions in an aqueous liquid, a non-aqueous liquid, an oil-in-water emulsion, or a water-in-oil emulsion.
  • Such compositions contain a predetermined amount of the pharmaceutically acceptable salt of the disclosed compounds, and may be prepared by methods of pharmacy well known to those skilled in the art. See generally, Remington: The Science and Practice of Pharmacy, 21st Ed., Lippincott, Williams, and Wilkins, Philadelphia PA. (2005).
  • Conventional dosage forms generally provide rapid or immediate drug release from the formulation. Depending on the pharmacology and pharmacokinetics of the drug, use of conventional dosage forms can lead to wide fluctuations in the concentrations of the drug in a patient's blood and other tissues. These fluctuations can impact a number of parameters, such as dose frequency, onset of action, duration of efficacy, maintenance of therapeutic blood levels, toxicity, side effects, and the like.
  • controlled-release formulations can be used to control a drug's onset of action, duration of action, plasma levels within the therapeutic window, and peak blood levels.
  • controlled- or extended-release dosage forms or formulations can be used to ensure that the maximum effectiveness of a drug is achieved while minimizing potential adverse effects and safety concerns, which can occur both from under-dosing a drug (i.e., going below the minimum therapeutic levels) as well as exceeding the toxicity level for the drug.
  • the composition can be administered in a sustained release formulation.
  • Controlled-release pharmaceutical products have a common goal of improving drug therapy over that achieved by their non-controlled release counterparts.
  • the use of an optimally designed controlled-release preparation in medical treatment is characterized by a minimum of drug substance being employed to cure or control the condition in a minimum amount of time.
  • Advantages of controlled-release formulations include: 1) extended activity of the drug; 2) reduced dosage frequency; 3) increased patient compliance; 4) usage of less total drug; 5) reduction in local or systemic side effects; 6) minimization of drug accumulation; 7) reduction in blood level fluctuations; 8) improvement in efficacy of treatment; 9) reduction of potentiation or loss of drug activity; and 10) improvement in speed of control of diseases or conditions. Kim, Cherng-ju, Controlled Release Dosage Form Design, 2 (Technomic Publishing, Lancaster, Pa.: 2000).
  • Controlled-release formulations are designed to initially release an amount of drug (active ingredient) that promptly produces the desired therapeutic effect, and gradually and continually release other amounts of drug to maintain this level of therapeutic or prophylactic effect over an extended period of time. In order to maintain this constant level of drug in the body, the drug must be released from the dosage form at a rate that will replace the amount of drug being metabolized and excreted from the body.
  • Controlled-release of an active ingredient can be stimulated by various conditions including, but not limited to, pH, ionic strength, osmotic pressure, temperature, enzymes, water, and other physiological conditions or compounds.
  • a variety of known controlled- or extended-release dosage forms, formulations, and devices can be adapted for use with the salts and compositions of the disclosure. Examples include, but are not limited to, those described in U.S. Pat. Nos. 3,845,770; 3,916,899; 3,536,809; 3,598,123; 4,008,719; 5,674,533; 5,059,595; 5,591,767; 5,120,548; 5,073,543; 5,639,476; 5,354,556; 5,733,566; and 6,365,185 B1; each of which is incorporated herein by reference.
  • dosage forms can be used to provide slow or controlled-release of one or more active ingredients using, for example, hydroxypropylmethyl cellulose, other polymer matrices, gels, permeable membranes, osmotic systems (such as OROS® (Alza Corporation, Mountain View, Calif. USA)), or a combination thereof to provide the desired release profile in varying proportions.
  • active ingredients for example, hydroxypropylmethyl cellulose, other polymer matrices, gels, permeable membranes, osmotic systems (such as OROS® (Alza Corporation, Mountain View, Calif. USA)), or a combination thereof to provide the desired release profile in varying proportions.
  • OROS® Alza Corporation, Mountain View, Calif. USA
  • the CAR composition described herein is administered as a monotherapy, e.g., another treatment for the disease or disorder (e.g., cancer) is not administered to the subject.
  • a monotherapy e.g., another treatment for the disease or disorder (e.g., cancer) is not administered to the subject.
  • the methods described herein can further comprise administering a second agent and/or treatment to the subject, e.g. as part of a combinatorial therapy.
  • a second agent and/or treatment can include radiation therapy, surgery, gemcitabine, cisplatin, paclitaxel, carboplatin, bortezomib, AMG479, vorinostat, rituximab, temozolomide, rapamycin, ABT-737, PI-103; alkylating agents such as thiotepa and CYTOXAN® cyclophosphamide; alkyl sulfonates such as busulfan, improsulfan and piposulfan; aziridines such as benzodopa, carboquone, meturedopa, and uredopa; ethylenimines and methylmelamines including altretamine, triethylenemelamine, trietylenephosphor
  • dynemicin including dynemicin A; bisphosphonates, such as clodronate; an esperamicin; as well as neocarzinostatin chromophore and related chromoprotein enediyne antibiotic chromophores), aclacinomycins, actinomycin, authramycin, azaserine, bleomycins, cactinomycin, carabicin, caminomycin, carzinophilin, chromomycins, dactinomycin, daunorubicin, detorubicin, 6-diazo-5-oxo-L-norleucine, ADRIAMYCIN® doxorubicin (including morpholino-doxorubicin, cyanomorpholino-doxorubicin, 2-pyrrolino-doxorubicin and deoxydoxorubicin), epirubicin,
  • chemotherapeutic agent of use e.g. see Physicians' Cancer Chemotherapy Drug Manual 2014, Edward Chu, Vincent T. DeVita Jr., Jones & Bartlett Learning; Principles of Cancer Therapy, Chapter 85 in Harrison's Principles of Internal Medicine, 18th edition; Therapeutic Targeting of Cancer Cells: Era of Molecularly Targeted Agents and Cancer Pharmacology, Chs. 28-29 in Abeloff's Clinical Oncology, 2013 Elsevier; and Fischer D S (ed): The Cancer Chemotherapy Handbook, 4th ed. St. Louis, Mosby-Year Book, 2003).
  • the methods of treatment can further include the use of radiation or radiation therapy. Further, the methods of treatment can further include the use of surgical treatments.
  • the subject is administered a CAR composition and an antimicrobial agent.
  • an antimicrobial agent also referred to herein as an antimicrobial, antimicrobial therapeutic, and the like refers to a molecule or composition which destroys microbes (i.e., bacteria, fungi, viruses, parasites and microbial spores) or prevents or inhibits their development, proliferation and/or pathogenic action.
  • microbes i.e., bacteria, fungi, viruses, parasites and microbial spores
  • the term “antimicrobial” thus comprises antibacterials, antifungals, and antivirals.
  • antimicrobial agents include, but are not limited to, small organic or inorganic molecules; peptides; proteins; peptide analogs and derivatives; peptidomimetics; antibodies (polyclonal or monoclonal); antigen binding fragments of antibodies; nucleic acids; nucleic acid analogs and derivatives; an extract made from biological materials such as bacteria, plants, fungi, or animal cells; animal tissues; naturally occurring or synthetic compositions; and any combinations thereof.
  • the antimicrobial agent can be selected from aminoglycosides, ansamycins, beta-lactams, bis-biguanides, carbacephems, carbapenems, cationic polypeptides, cephalosporins, fluoroquinolones, glycopeptides, iron-sequestering glycoproteins, linosamides, lipopeptides, macrolides, monobactams, nitrofurans, oxazolidinones, penicillins, polypeptides, quaternary ammonium compounds, quinolones, silver compounds, sulfonamides, tetracyclines, and any combinations thereof.
  • the antimicrobial agent can comprise an antibiotic.
  • the subject is administered a CAR composition and an antibacterial.
  • Some exemplary specific antibacterials include broad penicillins, amoxicillin (e.g., Ampicillin, Bacampicillin, Carbenicillin Indanyl, Mezlocillin, Piperacillin, Ticarcillin), Penicillins and Beta Lactamase Inhibitors (e.g., Amoxicillin-Clavulanic Acid, Ampicillin-Sulbactam, Benzylpenicillin, Cloxacillin, Dicloxacillin, Methicillin, Oxacillin, Penicillin G, Penicillin V, Piperacillin Tazobactam, Ticarcillin Clavulanic Acid, Nafcillin), Cephalosporins (e.g., Cephalosporin I Generation, Cefadroxil, Cefazolin, Cephalexin, Cephalothin, Cephapirin, Cephradine), Cephalosporin II Generation (e.g., Cefaclor
  • the subject is administered a CAR composition and an antiviral.
  • the antiviral is selected from the group consisting of: abacavir, acyclovir, adefovir, amantadine, ampligen, amprenavir, antiretroviral, arbidol, atazanavir, atripla, cidofovir, combivir, darunavir, delavirdine, didanosine, docosanol, dolutegravir, ecoliever, edoxudine, efavirenz, emtricitabine, enfuvirtide, entecavir, famciclovir, favipiravir, fomivirsen, fosamprenavir, foscarnet, fosfonet, fusion inhibitor, ganciclovir, hydroxychloroquine, ibacitabine, idoxuridine, imiquimod, im
  • the NK CAR compositions described herein can be administered to a subject in need thereof, in particular the treatment of cancer.
  • the CAR compositions described herein can be administered for the treatment of cancer or infectious disease.
  • Infectious diseases that can be treated with the CAR compositions described herein include any microorganism with a specific microbial antigen that can be targeted; the infectious diseases can be viral or bacterial infections.
  • the method of treatment can comprise first diagnosing a subject or patient who can benefit from treatment by a composition described herein.
  • diagnosis comprises detecting or measuring an abnormal level of a marker (e.g., the tumor antigens as described herein or antigens from a virus or bacteria) in a sample from the subject or patient.
  • the method further comprises administering to the patient a CAR composition as described herein.
  • the subject has previously been determined to have an abnormal level of an analyte described herein relative to a reference.
  • the reference level can be the level in a sample of similar cell type, sample type, sample processing, and/or obtained from a subject of similar age, sex and other demographic parameters as the sample/subject.
  • the test sample and control reference sample are of the same type, that is, obtained from the same biological source, and comprising the same composition, e.g. the same number and type of cells.
  • sample or “test sample” as used herein denotes a sample taken or isolated from a biological organism, e.g., a blood or plasma sample from a subject.
  • the technology described herein encompasses several examples of a biological sample.
  • the biological sample is cells, or tissue, or peripheral blood, or bodily fluid.
  • Exemplary biological samples include, but are not limited to, a biopsy, a tumor sample, biofluid sample; blood; serum; plasma; urine; sperm; mucus; tissue biopsy; organ biopsy; synovial fluid; bile fluid; cerebrospinal fluid; mucosal secretion; effusion; sweat; saliva; and/or tissue sample etc.
  • the term also includes a mixture of the above-mentioned samples.
  • test sample also includes untreated or pretreated (or pre-processed) biological samples.
  • a test sample can comprise cells from a subject.
  • the step of determining if the subject has an abnormal level of an analyte described herein can comprise i) obtaining or having obtained a sample from the subject and ii) performing or having performed an assay on the sample obtained from the subject to determine/measure the level of the analyte in the subject. In some embodiments of any of the aspects, the step of determining if the subject has an abnormal level of an analyte described herein can comprise performing or having performed an assay on a sample obtained from the subject to determine/measure the level of analyte in the subject.
  • the step of determining if the subject has an abnormal level of an analyte described herein can comprise ordering or requesting an assay on a sample obtained from the subject to determine/measure the level of the analyte in the subject. In some embodiments of any of the aspects, the step of determining if the subject has an abnormal level of an analyte described herein can comprise receiving the results of an assay on a sample obtained from the subject to determine/measure the level of the analyte in the subject.
  • the step of determining if the subject has an abnormal level of an analyte described herein can comprise receiving a report, results, or other means of identifying the subject as a subject with a decreased level of the analyte.
  • described herein is a method of treating a subject in need of a CAR-based therapy comprising administering to the subject a therapeutically effective amount of the CAR-based therapy selected from the group consisting of: a NK CAR polypeptide as described herein, a NK CAR polynucleotide as described herein, a NK CAR vector as described herein, a NK CAR lentivirus as described herein, a NK CAR cell or population thereof as described herein, or a NK CAR pharmaceutical composition as described herein.
  • described herein is a method of treating cancer or an infectious disease in a subject in need thereof, the method comprising: a) determining if the subject has an abnormal level of an analyte (e.g., a tumoral, viral, or bacterial antigen as described herein); and b) instructing or directing that the subject be administered a CAR composition as described herein if the level of the analyte is increased or otherwise abnormal relative to a reference.
  • the step of instructing or directing that the subject be administered a particular treatment can comprise providing a report of the assay results.
  • the step of instructing or directing that the subject be administered a particular treatment can comprise providing a report of the assay results and/or treatment recommendations in view of the assay results.
  • the administration of the CAR-based therapy results in increased specific lysis of cancer cells targeted by the CAR.
  • the administration of the CAR-based therapy results in increased specific lysis of infected cells targeted by the CAR.
  • a method of increasing the activation of an NK cell or population thereof comprising contacting the cell or population thereof with a NK CAR polypeptide as described herein, a NK CAR polynucleotide as described herein, a NK CAR vector as described herein, or a NK CAR lentivirus as described herein.
  • contacting the NK cell or population thereof with the polypeptide, polynucleotide, vector, or lentivirus increases the activity of the NK cell by at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 100%, at least 200%, at least 300%, at least 400%, or at least 500% compared to prior to contacting with the polypeptide, polynucleotide, vector, or lentivirus.
  • the increased activation of the NK cell or population thereof comprises increased expression of a cytokine or granzyme selected from the group consisting of TNF ⁇ , IFN ⁇ , GM-CSF, and Granzyme B.
  • the increased activation of the NK cell or population thereof results in an increased specific lysis of a target cell.
  • the target cell expresses a surface antigen that binds specifically to the extracellular binding domain of the polypeptide.
