US20230226175A1 - Modified exotoxin a proteins - Google Patents

Modified exotoxin a proteins Download PDF

Info

Publication number
US20230226175A1
US20230226175A1 US18/001,498 US202118001498A US2023226175A1 US 20230226175 A1 US20230226175 A1 US 20230226175A1 US 202118001498 A US202118001498 A US 202118001498A US 2023226175 A1 US2023226175 A1 US 2023226175A1
Authority
US
United States
Prior art keywords
amino acid
seq
amino acids
sequence
acid residues
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Pending
Application number
US18/001,498
Other languages
English (en)
Inventor
Stefan Jochen KEMMLER
Christian Lizak
Gerald Johann POSCH
Julien Laurent QUEBATTE
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
GlaxoSmithKline Biologicals SA
Original Assignee
GlaxoSmithKline Biologicals SA
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by GlaxoSmithKline Biologicals SA filed Critical GlaxoSmithKline Biologicals SA
Priority to US18/001,498 priority Critical patent/US20230226175A1/en
Assigned to GLAXOSMITHKLINE BIOLOGICALS SA reassignment GLAXOSMITHKLINE BIOLOGICALS SA ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: QUEBATTE, Julien Laurent, LIZAK, Christian, POSCH, Gerald Johann, KEMMLER, Stefan Jochen
Publication of US20230226175A1 publication Critical patent/US20230226175A1/en
Pending legal-status Critical Current

Links

Images

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/385Haptens or antigens, bound to carriers
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/02Bacterial antigens
    • A61K39/025Enterobacteriales, e.g. Enterobacter
    • A61K39/0266Klebsiella
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/62Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
    • A61K47/64Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent
    • A61K47/6415Toxins or lectins, e.g. clostridial toxins or Pseudomonas exotoxins
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/62Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
    • A61K47/64Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent
    • A61K47/646Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent the entire peptide or protein drug conjugate elicits an immune response, e.g. conjugate vaccines
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/04Antibacterial agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/195Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
    • C07K14/21Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Pseudomonadaceae (F)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/195Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
    • C07K14/24Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Enterobacteriaceae (F), e.g. Citrobacter, Serratia, Proteus, Providencia, Morganella, Yersinia
    • C07K14/26Klebsiella (G)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/10Transferases (2.)
    • C12N9/1048Glycosyltransferases (2.4)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/10Transferases (2.)
    • C12N9/1048Glycosyltransferases (2.4)
    • C12N9/1077Pentosyltransferases (2.4.2)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/10Transferases (2.)
    • C12N9/1048Glycosyltransferases (2.4)
    • C12N9/1081Glycosyltransferases (2.4) transferring other glycosyl groups (2.4.99)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12YENZYMES
    • C12Y204/00Glycosyltransferases (2.4)
    • C12Y204/02Pentosyltransferases (2.4.2)
    • C12Y204/02036NAD(+)--diphthamide ADP-ribosyltransferase (2.4.2.36)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12YENZYMES
    • C12Y204/00Glycosyltransferases (2.4)
    • C12Y204/99Glycosyltransferases (2.4) transferring other glycosyl groups (2.4.99)
    • C12Y204/99019Undecaprenyl-diphosphooligosaccharide—protein glycotransferase (2.4.99.19)
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/60Medicinal preparations containing antigens or antibodies characteristics by the carrier linked to the antigen
    • A61K2039/6031Proteins
    • A61K2039/6037Bacterial toxins, e.g. diphteria toxoid [DT], tetanus toxoid [TT]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/60Medicinal preparations containing antigens or antibodies characteristics by the carrier linked to the antigen
    • A61K2039/6031Proteins
    • A61K2039/6068Other bacterial proteins, e.g. OMP
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/02Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
    • YGENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
    • Y02TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
    • Y02ATECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
    • Y02A50/00TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
    • Y02A50/30Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change

Definitions

  • the present invention relates to the field of modified proteins, immunogenic compositions and vaccines comprising the modified proteins, their manufacture and the use of such compositions in medicine. More particularly, it relates to a modified EPA (Exotoxin A of Pseudomonas aeruginosa ) protein.