  • the target cell is a cancer cell.
  • the target cell is a cell infected by a virus or bacteria.
  • a method of making a therapeutic composition comprising introducing a NK CAR polypeptide as described herein, a NK CAR polynucleotide as described herein, a NK CAR vector as described herein, or a NK CAR lentivirus as described herein to an NK cell under conditions permitting expression of the NK CAR polypeptide in the cell.
  • the NK cell prior to introducing the nucleic acid, polynucleotide, vector, or lentivirus, the NK cell is removed from a subject in need of the therapeutic composition. In some embodiments of any of the aspects, after introducing the nucleic acid, polynucleotide, vector, or lentivirus, the NK cell is returned to the subject.
  • CAR polypeptides as described herein can be used to treat cancer.
  • cancer relates generally to a class of diseases or conditions in which abnormal cells divide without control and can invade nearby tissues. Cancer cells can also spread to other parts of the body through the blood and lymph systems.
  • Carcinoma is a cancer that begins in the skin or in tissues that line or cover internal organs.
  • Sarcoma is a cancer that begins in bone, cartilage, fat, muscle, blood vessels, or other connective or supportive tissue.
  • Leukemia is a cancer that starts in blood-forming tissue such as the bone marrow, and causes large numbers of abnormal blood cells to be produced and enter the blood.
  • Lymphoma and multiple myeloma are cancers that begin in the cells of the immune system.
  • Central nervous system cancers are cancers that begin in the tissues of the brain and spinal cord.
  • the cancer is a primary cancer. In some embodiments of any of the aspects, the cancer is a malignant cancer.
  • malignant refers to a cancer in which a group of tumor cells display one or more of uncontrolled growth (i.e., division beyond normal limits), invasion (i.e., intrusion on and destruction of adjacent tissues), and metastasis (i.e., spread to other locations in the body via lymph or blood).
  • metastasize refers to the spread of cancer from one part of the body to another.
  • a tumor formed by cells that have spread is called a “metastatic tumor” or a “metastasis.”
  • the metastatic tumor contains cells that are like those in the original (primary) tumor.
  • the term “benign” or “non-malignant” refers to tumors that may grow larger but do not spread to other parts of the body. Benign tumors are self-limited and typically do not invade or metastasize.
  • a “cancer cell” or “tumor cell” refers to an individual cell of a cancerous growth or tissue.
  • a tumor refers generally to a swelling or lesion formed by an abnormal growth of cells, which may be benign, pre-malignant, or malignant. Most cancer cells form tumors, but some, e.g., leukemia, do not necessarily form tumors. For those cancer cells that form tumors, the terms cancer (cell) and tumor (cell) are used interchangeably.
  • neoplasm refers to any new and abnormal growth of tissue, e.g., an abnormal mass of tissue, the growth of which exceeds and is uncoordinated with that of the normal tissues.
  • a neoplasm can be a benign neoplasm, premalignant neoplasm, or a malignant neoplasm.
  • a subject that has a cancer or a tumor is a subject having objectively measurable cancer cells present in the subject's body. Included in this definition are malignant, actively proliferative cancers, as well as potentially dormant tumors or micrometastases. Cancers which migrate from their original location and seed other vital organs can eventually lead to the death of the subject through the functional deterioration of the affected organs.
  • cancer examples include but are not limited to, carcinoma, lymphoma, blastoma, sarcoma, leukemia, basal cell carcinoma, biliary tract cancer; bladder cancer; bone cancer; brain and CNS cancer; breast cancer; cancer of the peritoneum; cervical cancer; choriocarcinoma; colon and rectum cancer; connective tissue cancer; cancer of the digestive system; endometrial cancer; esophageal cancer; eye cancer; cancer of the head and neck; gastric cancer (including gastrointestinal cancer); glioblastoma (GBM); hepatic carcinoma; hepatoma; intra-epithelial neoplasm; kidney or renal cancer; larynx cancer; leukemia; liver cancer; lung cancer (e.g., small-cell lung cancer, non-small cell lung cancer, adenocarcinoma of the lung, and squamous carcinoma of the lung); lymphoma including Hodgkin's and non-Hodgkin's lymphoma; mela
  • the subject has or has been diagnosed with adrenal cancer, anal cancer, appendix cancer, bile duct cancer, bladder cancer, bone cancer, brain cancer, breast cancer, cervical cancer, colorectal cancer, gallbladder cancer, gestational trophoblastic disease, head and neck cancer, Hodgkin lymphoma, intestinal cancer, kidney cancer, leukemia, liver cancer, lung cancer, melanoma, Merkel cell carcinoma, mesothelioma, multiple myeloma, neuroendocrine tumors, Non-Hodgkin lymphoma, oral cancer, ovarian cancer, pancreatic cancer, prostate cancer, sinus cancer, skin cancer, a sarcoma, a soft tissue sarcoma, spinal cancer, stomach cancer, testicular cancer, throat cancer, a tumor, thyroid cancer, uterine cancer, vaginal cancer or vulvar cancer.
  • a “cancer cell” is a cancerous, pre-cancerous, or transformed cell, either in vivo, ex vivo, or in tissue culture, that has spontaneous or induced phenotypic changes that do not necessarily involve the uptake of new genetic material.
  • transformation can arise from infection with a transforming virus and incorporation of new genomic nucleic acid, or uptake of exogenous nucleic acid, it can also arise spontaneously or following exposure to a carcinogen, thereby mutating an endogenous gene.
  • Transformation/cancer is associated with, e.g., morphological changes, immortalization of cells, aberrant growth control, foci formation, anchorage independence, malignancy, loss of contact inhibition and density limitation of growth, growth factor or serum independence, tumor specific markers, invasiveness or metastasis, and tumor growth in suitable animal hosts such as nude mice.
  • CAR polypeptides as described herein can be used to treat an infectious disease.
  • the infectious disease is a bacterial infection.
  • the infectious disease is a viral infection.
  • Non-limiting examples of pathogenic bacteria include spirochetes (e.g. Borrelia ), actinomycetes (e.g. Actinomyces ), mycoplasmas, Rickettsias, Gram negative aerobic rods, Gram negative aerobic cocci, Gram negatively facultatively anaerobic rods (e.g. Erwinia and Yersinia ), Gram-negative cocci, Gram negative coccobacilli, Gram positive cocci (e.g. Staphylococcus and Streptococcus ), endospore-forming rods, and endospore-forming cocci.
  • spirochetes e.g. Borrelia
  • actinomycetes e.g. Actinomyces
  • mycoplasmas e.g. Actinomyces
  • Rickettsias e.g. Actinomyces
  • Gram negative aerobic rods e.g. Gram negative aerobic cocci
  • bacterial pathogens include those belonging to the genera Bacillus, Brucella, Burkholderia, Francisella, Yersinia, Streptococcus, Haemophilus, Nisseria, Listeria, Clostridium, Klebsiella, Legionella, Escherichia (e.g., E. coli ), Mycobacterium, Staphylococcus, Campylobacter, Vibrio , and Salmonella , as well as drug and multidrug resistant strains and highly virulent strains of these pathogenic bacteria.
  • Non-limiting examples of known food-borne bacterial pathogens include those belonging to the genera Salmonella, Clostridium, Campylobacter spp., Staphylococcus, Salmonella, Escherichia (e.g., E. coli ), and Listeria .
  • non-limiting examples of bacterial pathogens include Bacillus anthracis, Brucella abortus, Brucella melitensis, Brucella suis, Burkholderia mallei, Burkholderia pseudomallei, Francisella tularensis, Yersinia pestis, Streptococcus Group A and B, MRSA, Streptococcus pneumonia, Haemophilus influenza, Neisseria meningitides, Listeria monocytegenes, Clostridium difficile, Klebsiella , highly virulent pathogenic strains of E.
  • non-limiting examples of known food-borne bacterial pathogens include Salmonella , non typhoidal Clostridium perfringens, Campylobacter spp., Staphylococcus aureus, Salmonella , nontyphoidal, Campylobacter spp., E. coli (STEC) 0157, and Listeria monocytogenes.
  • the CAR polypeptides described herein are used to treat an RNA virus.
  • the RNA virus is a Group III (dsRNA) virus, a Group IV (+ssRNA) virus, a Group V ( ⁇ ssRNA) virus, or a Group VI (reverse transcriptase) virus.
  • the RNA virus is a Group III (i.e., double stranded RNA (dsRNA)) virus.
  • the Group III RNA virus belongs to a viral family selected from the group consisting of: Amalgaviridae, Birnaviridae, Chrysoviridae, Cystoviridae, Endomaviridae, Hypoviridae, Megabirnaviridae, Partitiviridae, Picobirnaviridae, Reoviridae (e.g., Rotavirus), Totiviridae, Quadriviridae.
  • the Group III RNA virus belongs to the Genus Botybimavirus. In some embodiments of any of the aspects, the Group III RNA virus is an unassigned species selected from the group consisting of Botrytis porri RNA virus 1 , Circulifer tenellus virus 1, Colletotrichum camelliae filamentous virus 1, Cucurbit yellows associated virus, Sclerotinia sclerotiorum debilitation-associated virus, and Spissistilus festinus virus 1.
  • the RNA virus is a Group IV (i.e., positive-sense single stranded (ssRNA)) virus.
  • the Group IV RNA virus belongs to a viral order selected from the group consisting of: Nidovirales, Picornavirales, and Tymovirales.
  • the Group IV RNA virus belongs to a viral family selected from the group consisting of: Arteriviridae, Coronaviridae (e.g., Coronavirus, SARS-CoV), Mesoniviridae, Roniviridae, Dicistroviridae, Iflaviridae, Marnaviridae, Picornaviridae (e.g., Poliovirus, Rhinovirus (a common cold virus), Hepatitis A virus), Secoviridae (e.g., sub Comovirinae), Alphaflexiviridae, Betaflexiviridae, Gammaflexiviridae, Tymoviridae, Alphatetraviridae, Alvernaviridae, Astroviridae, Barnaviridae, Benyviridae, Bromoviridae, Caliciviridae (e.g., Norwalk virus), Carmotetraviridae, Closteroviridae, Flaviviridae
  • Coronaviridae e
  • the Group IV RNA virus belongs to a viral genus selected from the group consisting of: Bacillariornavirus, Dicipivirus, Labyrnavirus, Sequiviridae, Blunervirus, Cilevirus, Higrevirus, Idaeovirus, Negevirus, Ourmiavirus, Polemovirus, Sinaivirus, and Sobemovirus.
  • the Group IV RNA virus is an unassigned species selected from the group consisting of: Acyrthosiphon pisum virus, Bastrovirus, Blackford virus, Blueberry necrotic ring blotch virus, Cadicistrovirus, Chara australis virus, Extra small virus, Goji berry chlorosis virus, Hepelivirus, Jingmen tick virus, Le Blanc virus, Nedicistrovirus, Nesidiocoris tenuis virus 1, Niflavirus, Nylanderia fulva virus 1, Orsay virus, Osedax japonicus RNA virus 1, Picalivirus, Plasmopara halstedii virus, Rosellinia necatrix fusarivirus 1, Santeuil virus, Secalivirus, Solenopsis invicta virus 3, Wuhan large pig roundworm virus.
  • the Group IV RNA virus is a satellite virus selected from the group consisting of: Family Sarthroviridae, Genus Albetovirus, Genus Aumaivirus, Genus Papanivirus, Genus Virtovirus, and Chronic bee paralysis virus.
  • the RNA virus is a Group V (i.e., negative-sense ssRNA) virus.
  • the Group V RNA virus belongs to a viral phylum or subphylum selected from the group consisting of: Negamaviricota, Haploviricotina, and Polyploviricotina.
  • the Group V RNA virus belongs to a viral class selected from the group consisting of: Chunqiuviricetes, Ellioviricetes, Insthoviricetes, Milneviricetes, Monjiviricetes, and Yunchangviricetes.
  • the Group V RNA virus belongs to a viral order selected from the group consisting of: Articulavirales, Bunyavirales, Goujianvirales, Jingchuvirales, Mononegavirales, Muvirales, and Serpentovirales.
  • the Group V RNA virus belongs to a viral family selected from the group consisting of: Amnoonviridae (e.g., Taastrup virus), Arenaviridae (e.g., Lassa virus), Aspiviridae, Bornaviridae (e.g., Boma disease virus), Chuviridae, Cruliviridae, Feraviridae, Filoviridae (e.g., Ebola virus, Marburg virus), Fimoviridae, Hantaviridae, Jonviridae, Mymonaviridae, Nairoviridae, Nyamiviridae, Orthomyxoviridae (e.g., Influenza viruses), Paramyxoviridae (e.g., Measles virus, Mumps virus, Nipah virus, Hendra virus, and NDV), Peribunyaviridae, Phasmaviridae, Phenuiviridae, Pneumovirida
  • the Group V RNA virus belongs to a viral genus selected from the group consisting of: Anphevirus, Arlivirus, Chengtivirus, Crustavirus, Tilapineviridae, Wastrivirus, and Deltavirus (e.g., Hepatitis D virus).
  • the RNA virus is a Group VI RNA virus, which comprise a virally encoded reverse transcriptase.
  • the Group VI RNA virus belongs to the viral order Ortervirales.
  • the Group VI RNA virus belongs to a viral family or subfamily selected from the group consisting of Belpaoviridae, Caulimoviridae, Metaviridae, Pseudoviridae, Retroviridae (e.g., Retroviruses, e.g. HIV), Orthoretrovirinae, and Spumaretrovirinae.
  • the Group VI RNA virus belongs to a viral genus selected from the group consisting of: Alpharetrovirus (e.g., Avian leukosis virus; Rous sarcoma virus), Betaretrovirus (e.g., Mouse mammary tumour virus), Bovispumavirus (e.g., Bovine foamy virus), Deltaretrovirus (e.g., Bovine leukemia virus; Human T-lymphotropic virus), Epsilonretrovirus (e.g., Walleye dermal sarcoma virus), Equispumavirus (e.g., Equine foamy virus), Felispumavirus (e.g., Feline foamy virus), Gammaretrovirus (e.g., Murine leukemia virus; Feline leukemia virus), Lentivirus (e.g., Human immunodeficiency virus 1; Simian immunodeficiency virus; Feline immunodeficiency virus), Prosimiispumavirus (e.g.
  • Alpharetrovirus e.
  • the virus is an endogenous retrovirus (ERV; e.g., endogenous retrovirus group W envelope member 1 (ERVWE1); HCP5 (HLA Complex P5); Human teratocarcinoma-derived virus), which are endogenous viral elements in the genome that closely resemble and can be derived from retroviruses.
  • ERV endogenous retrovirus
  • ERVWE1 endogenous retrovirus group W envelope member 1
  • HCP5 HLA Complex P5
  • Human teratocarcinoma-derived virus Human teratocarcinoma-derived virus
  • the CAR polypeptides described herein are used to treat a DNA virus.
  • the DNA virus is a Group I (dsDNA) virus, a Group II (ssDNA) virus, or a Group VII (dsDNA-RT) virus.
  • the DNA virus is a Group I (i.e., dsDNA) virus.
  • the Group I dsDNA virus belongs to a viral order selected from the group consisting of: Caudovirales; Herpesvirales; and Ligamenvirales.
  • the Group I dsDNA virus belongs to a viral family selected from the group consisting of: Adenoviridae (e.g., adenoviruses), Alloherpesviridae, Ampullaviridae, Ascoviridae, Asfarviridae (e.g., African swine fever virus), Baculoviridae, Bicaudaviridae, Clavaviridae, Corticoviridae, Fuselloviridae, Globuloviridae, Guttaviridae, Herpesviridae (e.g., human herpesviruses, Varicella Zoster virus), Hytrosaviridae, Iridoviridae, Lavidaviridae, Lipothrixviridae, Malacoherpesviridae, Marseilleviridae, Mimiviridae, Myoviridae (e.g., Enterobacteria phage T4), Ni
  • the Group I dsDNA virus belongs to a viral genus selected from the group consisting of Dinodnavirus, Rhizidiovirus, and Salterprovirus. In some embodiments of any of the aspects, the Group I dsDNA virus belongs to an unassigned viral species selected from the group consisting of: Abalone shriveling syndrome-associated virus, Apis mellifera filamentous virus, Bandicoot papillomatosis carcinomatosis virus, Cedratvirus, Kaumoebavirus, KIs-V, Lentille virus, Leptopilina boulardi filamentous virus, Megavirus, Metallosphaera turreted icosahedral virus, Methanosarcina spherical virus, Mollivirus sibericum virus, Orpheovirus IHUMI-LCC2 , Phaeocystis globosa virus, and Pithovirus.