  • the modified EPA can be used as a carrier protein for other antigens, particularly saccharide antigens or other antigens lacking T cell epitopes.
  • Protein glycosylation is a common posttranslational modification in bacteria by which glycans are covalently attached to surface proteins, flagella, or pili, for example. Glycoproteins play roles in adhesion, stabilization of proteins against proteolysis, and evasion of the host immune response. Two protein glycosylation mechanisms are distinguished by the mode in which the glycans are transferred to proteins: one mechanism involves the transfer of carbohydrates directly from nucleotide-activated sugars to acceptor proteins (used in e.g. protein O-glycosylation in the Golgi apparatus of eukaryotic cells and flagellin O-glycosylation in some bacteria).
  • a second mechanism involves the preassembly of a polysaccharide onto a lipid-carrier (by glycosyltransferases) which is then transferred to a protein acceptor by an oligosaccharyltransferase (OTase) (Faridmoayer et al., J. Bacteriology, pp. 8088-8098, 2007).
  • This second mechanism is used in, e.g.
  • N-glycosylation in the endoplasmic reticulum of eukaryotic cells the well-characterized N-linked glycosylation system of Campylobacter jejuni, and the more recently characterized O-linked glycosylation systems of Neisseria meningitidis, Neisseria gonococcus, and Pseudomonas aeruginosa.
  • O-linked glycosylation O-glycosylation
  • glycans are generally attached to a serine or threonine residue on the protein acceptor.
  • N-linked glycosylation N-linked glycosylation
  • glycans are generally attached to an asparagine residue on the protein acceptor.
  • WO2006/119987 (Aebi et al.) describes proteins, as well as means and methods for producing proteins, with efficiency for N-glycosylation in prokaryotic organisms in vivo. It further describes the introduction of N-glycans into recombinant proteins for modifying immunogenicity, stability, biological, prophylactic and/or therapeutic activity of said proteins, and the provision of a host cell that displays recombinant N-glycosylated proteins of the present invention on its surface. In addition, it describes a recombinant N-glycosylated protein comprising one or more of the following optimized amino acid sequence(s): D/E-X-N-Z-S/T, wherein X and Z may be any natural amino acid except Pro. The introduction of such optimized amino acid sequence(s) into proteins leads to proteins that are N-glycosylated by an oligosaccharyl transferase in these introduced positions.
  • Conjugate vaccines have been a successful approach for vaccination against a variety of bacterial infections.
  • Conjugation of T-independent antigens, for example saccharides, to carrier proteins has long been established as a way of enabling T-cell help to become part of the immune response for a normally T-independent antigen. In this way, an immune response can be enhanced by allowing the development of immune memory and boostability of the response.
  • in vivo methods to produce a “bioconjugate vaccine” have been in development. These in vivo methods leverage the N-glycosylation and O-glycosylation systems discussed above.
  • WO2009/104074 describes a Shigella bioconjugate vaccine comprising a protein carrier comprising exotoxin of Pseudomonas aeruginosa (EPA) that has been modified to contain at least one consensus sequence D/E-X-N-Z-S/T and WO2017/035181 describes E. coli O-antigens covalently bound to a detoxified exotoxin A of P. aeruginosa (EPA) carrier protein.
  • EPA Pseudomonas aeruginosa
  • Exotoxin A of Pseudomonas aeruginosa is a secreted bacterial toxin, a member of the ADP-ribosyltransferasetoxin family.
  • the native protein is a single polypeptide chain of 613 amino acids (67kDa).
  • the protein consists of three main domains, domain Ia and b (receptor-binding domain), domain II (transmembrane domain) and domain III (catalytic NAD-ribosyltransferasedomain) (Allured et al., Proc. Natl. Acad. Sci. USA Vol. 83, pp. 1320-1324, March 1986).