  • the Group I dsDNA virus is a virophage selected from the group consisting of: Organic Lake virophage, Ace Lake Mavirus virophage, Dishui Lake virophage 1, Guarani virophage, Phaeocystis globosa virus virophage, Rio Negro virophage, Sputnik virophage 2, Yellowstone Lake virophage 1, Yellowstone Lake virophage 2, Yellowstone Lake virophage 3, Yellowstone Lake virophage 4, Yellowstone Lake virophage 5, Yellowstone Lake virophage 6, Yellowstone Lake virophage 7, and Zamilon virophage 2.
  • the DNA virus is a Group II (i.e., ssDNA) virus.
  • the Group II ssDNA virus belongs to a viral family selected from the group consisting of: Anelloviridae, Bacilladnaviridae, Bidnaviridae, Circoviridae, Geminiviridae, Genomoviridae, Inoviridae, Microviridae, Nanoviridae, Parvoviridae, Smacoviridae, and Spiraviridae.
  • the DNA virus is a Group VII (i.e., dsDNA-RT) virus.
  • the Group VII dsDNA-RT virus belongs to the Ortervirales order.
  • the Group VII dsDNA-RT virus belongs to the Caulimoviridae family or to the Hepadnaviridae family (e.g., Hepatitis B virus).
  • the Group VII dsDNA-RT virus belongs to a viral genus selected from the group consisting of: Badnavirus, Caulimovirus, Cavemovirus, Petuvirus, Rosadnavirus, Solendovirus, Soymovirus, Tungrovirus, Avihepadnavirus, and Orthohepadnavirus.
  • “decrease”, “reduced”, “reduction”, or “inhibit” are all used herein to mean a decrease by a statistically significant amount. In some embodiments, “reduce,” “reduction” or “decrease” or “inhibit” typically means a decrease by at least 10% as compared to a reference level (e.g.
  • “reduction” or “inhibition” does not encompass a complete inhibition or reduction as compared to a reference level.
  • “Complete inhibition” is a 100% inhibition as compared to a reference level.
  • a decrease can be preferably down to a level accepted as within the range of normal, e.g., for an individual without a given disorder.
  • the terms “increased”, “increase”, “enhance”, or “activate” are all used herein to mean an increase by a statically significant amount.
  • the terms “increased”, “increase”, “enhance”, or “activate” can mean an increase of at least 10% as compared to a reference level, for example an increase of at least about 20%, or at least about 30%, or at least about 40%, or at least about 50%, or at least about 60%, or at least about 70%, or at least about 80%, or at least about 90% or up to and including a 100% increase or any increase between 10-100% as compared to a reference level, or at least about a 2-fold, or at least about a 3-fold, or at least about a 4-fold, or at least about a 5-fold or at least about a 10-fold increase, or any increase between 2-fold and 10-fold or greater as compared to a reference level.
  • an “increase” is a statistically significant increase in such level.
  • a “subject” means a human or animal. Usually the animal is a vertebrate such as a primate, rodent, domestic animal or game animal. Primates include chimpanzees, cynomolgus monkeys, spider monkeys, and macaques, e.g., Rhesus. Rodents include mice, rats, woodchucks, ferrets, rabbits and hamsters.
  • Domestic and game animals include cows, horses, pigs, deer, bison, buffalo, feline species, e.g., domestic cat, canine species, e.g., dog, fox, wolf, avian species, e.g., chicken, emu, ostrich, and fish, e.g., trout, catfish and salmon.
  • the subject is a mammal, e.g., a primate, e.g., a human.
  • the terms, “individual,” “patient” and “subject” are used interchangeably herein.
  • the subject is a mammal.
  • the mammal can be a human, non-human primate, mouse, rat, dog, cat, horse, or cow, but is not limited to these examples. Mammals other than humans can be advantageously used as subjects that represent animal models of cancer or infectious disease.
  • a subject can be male or female.
  • a subject can be one who has been previously diagnosed with or identified as suffering from or having a condition in need of treatment (e.g. cancer or infectious disease) or one or more complications related to such a condition, and optionally, have already undergone treatment for the disease or disorder (e.g., cancer or infectious disease) or the one or more complications related to the disease or disorder (e.g., cancer or infectious disease).
  • a subject can also be one who has not been previously diagnosed as having the disease or disorder (e.g., cancer or infectious disease) or one or more complications related to the disease or disorder (e.g., cancer or infectious disease).
  • a subject can be one who exhibits one or more risk factors for the disease or disorder (e.g., cancer or infectious disease) or one or more complications related to the disease or disorder (e.g., cancer or infectious disease) or a subject who does not exhibit risk factors.
  • the disease or disorder e.g., cancer or infectious disease
  • the complications related to the disease or disorder e.g., cancer or infectious disease
  • a “subject in need” of treatment for a particular condition can be a subject having that condition, diagnosed as having that condition, or at heightened risk of developing that condition.
  • protein and “polypeptide” are used interchangeably to designate a series of amino acid residues, connected to each other by peptide bonds between the alpha-amino and carboxy groups of adjacent residues.
  • protein and “polypeptide” refer to a polymer of amino acids, including modified amino acids (e.g., phosphorylated, glycated, glycosylated, etc.) and amino acid analogs, regardless of its size or function.
  • Protein and “polypeptide” are often used in reference to relatively large polypeptides, whereas the term “peptide” is often used in reference to small polypeptides, but usage of these terms in the art overlaps.
  • polypeptide proteins and “polypeptide” are used interchangeably herein when referring to a gene product and fragments thereof.
  • exemplary polypeptides or proteins include gene products, naturally occurring proteins, homologs, orthologs, paralogs, fragments and other equivalents, variants, fragments, and analogs of the foregoing.
  • variants naturally occurring or otherwise
  • alleles homologs
  • conservatively modified variants conservative substitution variants of any of the particular polypeptides described are encompassed.
  • amino acid sequences one of skill will recognize that individual substitutions, deletions or additions to a nucleic acid, peptide, polypeptide, or protein sequence which alters a single amino acid or a small percentage of amino acids in the encoded sequence is a “conservatively modified variant” where the alteration results in the substitution of an amino acid with a chemically similar amino acid and retains the desired activity of the polypeptide.
  • conservatively modified variants are in addition to and do not exclude polymorphic variants, interspecies homologs, and alleles consistent with the disclosure.
  • polypeptide domain(s), region(s), or amino acid residue(s) that can likely tolerate variation can be identified by alignment of different intraspecies or interspecies variants of the polypeptide (e.g., an NK cell receptor, NK cell membrane-bound signaling adaptor protein, or a co-stimulatory receptor as described herein) or domains thereof (e.g., intracellular signaling domain, co-stimulatory domain, transmembrane domain, etc.).
  • Domain(s), region(s), or amino acid residue(s) that exhibit minimal intraspecies and/or interspecies variation represent conserved sequences that likely cannot tolerate substantial variation or mutation, or likely can only tolerate conservative substitutions.
  • Domain(s), region(s), or amino acid residue(s) that do exhibit intraspecies and/or interspecies variation represent non-conserved sequences that likely can tolerate variation or mutation (e.g., non-conservative substitutions or conservative substitutions).
  • a given amino acid can be replaced by a residue having similar physiochemical characteristics, e.g., substituting one aliphatic residue for another (such as Ile, Val, Leu, or Ala for one another), or substitution of one polar residue for another (such as between Lys and Arg; Glu and Asp; or Gln and Asn).
  • Other such conservative substitutions e.g., substitutions of entire regions having similar hydrophobicity characteristics, are well known.
  • Polypeptides comprising conservative amino acid substitutions can be tested in any one of the assays described herein to confirm that a desired activity, e.g. function and specificity of a native or reference polypeptide is retained.
  • Amino acids can be grouped according to similarities in the properties of their side chains (in A. L. Lehninger, in Biochemistry, second ed., pp. 73-75, Worth Publishers, New York (1975)): (1) non-polar: Ala (A), Val (V), Leu (L), Ile (I), Pro (P), Phe (F), Trp (W), Met (M); (2) uncharged polar: Gly (G), Ser (S), Thr (T), Cys (C), Tyr (Y), Asn (N), Gln (Q); (3) acidic: Asp (D), Glu (E); (4) basic: Lys (K), Arg (R), His (H).
  • Naturally occurring residues can be divided into groups based on common side-chain properties: (1) hydrophobic: Norleucine, Met, Ala, Val, Leu, Ile; (2) neutral hydrophilic: Cys, Ser, Thr, Asn, Gln; (3) acidic: Asp, Glu; (4) basic: His, Lys, Arg; (5) residues that influence chain orientation: Gly, Pro; (6) aromatic: Trp, Tyr, Phe.
  • Non-conservative substitutions will entail exchanging a member of one of these classes for another class.
  • Particular conservative substitutions include, for example; Ala into Gly or into Ser; Arg into Lys; Asn into Gln or into His; Asp into Glu; Cys into Ser; Gln into Asn; Glu into Asp; Gly into Ala or into Pro; His into Asn or into Gln; Ile into Leu or into Val; Leu into Ile or into Val; Lys into Arg, into Gln or into Glu; Met into Leu, into Tyr or into Ile; Phe into Met, into Leu or into Tyr; Ser into Thr; Thr into Ser; Trp into Tyr; Tyr into Trp; and/or Phe into Val, into Ile or into Leu.
  • the polypeptide described herein can be a functional fragment of one of the amino acid sequences described herein.
  • a “functional fragment” is a fragment or segment of a peptide which retains at least 50% of the wild-type reference polypeptide's activity according to an assay known in the art or as described herein.
  • a functional fragment can comprise one or more conservative substitutions of the sequences disclosed herein.
  • a polypeptide can comprise the first N-terminal amino acid methionine. In embodiments where a polypeptide does not comprise a first N-terminal methionine, it is understood that a variant of the polypeptide does comprise a first N-terminal methionine.
  • the polypeptide described herein can be a variant of a sequence described herein.
  • the variant is a conservatively modified variant.
  • Conservative substitution variants can be obtained by mutations of native nucleotide sequences, for example.
  • a “variant,” as referred to herein, is a polypeptide substantially homologous to a native or reference polypeptide, but which has an amino acid sequence different from that of the native or reference polypeptide because of one or a plurality of deletions, insertions or substitutions.
  • Variant polypeptide-encoding DNA sequences encompass sequences that comprise one or more additions, deletions, or substitutions of nucleotides when compared to a native or reference DNA sequence, but that encode a variant protein or fragment thereof that retains activity.
  • a wide variety of PCR-based site-specific mutagenesis approaches are known in the art and can be applied by the ordinarily skilled artisan.
  • a variant amino acid or DNA sequence can be at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or more, identical to a native or reference sequence.
  • the degree of homology (percent identity) between a native and a mutant sequence can be determined, for example, by comparing the two sequences using freely available computer programs commonly employed for this purpose on the world wide web (e.g. BLASTp or BLASTn with default settings).
  • a variant amino acid sequence can be at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or more, similar to a native or reference sequence.
  • a sequence that has a specified percent similarity to a reference sequence necessarily encompasses a sequence with the same specified percent identity to that reference sequence.
  • the skilled person will be aware of several different computer programs, using different mathematical algorithms, that are available to determine the identity or similarity between two sequences. For instance, use can be made of a computer program employing the Needleman and Wunsch algorithm (Needleman et al. (1970)); the GAP program in the Accelrys GCG software package (Accelerys Inc., San Diego U.S.A.); the algorithm of E. Meyers and W. Miller (Meyers et al.
  • Alterations of the native amino acid sequence can be accomplished by any of a number of techniques known to one of skill in the art. Mutations can be introduced, for example, at particular loci by synthesizing oligonucleotides containing a mutant sequence, flanked by restriction sites enabling ligation to fragments of the native sequence. Following ligation, the resulting reconstructed sequence encodes an analog having the desired amino acid insertion, substitution, or deletion. Alternatively, oligonucleotide-directed site-specific mutagenesis procedures can be employed to provide an altered nucleotide sequence having particular codons altered according to the substitution, deletion, or insertion required. Techniques for making such alterations are very well established and include, for example, those disclosed by Walder et al.
  • Any cysteine residue not involved in maintaining the proper conformation of the polypeptide also can be substituted, generally with serine, to improve the oxidative stability of the molecule and prevent aberrant crosslinking. Conversely, cysteine bond(s) can be added to the polypeptide to improve its stability or facilitate oligomerization.
  • nucleic acid or “nucleic acid sequence” refers to any molecule, preferably a polymeric molecule, incorporating units of ribonucleic acid, deoxyribonucleic acid or an analog thereof.
  • the nucleic acid can be either single-stranded or double-stranded.
  • a single-stranded nucleic acid can be one nucleic acid strand of a denatured double-stranded DNA. Alternatively, it can be a single-stranded nucleic acid not derived from any double-stranded DNA.
  • the nucleic acid can be DNA.
  • nucleic acid can be RNA.
  • Suitable DNA can include, e.g., genomic DNA, cDNA, or vector DNA.
  • Suitable RNA can include, e.g., mRNA.
  • expression refers to the cellular processes involved in producing RNA and proteins and as appropriate, secreting proteins, including where applicable, but not limited to, for example, transcription, transcript processing, translation and protein folding, modification and processing.
  • Expression can refer to the transcription and stable accumulation of sense (e.g., mRNA) or antisense RNA derived from a nucleic acid fragment or fragments and/or to the translation of mRNA into a polypeptide.
  • the term “detecting” or “measuring” refers to observing a signal from, e.g. a probe, label, or target molecule to indicate the presence of an analyte in a sample. Any method known in the art for detecting a particular label moiety can be used for detection. Exemplary detection methods include, but are not limited to, spectroscopic, fluorescent, photochemical, biochemical, immunochemical, electrical, optical or chemical methods. In some embodiments of any of the aspects, measuring can be a quantitative observation.
  • a polypeptide, nucleic acid, or cell as described herein can be engineered.
  • engineered refers to the aspect of having been manipulated by the hand of man.
  • a polypeptide is considered to be “engineered” when at least one aspect of the polypeptide, e.g., its sequence, has been manipulated by the hand of man to differ from the aspect as it exists in nature.
  • progeny of an engineered cell are typically still referred to as “engineered” even though the actual manipulation was performed on a prior entity.
  • a CAR polypeptide described herein is exogenous. In some embodiments of any of the aspects, a CAR polypeptide described herein is ectopic. In some embodiments of any of the aspects, a CAR polypeptide described herein is not endogenous.
  • exogenous refers to a substance present in a cell other than its native source.
  • exogenous when used herein can refer to a nucleic acid (e.g. a nucleic acid encoding a polypeptide) or a polypeptide that has been introduced by a process involving the hand of man into a biological system such as a cell or organism in which it is not normally found and one wishes to introduce the nucleic acid or polypeptide into such a cell or organism.
  • exogenous can refer to a nucleic acid or a polypeptide that has been introduced by a process involving the hand of man into a biological system such as a cell or organism in which it is found in relatively low amounts and one wishes to increase the amount of the nucleic acid or polypeptide in the cell or organism, e.g., to create ectopic expression or levels.
  • endogenous refers to a substance that is native to the biological system or cell.
  • ectopic refers to a substance that is found in an unusual location and/or amount. An ectopic substance can be one that is normally found in a given cell, but at a much lower amount and/or at a different time. Ectopic also includes substance, such as a polypeptide or nucleic acid that is not naturally found or expressed in a given cell in its natural environment.
  • an “antigen” is a molecule that is bound by a binding site on an antibody agent (e.g., extracellular binding domain comprising an antibody-derived structure).
  • antigens are bound by antibody ligands and are capable of raising an antibody response in vivo.
  • An antigen can be a polypeptide, protein, nucleic acid or other molecule or portion thereof.
  • antigenic determinant refers to an epitope on the antigen recognized by an antigen-binding molecule, and more particularly, by the antigen-binding site of said molecule.
  • a nucleic acid encoding a polypeptide as described herein is comprised by a vector.
  • a nucleic acid sequence encoding a given polypeptide as described herein, or any module thereof is operably linked to a vector.
  • the term “vector”, as used herein, refers to a nucleic acid construct designed for delivery to a host cell or for transfer between different host cells.
  • a vector can be viral or non-viral.
  • the term “vector” encompasses any genetic element that is capable of replication when associated with the proper control elements and that can transfer gene sequences to cells.
  • a vector can include, but is not limited to, a cloning vector, an expression vector, a plasmid, phage, transposon, cosmid, chromosome, virus, virion, etc.
  • the vector is recombinant, e.g., it comprises sequences originating from at least two different sources or is otherwise modified by the hand of man. In some embodiments of any of the aspects, the vector comprises sequences originating from at least two different species. In some embodiments of any of the aspects, the vector comprises sequences originating from at least two different genes, e.g., it comprises a fusion protein or a nucleic acid encoding an expression product which is operably linked to at least one non-native (e.g., heterologous) genetic control element (e.g., a promoter, suppressor, activator, enhancer, response element, or the like).
  • non-native e.g., heterologous
  • expression vector refers to a vector that directs expression of an RNA or polypeptide from sequences linked to transcriptional regulatory sequences on the vector.
  • sequences expressed will often, but not necessarily, be heterologous to the cell.
  • An expression vector may comprise additional elements, for example, the expression vector may have two replication systems, thus allowing it to be maintained in two organisms, for example in human cells for expression and in a prokaryotic host for cloning and amplification.
  • viral vector refers to a nucleic acid vector construct that includes at least one element of viral origin and has the capacity to be packaged into a viral vector particle.
  • the viral vector can contain the nucleic acid encoding a polypeptide as described herein in place of non-essential viral genes.
  • the vector and/or particle can be utilized for the purpose of transferring any nucleic acids into cells either in vitro or in vivo. Numerous forms of viral vectors are known in the art.
  • Non-limiting examples of a viral vector useful in connection with the technology disclosed herein include an AAV vector, an adenovirus vector, a lentivirus vector, a retrovirus vector, a herpesvirus vector, an alphavirus vector, a poxvirus vector a baculovirus vector, and a chimeric virus vector.
  • the vectors described herein can, in some embodiments, be combined with other suitable compositions and therapies.
  • the vector is episomal.
  • the use of a suitable episomal vector provides a means of maintaining the nucleotide of interest in the subject in high copy number extra chromosomal DNA thereby eliminating potential effects of chromosomal integration.
  • the terms “treat,” “treatment,” “treating,” or “amelioration” refer to therapeutic treatments, wherein the object is to reverse, alleviate, ameliorate, inhibit, slow down or stop the progression or severity of a condition associated with a disease or disorder, e.g. cancer or infectious disease.
  • the term “treating” includes reducing or alleviating at least one adverse effect or symptom of a condition, disease or disorder (e.g., cancer or infectious disease).
  • Treatment is generally “effective” if one or more symptoms or clinical markers are reduced. Alternatively, treatment is “effective” if the progression of a disease is reduced or halted.
  • treatment includes not just the improvement of symptoms or markers, but also a cessation of, or at least slowing of, progress or worsening of symptoms compared to what would be expected in the absence of treatment.
  • Beneficial or desired clinical results include, but are not limited to, alleviation of one or more symptom(s), diminishment of extent of disease, stabilized (i.e., not worsening) state of disease, delay or slowing of disease progression, amelioration or palliation of the disease state, remission (whether partial or total), and/or decreased mortality, whether detectable or undetectable.
  • treatment also includes providing relief from the symptoms or side-effects of the disease (including palliative treatment).
  • a pharmaceutically acceptable carrier e.g. a carrier commonly used in the pharmaceutical industry.
  • pharmaceutically acceptable is employed herein to refer to those compounds, materials, compositions, and/or dosage forms which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of human beings and animals without excessive toxicity, irritation, allergic response, or other problem or complication, commensurate with a reasonable benefit/risk ratio.
  • a pharmaceutically acceptable carrier can be a carrier other than water.
  • a pharmaceutically acceptable carrier can be an artificial or engineered carrier, e.g., a carrier that the active ingredient would not be found to occur in or within nature.
  • administering refers to the placement of a compound as disclosed herein into a subject by a method or route which results in at least partial delivery of the agent at a desired site.
  • Pharmaceutical compositions comprising the compositions disclosed herein can be administered by any appropriate route which results in an effective treatment in the subject.
  • administration comprises physical human activity, e.g., an injection, an act of application, and/or manipulation of a delivery device or machine. Such activity can be performed, e.g., by a medical professional and/or the subject being treated.
  • contacting refers to any suitable means for delivering, or exposing, an agent to at least one cell.
  • exemplary delivery methods include, but are not limited to, direct delivery to cell culture medium, transfection, transduction, perfusion, injection, or other delivery method known to one skilled in the art.
  • contacting comprises physical human activity, e.g., an injection; an act of dispensing, mixing, and/or decanting; and/or manipulation of a delivery device or machine.
  • statically significant or “significantly” refers to statistical significance and generally means a two standard deviation (2SD) or greater difference.
  • compositions, methods, and respective components thereof as described herein, which are exclusive of any element not recited in that description of the embodiment.
  • the term “consisting essentially of” refers to those elements required for a given embodiment. The term permits the presence of additional elements that do not materially affect the basic and novel or functional characteristic(s) of that embodiment of the invention.
  • corresponding to refers to an amino acid or nucleotide at the enumerated position in a first polypeptide or nucleic acid, or an amino acid or nucleotide that is equivalent to an enumerated amino acid or nucleotide in a second polypeptide or nucleic acid.
  • Equivalent enumerated amino acids or nucleotides can be determined by alignment of candidate sequences using degree of homology programs known in the art, e.g., BLAST.
  • specific binding refers to a chemical interaction between two molecules, compounds, cells and/or particles wherein the first entity binds to the second, target entity with greater specificity and affinity than it binds to a third entity which is a non-target.
  • specific binding can refer to an affinity of the first entity for the second target entity which is at least 10 times, at least 50 times, at least 100 times, at least 500 times, at least 1000 times or more times greater than the affinity for the third non-target entity.
  • a reagent specific for a given target is one that exhibits specific binding for that target under the conditions of the assay being utilized.
  • the disclosure described herein does not concern a process for cloning human beings, processes for modifying the germ line genetic identity of human beings, uses of human embryos for industrial or commercial purposes or processes for modifying the genetic identity of animals which are likely to cause them suffering without any substantial medical benefit to man or animal, and also animals resulting from such processes.
  • Tables 1 and 2 show exemplary CD19 CAR-NK constructs.
  • exemplary CD19 CAR-NK data see e.g., Examples 1-7 or FIGS. 1 - 17 .
  • NK CARs CC008, CC024, CC025, and CC033 were transfected into NK92 cells using the lentiviral based method.
  • the CAR constructs were first cloned into the plasmid pSIH1 (SBI Cat #CD510B-1), followed by transfection into the 293FT packaging cells along with helper plasmids, pMDL, VSVG and REV using a CaCl 2 mediated transfection method. Culture supernatants were collected after 48 h, filtered (0.22 ⁇ m) and stored at ⁇ 80° C.
  • titer of LV particles was determined using a Lenti-X p24 Rapid Titer Kit (NovoproteinTM).
  • NK92 cell transduction NK92 cells were loaded in 24-well plates followed by the addition of lentivirus at a multiplicity of infection (MOI) of 20 in the presence of 8 ⁇ g/ml POLYBRENE and incubated at 37° C. for 48 h.
  • CAR transduction efficiency was determined using Guava EasycyteTM flow cytometry, measuring Flag-tag expression using fluorescent labeled anti-flag tag antibody.
  • Cytotoxicity of each CAR was evaluated with a real-time cell assay (RTCA) using CD19 expressing A549 cell line as target cell and CAR transfected NK92 cell as effector cell.
  • RTCA real-time cell assay
  • CD19 expressing A549 cell line as target cell
  • CAR transfected NK92 cell as effector cell.
  • specific lysis (%) of target cell the CD19-expressing A549 target cells (i.e., tumor cells) were first seeded in the wells of an electronic microtiter plate (E-Plate®) to let cells settle and target cell attachment. On the second day, media was removed from the wells and effector cells were added to the plates and incubated at 37° C. for another 2-5 days.
  • E-Plate® electronic microtiter plate
  • cytotoxicity of CC008 CAR construct is significantly higher than control CARs CC002 and CC004.
  • NK CARs cytotoxicity of exemplary NK CARs CC005, CC007, CC008, CC013, CC016, CC017, CC018, and CC024 with NK92 control without CAR transduction.
  • the CARs were transfected into NK92 cells using the lentiviral based method.
  • the CAR constructs were first cloned into the plasmid pSIH1 (SBI Cat #CD510B-1), followed by transfection into the 293FT packaging cell along with helper plasmids, pMDL, VSVG and REV using a CaCl 2 mediated transfection method.
  • NK92 cell transduction NK92 cells were loaded in 24-well plates followed by the addition of lentivirus at an MOI of 20 in the presence of 8 ⁇ g/ml Polybrene and incubated at 37° C. for 48 h. CAR transduction efficiency was determined using Guava EasycyteTM flow cytometry, measuring Flag-tag expression using fluorescent labeled anti-flag tag antibody.
  • Cytotoxicity of each CAR was evaluated with a Calcein-AM assay using Raji cell line as target cell and CAR transfected NK92 cell as effector cell.
  • a Calcein-AM assay For measuring of specific lysis (%) of target cell, 1 ⁇ 10 6 effector cells were stained with 0.15 NM Calcein-AM in NK92 medium for 25 minutes (min) at 37° C. in a volume of 10 mL. Cells were then washed twice in NK92 medium and added to 96-well round bottom plates at a concentration of 5 ⁇ 10 4 cells/mL in triplicate, and effector cells were added at 5:1 effector-to-target (E:T) ratio. Plates were centrifuged at 300 rpm for 1 min and incubated at 37° C. for 4 h.
  • Results as shown in FIG. 2 demonstrate that cytotoxic activity of CC005/CC007/CC008 CAR constructs incorporating Fc ⁇ RI intracellular domain is higher than the other CAR constructs evaluated.
  • NK CARs CC008, and CC026-CC039 were transfected into NK92 cells using the lentiviral based method.
  • the CAR constructs were first cloned into the plasmid pSIH1 (SBI Cat #CD510B-1), followed by transfection into the 293FT packaging cell along with helper plasmids, pMDL, VSVG and REV using a CaCl 2 mediated transfection method. Culture supernatants were collected after 48 h, filtered (0.22 ⁇ m) and stored at ⁇ 80° C.
  • titer of LV particles was determined using a Lenti-X p24 Rapid Titer Kit (NovoproteinTM).
  • NK92 cell transduction NK92 cells were loaded in 24-well plates followed by the addition of lentivirus at an MOI of 20 in the presence of 8 ⁇ g/ml Polybrene and incubated at 37° C. for 48 h.
  • CAR transduction efficiency was determined using Guava EasycyteTM flow cytometry, measuring Flag-tag expression using fluorescent labeled anti-flag tag antibody.