  • the present invention provides modified EPA proteins comprising at least one consensus sequence for glycosylation (e.g. D/E-X-N-Z-S/T) for use in conjugation to an antigen (e.g. bacterial polysaccharide).
  • the glycosylation consensus sequences are introduced into specific regions of the EPA carrier protein.
  • the present inventors have found that the position of the consensus sequence in the EPA amino acid sequence can increase glycosylation efficiency and/or optimize the operation of the N-glycosylation site.
  • Modified EPA proteins of the invention show higher site occupancy, higher sugar:protein ratio and/or higher yield. Differences in protein glycosylation may also influence the biological activity, antigenicity, stability and/or half-life of the protein.
  • the modified EPA proteins described herein are modified such that the number of glycosylation sites in the carrier proteins is optimized. This may allow for lower concentrations of the EPA protein to be administered in its conjugate form, e.g. in an immunogenic composition or vaccine.
  • the present invention also provides further EPA carrier proteins so that there is a choice of EPA carrier proteins with different numbers of consensus sequence sites for different saccharide antigens.
  • the number of glycosites may be selected to optimise the sugar:protein ratio. For example, for shorter saccharide antigens (glycans) a higher number of glycosites (using the modified EPA carrier proteins of the invention as described herein) may be used to increase the sugar:protein ratio.
  • a modified EPA (Exotoxin A of Pseudomonas aeruginosa ) protein having an amino acid sequence of SEQ ID NO: 1 or an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1, modified in that the amino acid sequence comprises one (or more) consensus sequence(s) selected from: D/E-X-N-Z-S/T (SEQ ID NO: 2) and K-D/E-X-N-Z-S/T-K (SEQ ID NO: 3), wherein X and Z are independently any amino acid except proline, wherein the one (or more) consensus sequences have each been added next to or substituted for one or more amino acids, independently selected from: (i) one or more amino acids between amino acid residues 198-218 (e.g.
  • a modified EPA (Exotoxin A of Pseudomonas aeruginosa ) protein having an amino acid sequence of SEQ ID NO: 1 or an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1, modified in that the amino acid sequence comprises one (or more) consensus sequence(s) selected from: D/E-X-N-Z-S/T (SEQ ID NO: 2) and K-D/E-X-N-Z-S/T-K (SEQ ID NO: 3), wherein X and Z are independently any amino acid except proline, wherein the one (or more) consensus sequences have each been added next to or substituted for one or more amino acids, independently selected from: (i) one or more amino acids between amino acid residues 198-218 (e.g.
  • a conjugate comprising a modified EPA protein of the invention linked to an antigen (e.g. a saccharide antigen, optionally a bacterial polysaccharide antigen).
  • an antigen e.g. a saccharide antigen, optionally a bacterial polysaccharide antigen.
  • a polynucleotide encoding a modified EPA protein of the invention.
  • a vector comprising a polynucleotide encoding a modified EPA protein of the invention.
  • a host cell comprising:
  • nucleotide sequences comprising polysaccharide synthesis genes, optionally for producing a bacterial polysaccharide antigen (e.g. an O-antigen from a Gram negative bacterium optionally from Shigella dysenteriae, Shigella flexneri, Shigella sonnei, Pseudomonas aeruginosa, Klebsiella pneumoniae, or a capsular polysaccharide from a Gram positive bacterium optionally from Streptococcus pneumoniae or Staphylococcus aureus ) or a yeast polysaccharide antigen or a mammalian polysaccharide antigen, optionally integrated into the host cell genome;
  • a bacterial polysaccharide antigen e.g. an O-antigen from a Gram negative bacterium optionally from Shigella dysenteriae, Shigella flexneri, Shigella sonnei, Pseudomonas aeruginosa, Klebsi
  • a nucleotide sequence that encodes a modified EPA protein of the invention optionally within a plasmid.
  • a process for producing a bioconjugate that comprises (or consists of) a modified EPA protein linked to a polysaccharide, said process comprising: (i) culturing the host cell of the invention under conditions suitable for the production of glycoproteins and (ii) isolating the bioconjugate produced by said host cell, optionally isolating the bioconjugate from a periplasmic extract from the host cell.
  • an immunogenic composition comprising a conjugate (e.g. bioconjugate) of the invention and optionally a pharmaceutically acceptable excipient and/or carrier.
  • a vaccine comprising an immunogenic composition of the invention and optionally an adjuvant.
  • a method of inducing an immune response in a subject comprising administering a therapeutically or prophylactically effective amount of a conjugate (e.g. bioconjugate) of the invention, an immunogenic composition of the invention or a vaccine of the invention to a subject (e.g. human) in need thereof.
  • a conjugate e.g. bioconjugate
  • conjugate e.g. bioconjugate
  • an immunogenic composition of the invention e.g. an immunogenic composition of the invention
  • a vaccine of the invention for use in inducing an immune response in a subject (e.g. human).
  • a conjugate e.g. bioconjugate
  • an immunogenic composition of the invention or a vaccine of the invention, for use in the manufacture of a medicament inducing an immune response in a subject (e.g. human).
  • a subject e.g. human
  • FIG. 1 shows 3D structure of EPA presented as cartoon and positions Y208, R274, S318 and A519 selected for insertion of glycosites presented as spheres.
  • FIG. 2 shows sequence alignment of EPA variants containing single glycosite at positions Y208, R274, S318 and A519 compared to EPA without any glycosite.
  • EPA_detox SEQ ID NO: 1
  • EPA_mut_Y208 SEQ ID NO: 34
  • EPA_mutR274 SEQ ID NO: 35
  • EPA_mut_5318 SEQ ID NO: 36
  • EPA_mut_A519 SEQ ID NO: 37
  • FIG. 3 shows SDS-PAGE analysis of IMAC (Immobilized metal affinity chromatography) enriched periplasmic extract of E. coli strains producing KpO-antigen ( Klebsiella pneumoniae O-antigen) polysaccharide and expressing PglB and EPA variants with a glycosite KDQNATK (SEQ ID NO: 4) introduced at the following positions: Y208 (lane 1), K240 (lane 2), R274 (lane 3), S318 (lane 4), A376 (lane 5), A519 (lane 6), and K240 and A376 (lane 7).
  • the bands corresponding to the unglycosylated EPA carrier, and to KpO-antigen-EPA bioconjugates with one and two occupied glycosites are labelled.
  • FIG. 4 shows SDS-PAGE analysis of IMAC enriched periplasmic extract of E. coli strains producing KpO-antigen polysaccharide and expressing PglB and EPA variants with a glycosite KDQNATK (SEQ ID NO: 4) introduced at the following positions: K240 and A376 (lane 1), Y208 and R274 (lane 2), Y208 and S318 (lane 3), Y208 and A519 (lane 4), R274 and S318 (lane 5), R274 and A519 (lane 6), S318 and A519 (lane 7), and Y208 and R274 and A519 (lane 8).
  • the bands corresponding to the unglycosylated EPA carrier, and to KpO-antigen-EPA bioconjugates with one, two and three occupied glycosites are labelled.
  • FIG. 5 shows immunoblot analyses of periplasmic extract of E. coli strains producing KpO-antigen polysaccharide and expressing PglB and EPA variants with 1 to 7 glycosites introduced at the following positions: Y208 (lane 1), K240 (lane 2), R274 (lane 3), S318 (lane 4), A376 (lane 5), A519 (lane 6), and K240 and A376 (lane 7), Y208 and R274 (lane 8), Y208 and S318 (lane 9), Y208 and A519 (lane 10), R274 and S318 (lane 11), R274 and A519 (lane 12), S318 and A519 (lane 13), Y208 and R274 and A519 (lane 14), N-terminal glycotag and K240 and A376 and C-terminal glycotag (lane 15), N-terminal glycotag and Y208 and R274 and A519 (lane 16), N-terminal glycotag and Y208 and R274 and A5
  • the upper panel represents the immunoblot probed with anti-KpO-antigen anti-serum, while the bottom panel represents the immunoblot probed with anti-EPA antibody.