  • Cytotoxicity of each CAR was evaluated with a Calcein-AM assay using Raji cell line as target cell and CAR transfected NK92 cell as effector cell.
  • a Calcein-AM assay For measuring of specific lysis (%) of target cell, 1 ⁇ 10 6 effector cells were stained with 0.15 ⁇ M Calcein-AM in NK92 medium for 25 min at 37° C. in a volume of 10 mL. Cells were then washed twice in NK92 medium and added to 96-well round bottom plates at a concentration of 5 ⁇ 10 4 cells/mL in triplicate, and effector cells were added at 5:1 effector-to-target (E:T) ratio. Plates were centrifuged at 300 rpm for 1 min and incubated at 37° C. for 4 h.
  • CC027/CC030/CC034/CC038 CAR constructs incorporating DNAM1 intracellular domain, CC026 construct incorporating NKp46 and CD2 intracellular domain, and CC028/CC035/CC036 construct incorporating NKG2D and CRACC intracellular domain demonstrate strong cytotoxic activity against Raji tumor cell targets.
  • Cytotoxicity of each CAR was further evaluated with a bioluminescence assay using Nalm6-GFP-luciferase cell line as target cell and CAR transfected NK92 cell as effector cell.
  • luciferase-expressing tumor cells were placed in 96-well round bottom plates at a concentration of 5 ⁇ 10 5 cells/mL in triplicate, and effector cells were added at 1:1 effector-to-target (E:T) ratio. Plates were centrifuged at 300 rpm for 1 min and incubated at 37° C. for 24, 48 and 72 hours, respectively.
  • % specific lysis 100 ⁇ [(spontaneous cell data ⁇ experimental data)/(spontaneous cell data ⁇ medium control data)].
  • CC028/CC039/CC035 CAR constructs incorporating NKG2D plus CRACC or NTB-A intracellular domain demonstrate strong cytotoxic activity against Nalm6-GFP-luciferase tumor cell targets.
  • This study compares the cytotoxicity of exemplary NK CARs CC005, CC007, CC008, CC016, CC018, CC024, CC025, CC028, CC030, CC035, CC036, CC038, and CC039 with control CARs CC002 and CC004.
  • the CARs were transfected into NK92 cells using the lentiviral based method.
  • the CAR constructs were first cloned into the plasmid pSIH1 (SBI Cat #CD510B-1), followed by transfection into the 293FT packaging cell along with helper plasmids, pMDL, VSVG and REV using a CaCl 2 mediated transfection method. Culture supernatants were collected after 48 h, filtered (0.22 ⁇ m) and stored at ⁇ 80° C. The titer of LV particles was determined using a Lenti-X p24 Rapid Titer Kit (NovoproteinTM).
  • NK92 cells were loaded in 24-well plates followed by the addition of lentivirus at an MOI of 20 in the presence of 8 ⁇ g/ml Polybrene and incubated at 37° C. for 48 h.
  • CAR transduction efficiency was determined using Guava EasycyteTM flow cytometry, measuring Flag-tag expression using fluorescent labeled anti-flag tag antibody.
  • Cytotoxicity of each CAR was evaluated with a Calcein-AM assay using Raji cell line as target cell and CAR transfected NK92 cell as effector cell.
  • a Calcein-AM assay For measuring of specific lysis (%) of target cell, 1 ⁇ 10 6 effector cells were stained with 0.15 ⁇ M Calcein-AM in NK92 medium for 25 min at 37° C. in a volume of 10 mL. Cells were then washed twice in NK92 medium and added to 96-well round bottom plates at a concentration of 5 ⁇ 10 4 cells/mL in triplicate, and effector cells were added at 5:1 effector-to-target (E:T) ratio. Plates were centrifuged at 300 rpm for 1 min and incubated at 37° C. for 4 h.
  • CC005/CC007/CC008 CAR constructs incorporating CD8 and Fc ⁇ RI intracellular domain CC024/CC028/CC035/CC036 constructs incorporating NKG2D intracellular domain
  • CC030/CC038 incorporating DNAM1 intracellular domain demonstrate strong cytotoxic activity against Raji tumor cell targets.
  • Cytotoxicity of each CAR was further evaluated with a bioluminescence assay using Nalm6-GFP-luciferase cell line as target cell and CAR transfected NK92 cell as effector cell.
  • luciferase-expressing tumor cells were placed in 96-well round bottom plates at a concentration of 5 ⁇ 10 5 cells/mL in triplicate, and effector cells were added at 1:1 effector-to-target (E:T) ratio. Plates were centrifuged at 300 rpm for 1 min and incubated at 37° C. for 24, 48 and 72 hours, respectively.
  • CC005/CC007/CC008 CAR constructs incorporating CD8 and Fc ⁇ RI intracellular domain and CC024/CC036/CC039 incorporating NKG2D intracellular domain demonstrate strong cytotoxic activity against Nalm6-GFP-luciferase tumor cell targets.
  • NK CARs CC005, CC007, CC008, CC024, CC030, CC035, and CC036 were transfected into NK92 cells using the lentiviral based method.
  • the CAR constructs were first cloned into the plasmid pSIH1 (SBI Cat #CD510B-1), followed by transfection into the 293FT packaging cell along with helper plasmids, pMDL, VSVG and REV using a CaCl 2 mediated transfection method.
  • NK92 cell transduction NK92 cells were loaded in 24-well plates followed by the addition of lentivirus at an MOI of 20 in the presence of 8 ⁇ g/ml Polybrene and incubated at 37° C. for 48 h. CAR transduction efficiency was determined using Guava EasycyteTM flow cytometry, measuring Flag-tag expression using fluorescent labeled anti-flag tag antibody.
  • Cytotoxicity of each CAR was evaluated with a Calcein-AM assay using Raji cell line as target cell and CAR transfected NK92 cell as effector cell.
  • a Calcein-AM assay For measuring of specific lysis (%) of target cell, 1 ⁇ 10 6 effector cells were stained with 0.15 ⁇ M Calcein-AM in NK92 medium for 25 min at 37° C. in a volume of 10 mL. Cells were then washed twice in NK92 medium and added to 96-well round bottom plates at a concentration of 5 ⁇ 10 4 cells/mL in triplicate, and effector cells were added at 5:1 effector-to-target (E:T) ratio. Plates were centrifuged at 300 rpm for 1 min and incubated at 37° C. for 4 h.
  • CC007/CC008 CAR constructs incorporating CD8 and Fc ⁇ RI intracellular domain demonstrate strong cytotoxic activity against Raji tumor cell targets.
  • CC024/CC035/CC036 constructs incorporating NKG2D intracellular domain demonstrate strong cytotoxic activity against Raji tumor cell targets.
  • CC030 incorporating DNAM1 intracellular domain demonstrate strong cytotoxic activity against Raji tumor cell targets.
  • Cytotoxicity of each CAR was further evaluated with a bioluminescence assay using Nalm6-GFP-luciferase cell line as target cell and CAR transfected NK92 cell as effector cell.
  • luciferase-expressing tumor cells were placed in 96-well round bottom plates at a concentration of 5 ⁇ 10 5 cells/mL in triplicate, and effector cells were added at 1:1 effector-to-target (E:T) ratio. Plates were centrifuged at 300 rpm for 1 min and incubated at 37° C. for 24, 48 and 72 hours, respectively.
  • CC005/CC007/CC008 CAR constructs incorporating CD8 and Fc ⁇ RI intracellular domain and CC024/CC035/CC036 incorporating NKG2D intracellular domain demonstrate strong cytotoxic activity against Nalm6-GFP-luciferase tumor cell targets.
  • NK CARs cytotoxicity of exemplary NK CARs CC005, CC007, CC008, CC018, CC024, CC028, CC030, CC035, and CC036 with control CAR CC004 and NK92 null control.
  • the CARs were transfected into NK92 cells using the lentiviral based method.
  • the CAR constructs were first cloned into the plasmid pSIH1 (SBI Cat #CD510B-1), followed by transfection into the 293FT packaging cell along with helper plasmids, pMDL, VSVG and REV using a CaCl 2 mediated transfection method.
  • NK92 cell transduction NK92 cells were loaded in 24-well plates followed by the addition of lentivirus at an MOI of 20 in the presence of 8 ⁇ g/ml Polybrene and incubated at 37° C. for 48 h. CAR transduction efficiency was determined using Guava EasycyteTM flow cytometry, measuring Flag-tag expression using fluorescent labeled anti-flag tag antibody.
  • Cytotoxicity of each CAR was evaluated with a Calcein-AM assay using Raji cell line as target cell and CAR transfected NK92 cell as effector cell.
  • a Calcein-AM assay For measuring of specific lysis (%) of target cell, 1 ⁇ 10 6 effector cells were stained with 0.15 ⁇ M Calcein-AM in NK92 medium for 25 min at 37° C. in a volume of 10 mL. Cells were then washed twice in NK92 medium and added to 96-well round bottom plates at a concentration of 5 ⁇ 10 4 cells/mL in triplicate, and effector cells were added at 5:1 effector-to-target (E:T) ratio. Plates were centrifuged at 300 rpm for 1 min and incubated at 37° C. for 4 h.
  • CC007/CC008/CC018 CAR constructs incorporating Fc ⁇ RI intracellular domain demonstrate strong cytotoxic activity against Raji tumor cell targets.
  • Cytotoxicity of each CAR was further evaluated with a bioluminescence assay using Nalm6-GFP-luciferase cell line as target cell and CAR transfected NK92 cell as effector cell.
  • luciferase-expressing tumor cells were placed in 96-well round bottom plates at a concentration of 5 ⁇ 10 5 cells/mL in triplicate, and effector cells were added at 1:1 effector-to-target (E:T) ratio. Plates were centrifuged at 300 rpm for 1 min and incubated at 37° C. for 24, 48 and 72 hours, respectively.
  • CC005/CC007/CC008/CC018 CAR constructs incorporating Fc ⁇ RI intracellular domain demonstrate strong cytotoxic activity against Nalm6-GFP-luciferase tumor cell targets.
  • This study compares the cytokine and Granzyme release of exemplary NK CARs CC008, CC018, CC024, CC030, CC035, and CC036 with control CARs CC002-CC004.
  • the release of cytokines TNF-alpha, IFN-gamma, Granzyme B and GM-CSF was analyzed with a CisbioTM bioassay using HTRF (Homogeneous Time Resolved Fluorescence) technology.
  • Tables 3 and 4 show exemplary CD33 CAR-NK constructs.
  • exemplary CD33 CAR-NK data see e.g., Example 8 or FIGS. 17 - 24 B .
  • NK CARs CC104, CC108, CC118, CC124, CC125, CC130, CC135 and CC136 were transfected into NK92 cells using the lentiviral based method.
  • the CAR constructs were first cloned into the plasmid pSIH1 (SBI Cat #CD510B-1), followed by transfection into the 293FT packaging cell alongside with helper plasmids, pMDL, VSVG and REV using a CaCl 2 mediated transfection method.
  • NK92 cell transduction NK92 cells were loaded in 24-well plates followed by the addition of lentivirus at an MOI of 20 in the presence of 8 ⁇ g/ml Polybrene and incubated at 37° C. for 48 h. CAR transduction efficiency was determined using Guava EasycyteTM flow cytometry, measuring Flag-tag expression using fluorescent labeled anti-flag tag antibody.
  • Cytotoxicity of each CAR was evaluated with a Calcein-AM assay using U937 cell line as target cell and CAR transfected NK92 cell as effector cell.
  • a Calcein-AM assay For measuring of specific lysis (%) of target cell, 1 ⁇ 10 6 effector cells were stained with 0.15 ⁇ M Calcein-AM in NK92 medium for 25 min at 37° C. in a volume of 10 mL. Cells were then washed twice in NK92 medium and added to 96-well round bottom plates at a concentration of 5 ⁇ 10 4 cells/mL in triplicate, and effector cells were added at 1:1 or 1:4 effector-to-target (E:T) ratio. Plates were centrifuged at 300 rpm for 1 min and incubated at 37° C.
  • the cytotoxicity of CC108 CAR construct is significantly higher than control CARs CC103 and CC104.
  • the CAR constructs CC124 and CC135 also have enhanced cytotoxicity over the control CARs CC103 and CC104.
  • Cytotoxicity of each CAR was further evaluated with a flow cytometry based method.
  • U937 target cells were incubated with effector cells at 1:1 or 1:4 effector to target (E/T) ratio at 37° C. for 24 h and 48 h, respectively.
  • E/T effector to target
  • PE conjugated anti-CD33 antibody, APC conjugated anti-CD56 antibody, and 7AAD solution were added to each sample and incubated for 30 min at 4° C. before flow cytometric analysis in a Guava EasycyteTM flow cytometer. Dead target cells were identified as 7AAD positive.
  • CAR constructs demonstrate strong cytotoxic activity against U937 tumor cell targets: CC008 CAR constructs incorporating CD8 and Fc ⁇ RI intracellular domain together with IL15 and IL21; CC124/CC125 constructs incorporating NKG2D and 2B4 intracellular domain; CC130 constructs incorporating DNAM1 and CRACC intracellular domain; and CC135 construct incorporating NKG2D and CRACC intracellular domain.
  • NK92 cells were cultured in medium supplemented with 100 IU/mL recombinant human IL-2 (CytocaresTM).
  • Raji, U937, Nalm6-GFP-luciferase cells were cultured in 1640 medium (GibcoTM) supplemented with 10% fetal bovine serum (FBS) and 1% penicillin/streptomycin.
  • A549-CD19 cells were cultured in DMEM medium (GibcoTM) supplemented with 10% fetal bovine serum (FBS) and 1% penicillin/streptomycin.
  • peripheral blood natural killer cell (PB-NK) preparation peripheral blood mononuclear cells (PBMCs) were separated from peripheral blood of healthy donors using Ficoll-Paque PLUSTM (GE HealthcareTM) and cultured in stem cell growth medium (SCGM) medium with various cytokines and antibodies for two weeks to obtain primary NK cells with high purity.
  • PBMCs peripheral blood mononuclear cells
  • SCGM stem cell growth medium
  • the plasmid containing exemplary CARs was transduced into 293FT cells with pMDL, VSVG and REV. 48 hours after transfection, viral supernatant was harvested, filtered and concentrated. The virus was stored at ⁇ 80° C. and the titer was determined using a Lenti-X p24 Rapid Titer KitTM (NovoproteinTM). NK cells were loaded in 24-well plates followed by the addition of lentivirus at an MOI of 20 in the presence of 8 ⁇ g/ml Polybrene and incubated at 37° C. for 48 h. At the endpoint, 7AAD (7-amino-actinomycin D) and flag tag antibody were added 30 min before flow cytometric analysis in a Guava EasycyteTM flow cytometer to detect the CAR transduction efficiency.
  • 7AAD 7-amino-actinomycin D
  • Adherent target cells e.g., tumor cells
  • E-Plate® electronic microtiter plate
  • S16 plate S16 plate
  • S16 wells Effector cells were then added to the S16 wells and incubated at 37° C. for another 2-5 days. Data was analyzed by xCELLigenceTM software.
  • effector cells were stained with 0.15 ⁇ M Calcein-AM in NK92 medium for 25 min at 37° C. in a volume of 10 mL. Cells were then washed twice in NK92 medium and added to 96-well round bottom plates at a concentration of 5 ⁇ 10 4 cells/mL in triplicate, and effector cells were added at 1:1 effector-to-target (E:T) ratio. Plates were centrifuged at 300 rpm for 1 min and incubated at 37° C. for 4 h. Cells were centrifuged at 400 g for 5 min and the supernatants were transferred into 96-well flat white plates.
  • E:T effector-to-target
  • Luciferase-expressing tumor cells were placed in 96-well round bottom plates at a concentration of 5 ⁇ 10 5 cells/mL in triplicate, and effector cells were added at 1:1 effector-to-target (E:T) ratio. Plates were centrifuged at 300 rpm for 1 min and incubated at 37° C. for 24, 48 and 72 hours, respectively. At the endpoint, D-luciferin (Perkin ElmerTM) was added to each well at a final concentration of 0.14 mg/mL and incubated at 37° C. for 10 min. Cells were then mixed and transferred into 96-well flat white plates.
  • CisbioTM bioassay were performed using HTRF Homogeneous Time Resolved Fluorescence) technology followed CisbioTM protocol. See e.g., Degorce et al., HTRF: A Technology Tailored for Drug Discovery—A Review of Theoretical Aspects and Recent Applications, Curr Chem Genomics. 2009; 3: 22-32; the content of which is incorporated herein by reference in its entirety.
  • Target cells were incubated with effector cells at different effector to target (E/T) ratios at 37° C. for 24 h and 48 h, respectively. Then various antibody solutions were added to each sample and incubated for 30 min at 4° C. before flow cytometric analysis in a Guava EasycyteTM flow cytometer. Dead target cells were identified as 7AAD positive.
  • E/T effector to target

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Immunology (AREA)
  • Genetics & Genomics (AREA)
  • Zoology (AREA)
  • Veterinary Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Engineering & Computer Science (AREA)
  • Biochemistry (AREA)
  • Medicinal Chemistry (AREA)
  • Cell Biology (AREA)
  • Epidemiology (AREA)
  • Molecular Biology (AREA)
  • Biomedical Technology (AREA)
  • Biophysics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Toxicology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Biotechnology (AREA)
  • Wood Science & Technology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • General Engineering & Computer Science (AREA)
  • Microbiology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Hematology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Virology (AREA)
  • Physics & Mathematics (AREA)
  • Plant Pathology (AREA)
  • Peptides Or Proteins (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
US18/273,661 2021-01-26 2022-01-25 Chimeric antigen receptor (car) constructs and nk cells expressing car constructs Pending US20240115607A1 (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
US18/273,661 US20240115607A1 (en) 2021-01-26 2022-01-25 Chimeric antigen receptor (car) constructs and nk cells expressing car constructs

Applications Claiming Priority (3)

Application Number Priority Date Filing Date Title
US202163141621P 2021-01-26 2021-01-26
US18/273,661 US20240115607A1 (en) 2021-01-26 2022-01-25 Chimeric antigen receptor (car) constructs and nk cells expressing car constructs
PCT/CN2022/073808 WO2022161355A1 (en) 2021-01-26 2022-01-25 Chimeric antigen receptor (car) constructs and nk cells expressing car constructs