  • the bands corresponding to the unglycosylated EPA carrier, and to KpO-antigen-EPA bioconjugates with one to seven occupied glycosites are labelled.
  • FIG. 6 shows SDS-PAGE analysis of periplasmic extract of E. coli strains producing KpO-antigen polysaccharide and expressing PglB and EPA variants with a glycosite KDQNATK (SEQ ID NO: 4) introduced at the following positions: N-terminal glycotag and Y208 and R274 and A519 and C-terminal glycotag (lane 1), N-terminal glycotag and Y208 and S318 and A519 and C-terminal glycotag (lane 2), N-terminal glycotag and R274 and S318 and A519 and C-terminal glycotag (lane 3), N-terminal glycotag and Y208 and R274 and S318 and A519 and C-terminal glycotag (lane 4), N-terminal glycotag and Y208 and K240 and R274 and S318 and A519 (lane 5), N-terminal glycotag and Y208 and K240 and R274 and S318 and A519 and C-terminal glycotag (lane
  • FIG. 7 shows SDS-PAGE analysis of IMAC enriched periplasmic extracts of E. coli strain producing Sf2a Shigella flexneri 2a (left) or Sp11A Streptococcus pneumoniae 11A (right) polysaccharide and expressing PglB and EPA variants with a glycosite introduced at K240 and a second glycosite at A376 (lane 1) or three glycosites at positions Y208, R274, and A519 (lane 2).
  • FIG. 8 shows SDS-PAGE analysis of IMAC enriched periplasmic extracts of E. coli strain producing two different Klebsiella pneumoniae O-antigen polysaccharides (left and right) and expressing PglB and EPA variants with glycosites at positions Y208 and R274 and A519 (lane 1), or with N-terminal glycotag and glycosites at positions Y208 and R274 and A519 (lane 2).
  • FIG. 9 shows immunoblot analyses of periplasmic extract of E. coli strains producing Sf2a, Sp33F, PaO6 and PaO11 antigen polysaccharide (bottom panel) and expressing PglB and EPA variants with 1 glycosite KDQNATK (SEQ ID NO: 4) introduced at the following positions: Y208 (lane 1), D218 (lane 2), R274 (lane 3), R279 (lane 4), S318 (lane 5), G323 (lane 6), A376 (lane 7), A519 (lane 8), and G525 (lane 9).
  • the bands corresponding to EPA bioconjugates and unglycosylated EPA carrier protein are labelled with arrows.
  • Carrier protein a protein which may be covalently attached to an antigen (e.g. saccharide antigen, such as a bacterial polysaccharide antigen) to create a conjugate (e.g. bioconjugate).
  • an antigen e.g. saccharide antigen, such as a bacterial polysaccharide antigen
  • a carrier protein activates T-cell mediated immunity in relation to the antigen to which it is conjugated.
  • Exotoxin A of Pseudomonas aeruginosa also known as “Exotoxin of P. aeruginosa ”, “EPA”, or “ETA”
  • proline refers to an amino acid selected from the group consisting of alanine (ala, A), arginine (arg, R), asparagine (asn, N) , aspartic acid (asp,D), cysteine (cys, C), glutamine (gln, Q), glutamic acid (glu, E), glycine (gly, G), histidine (his, H), isoleucine (ile, I), leucine (leu, L), lysine (lys, K), methionine (met, M), phenylalanine (phe, F), serine (ser, S), threonine (thr, T), tryptophan (trp, W), tyrosine (tyr, Y), and valine (val, V).
  • alanine ala, A
  • arginine arg, R
  • asparagine asparagine
  • aspartic acid aspartic acid
  • cysteine cysteine
  • Naturally occurring amino acid residues amino acids that are naturally incorporated into polypeptides.