Publications (1)

Publication Number Publication Date
US20240115607A1 true US20240115607A1 (en) 2024-04-11

Family

ID=81327157

Family Applications (1)

Application Number Title Priority Date Filing Date
US18/273,661 Pending US20240115607A1 (en) 2021-01-26 2022-01-25 Chimeric antigen receptor (car) constructs and nk cells expressing car constructs

Country Status (5)

Country Link
US (1) US20240115607A1 (https=)
EP (1) EP4284394A1 (https=)
JP (1) JP2024504728A (https=)
CN (1) CN117062611A (https=)
WO (1) WO2022161355A1 (https=)

Families Citing this family (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP3773918A4 (en) 2019-03-05 2022-01-05 Nkarta, Inc. CD19 DIRECTED CHIMERIC ANTIGEN RECEPTORS AND THEIR USES IN IMMUNOTHERAPY
CN116286660B (zh) * 2022-12-08 2023-10-03 全球细胞控股(广州)有限公司 一种ipsc-(car)自然杀伤细胞、制备方法及其在肿瘤治疗中的应用
WO2025067205A1 (en) * 2023-09-25 2025-04-03 Nanjing Legend Biotech Co., Ltd. Engineered receptors and methods of use thereof
WO2025140265A1 (en) * 2023-12-26 2025-07-03 Wuxi Biologics (Shanghai) Co., Ltd. Combination of chimeric antigen receptor and dap10 in cell therapy
WO2026003135A1 (en) * 2024-06-27 2026-01-02 Genicity Limited Engineered lymphocytes expressing interleukin-15 and interleukin-21 and uses thereof

Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20180002438A1 (en) * 2015-01-29 2018-01-04 Regents Of The University Of Minnesota Chimeric antigen receptors, compositions, and methods
US20180161017A1 (en) * 2013-01-29 2018-06-14 Becton, Dickinson And Company Specimen Collection Container Having a Fluid Separation Chamber

Family Cites Families (45)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US3536809A (en) 1969-02-17 1970-10-27 Alza Corp Medication method
US3598123A (en) 1969-04-01 1971-08-10 Alza Corp Bandage for administering drugs
US3845770A (en) 1972-06-05 1974-11-05 Alza Corp Osmatic dispensing device for releasing beneficial agent
US3916899A (en) 1973-04-25 1975-11-04 Alza Corp Osmotic dispensing device with maximum and minimum sizes for the passageway
US4008719A (en) 1976-02-02 1977-02-22 Alza Corporation Osmotic system having laminar arrangement for programming delivery of active agent
US4737462A (en) 1982-10-19 1988-04-12 Cetus Corporation Structural genes, plasmids and transformed cells for producing cysteine depleted muteins of interferon-β
US4518584A (en) 1983-04-15 1985-05-21 Cetus Corporation Human recombinant interleukin-2 muteins
JPH0746994B2 (ja) 1984-10-04 1995-05-24 味の素株式会社 発酵法によるl−アミノ酸の製造法
IE58110B1 (en) 1984-10-30 1993-07-14 Elan Corp Plc Controlled release powder and process for its preparation
US5073543A (en) 1988-07-21 1991-12-17 G. D. Searle & Co. Controlled release formulations of trophic factors in ganglioside-lipsome vehicle
IT1229203B (it) 1989-03-22 1991-07-25 Bioresearch Spa Impiego di acido 5 metiltetraidrofolico, di acido 5 formiltetraidrofolico e dei loro sali farmaceuticamente accettabili per la preparazione di composizioni farmaceutiche in forma a rilascio controllato attive nella terapia dei disturbi mentali organici e composizioni farmaceutiche relative.
US5120548A (en) 1989-11-07 1992-06-09 Merck & Co., Inc. Swelling modulated polymeric drug delivery device
US5733566A (en) 1990-05-15 1998-03-31 Alkermes Controlled Therapeutics Inc. Ii Controlled release of antiparasitic agents in animals
CA2058820C (en) 1991-04-25 2003-07-15 Kotikanyad Sreekrishna Expression cassettes and vectors for the secretion of human serum albumin in pichia pastoris cells
JPH07501450A (ja) 1991-11-29 1995-02-16 モンサント カンパニー 環状ジグアニレート代謝酵素
US5580578A (en) 1992-01-27 1996-12-03 Euro-Celtique, S.A. Controlled release formulations coated with aqueous dispersions of acrylic polymers
EP0672161B1 (en) 1992-11-05 1999-09-22 Xyrofin Oy Recombinant method and host for manufacture of xylitol
US5591767A (en) 1993-01-25 1997-01-07 Pharmetrix Corporation Liquid reservoir transdermal patch for the administration of ketorolac
IT1270594B (it) 1994-07-07 1997-05-07 Recordati Chem Pharm Composizione farmaceutica a rilascio controllato di moguisteina in sospensione liquida
WO1996006926A1 (fr) 1994-08-30 1996-03-07 Ajinomoto Co., Inc. Procede pour produire de la l-valine et de la l-leucine
JP3966583B2 (ja) 1997-06-23 2007-08-29 協和醗酵工業株式会社 発酵法によるl−アミノ酸の製造法
US6365185B1 (en) 1998-03-26 2002-04-02 University Of Cincinnati Self-destructing, controlled release peroral drug delivery system
ZA200503075B (en) 2002-11-07 2006-09-27 Immunogen Inc Anti-CD33 antibodies and method for treatment of acute myeloid leukemia using the same
JP2013529627A (ja) 2010-06-24 2013-07-22 パンメド リミテッド ヒドロキシクロロキンまたはヒドロキシクロロキンおよび抗ウイルス剤の組合せを使用するc型肝炎ウイルス関連疾患の処置
PH12013501201A1 (en) * 2010-12-09 2013-07-29 Univ Pennsylvania Use of chimeric antigen receptor-modified t cells to treat cancer
NL2006359C2 (en) 2011-03-08 2012-04-24 Bird Engineering B V Genetically modified cell and process for use of said cell.
US20130309223A1 (en) 2012-05-18 2013-11-21 Seattle Genetics, Inc. CD33 Antibodies And Use Of Same To Treat Cancer
UY35468A (es) 2013-03-16 2014-10-31 Novartis Ag Tratamiento de cáncer utilizando un receptor quimérico de antígeno anti-cd19
SG11201604784XA (en) 2013-12-13 2016-07-28 Genentech Inc Anti-cd33 antibodies and immunoconjugates
US20170335281A1 (en) 2014-03-15 2017-11-23 Novartis Ag Treatment of cancer using chimeric antigen receptor
EP4205749A1 (en) 2014-07-31 2023-07-05 Novartis AG Subset-optimized chimeric antigen receptor-containing cells
MX2017002205A (es) 2014-08-19 2017-08-21 Novartis Ag Receptor quimerico de antigeno (car) anti-cd123 para uso en el tratamiento de cancer.
RU2021118125A (ru) * 2014-12-29 2022-04-06 Новартис Аг Способы получения экспрессирующих химерный антигенный рецептор клеток
EP4286511A3 (en) 2015-06-12 2024-03-06 Lentigen Technology, Inc. Method to treat cancer with engineered t-cells
JP6821688B2 (ja) 2015-10-09 2021-01-27 ミルテニー・バイオテク・テクノロジー・インコーポレイテッドMiltenyi Biotec Technology, Inc. キメラ抗原受容体および使用方法
CA3011538A1 (en) 2016-01-18 2017-07-27 Arisan Therapeutics Adamantane derivatives for the treatment of filovirus infection
WO2019018185A1 (en) 2017-07-15 2019-01-24 Arisan Therapeutics Inc. ENANTIOMERICALLY PURE ADAMATANE DERIVATIVES FOR THE TREATMENT OF FILOVIRUS INFECTIONS
CN117721084A (zh) * 2017-10-12 2024-03-19 美商生物细胞基因治疗有限公司 靶向多种抗原的复合嵌合抗原受体(cCAR)及其组成和使用方法
WO2019079339A1 (en) 2017-10-18 2019-04-25 Avalon Flaviviral Therapeutics (Hk) Limited COMPOSITIONS AND METHODS FOR BROAD SPECTRUM ANTIVIRAL THERAPY
IL321548A (en) * 2018-05-22 2025-08-01 Immunitybio Inc Recombinant NK cells expressing a chimeric antigen receptor (CAR) for epsilon-FC and uses thereof
WO2020055368A2 (en) 2018-09-12 2020-03-19 Istanbul Medipol Universitesi Usage of terpenic coumarin derived molecules in treating viral diseases
AU2019377461A1 (en) * 2018-11-06 2021-05-27 Washington University Chimeric antigen receptor memory-like (CARML) NK cells and methods of making and using same
EP3773918A4 (en) * 2019-03-05 2022-01-05 Nkarta, Inc. CD19 DIRECTED CHIMERIC ANTIGEN RECEPTORS AND THEIR USES IN IMMUNOTHERAPY
WO2020198128A1 (en) * 2019-03-22 2020-10-01 The Regents Of The University Of California Switchable chimeric antigen receptor-engineered human natural killer cells
US20200308248A1 (en) * 2019-03-26 2020-10-01 ST Phi Therapeutics Chimeric Natural Killer Cell Receptors and Method of Using Thereof

Patent Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20180161017A1 (en) * 2013-01-29 2018-06-14 Becton, Dickinson And Company Specimen Collection Container Having a Fluid Separation Chamber
US20180002438A1 (en) * 2015-01-29 2018-01-04 Regents Of The University Of Minnesota Chimeric antigen receptors, compositions, and methods

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
Morgan, M., et al., Use of Cell and Genome Modification Technologies to Generate Improved "Off-the-Shelf" CAR T and CAR NK Cells, Frontiers in Immunology, Aug. 7, 2020, 11:1965. (Year: 2020) *

Also Published As

Publication number Publication date
WO2022161355A1 (en) 2022-08-04
EP4284394A1 (en) 2023-12-06
CN117062611A (zh) 2023-11-14
JP2024504728A (ja) 2024-02-01

Similar Documents

Publication Publication Date Title
US20240115607A1 (en) Chimeric antigen receptor (car) constructs and nk cells expressing car constructs
US11666642B2 (en) PDE5 compositions and methods for immunotherapy
TWI761868B (zh) FLT3L-Fc融合蛋白及其使用方法
ES2944607T3 (es) Composiciones y métodos para la expresión selectiva de receptores quiméricos para el antígeno
US20230140802A1 (en) Novel platforms for co-stimulation, novel car designs and other enhancements for adoptive cellular therapy
JP2022048304A (ja) ポリペプチド製剤の偽型腫瘍溶解性ウィルス送達
CN110352068A (zh) 合成的免疫受体及其使用方法
JP2017521410A (ja) Il−15ベース分子及びその使用方法
US11059864B2 (en) Chimeric antigen receptor (CAR) modulation
CN111139256A (zh) 使用人源化抗EGFRvIII嵌合抗原受体治疗癌症
CN111712516A (zh) 粘附受体构建体及其在自然杀伤细胞免疫疗法中的用途
CN110475566A (zh) 工程细胞和使用方法
US20080318886A1 (en) Methods of Increasing Cancer Sensitivity to Chemotherapeutic Agents Using Chimeric ISF35
JP7815283B2 (ja) キメラ抗原受容体
JP2022532249A (ja) インターロイキンタンパク質の類似体と組み合わせて癌を処置するための治療用組成物及び方法
JP2024538116A (ja) キメラ抗原受容体のシグナル伝達ドメイン
AU2020307688B2 (en) Combination cancer immunotherapy
US20210346486A1 (en) Combination cell-based therapies
CA3142513C (en) Flt3l-fc fusion proteins and methods of use
WO2025216764A2 (en) Improved anti-cd72 nanobodies for immunotherapy
CN120173884A (zh) 功能优化的嵌合抗原受体效应细胞及其在制备治疗急性髓系白血病的组合物中的应用
HK40071848B (zh) Flt3l-fc融合蛋白和使用方法

Legal Events

Date Code Title Description
AS Assignment

Owner name: CYTOCARES (SHANGHAI) INC., CHINA

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:XU, QIMING;CHEN, LI;ZHU, HUAXING;REEL/FRAME:064408/0431

Effective date: 20220426

STPP Information on status: patent application and granting procedure in general

Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION

Free format text: NON FINAL ACTION COUNTED, NOT YET MAILED

STPP Information on status: patent application and granting procedure in general

Free format text: NON FINAL ACTION COUNTED, NOT YET MAILED

STPP Information on status: patent application and granting procedure in general

Free format text: NON FINAL ACTION MAILED