  • the 20 amino acids encoded by the universal genetic code alanine (ala, A), arginine (arg, R), asparagine (asn, N) , aspartic acid (asp,D), cysteine (cys, C) ,glutamine (gln, Q), glutamic acid (glu, E), glycine (gly, G), histidine (his, H), isoleucine (ile,I), leucine (leu, L), lysine (lys, K), methionine (met, M), phenylalanine (phe, F), proline (pro, P), serine (ser, S), threonine (thr, T), tryptophan (trp, W), tyrosine (tyr, Y), and valine (val, V).
  • Glycosyltransferases enzymes that establish glycosidic linkages.
  • Glycosyltransferases are enzymes that catalyze the formation of the glycosidic linkage to form a glycoside. For example, they catalyze the transfer of saccharide moieties from an activated nucleotide sugar (also known as the “glycosyl donor”) to a nucleophilic glycosyl acceptor molecule, the nucleophile of which can be oxygen-carbon-, nitrogen-, or sulfur-based.
  • O-Antigens also known as O-specific polysaccharides or O-side chains
  • LPS surface lipopolysaccharide
  • examples include O-antigens from Pseudomonas aeruginosa and Klebsiella pneumoniae.
  • LPS Lipopolysaccharide
  • Capsular polysaccharide polysaccharide found on the bacterial cell wall. Examples include capsular polysaccharide from Streptococcus pneumoniae, Haemophilus influenzae, Neisseria meningitidis and Staphylococcus aureus.
  • wzy a polysaccharide polymerase gene encoding an enzyme which catalyzes polysaccharide polymerization.
  • the encoded enzyme transfers oligosaccharide units to the non-reducing end forming a glycosidic bond.
  • waaL a O antigen ligase gene encoding a membrane bound enzyme.
  • the encoded enzyme transfers undecaprenyl-diphosphate (UPP)-bound O antigen to the lipid A core oligosaccharide, forming lipopolysaccharide.
  • UFP undecaprenyl-diphosphate
  • conjugate refers to carrier protein covalently linked to an antigen.
  • bioconjugate refers to conjugate between a protein (e.g. a carrier protein) and an antigen (e.g. a saccharide antigen, such as a bacterial polysaccharide antigen) prepared in a host cell background, wherein host cell machinery links the antigen to the protein (e.g. N-linked glycosylation).
  • a protein e.g. a carrier protein
  • an antigen e.g. a saccharide antigen, such as a bacterial polysaccharide antigen
  • modified protein means a protein that is altered (in one or more way) as compared to wild type (e.g. a “modified EPA protein” excludes a wild type EPA protein).
  • immunogenic fragment means a portion of an antigen smaller than the whole, that is capable of eliciting a humoral and/or cellular immune response in a host animal, e.g. human, specific for that fragment.
  • Fragments of a protein can be produced using techniques known in the art, e.g. recombinantly, by proteolytic digestion, or by chemical synthesis.
  • Internal or terminal fragments of a polypeptide can be generated by removing one or more nucleotides from one end (for a terminal fragment) or both ends (for an internal fragment) of a nucleic acid which encodes the polypeptide.
  • fragments comprise at least 10, 20, 30, 40 or 50 contiguous amino acids of the full length sequence.
  • Fragments may be readily modified by adding or removing 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 20, 30, 40 or 50 amino acids from either or both of the N and C termini.
  • a fragment of a modified EPA protein still comprises the recited modifications that are made to the EPA protein.
  • the term “conservative amino acid substitution” involves substitution of a native amino acid residue with a non-native residue such that there is little or no effect on the size, polarity, charge, hydrophobicity, or hydrophilicity of the amino acid residue at that position, and without resulting in decreased immunogenicity.
  • these may be substitutions within the following groups: valine, glycine; glycine, alanine; valine, isoleucine, leucine; aspartic acid, glutamic acid; asparagine, glutamine; serine, threonine; lysine, arginine; and phenylalanine, tyrosine.
  • Conservative amino acid modifications to the sequence of a polypeptide (and the corresponding modifications to the encoding nucleotides) may produce polypeptides having functional and chemical characteristics similar to those of a parental polypeptide.
  • deletion is the removal of one or more amino acid residues from the protein sequence. Typically, no more than about from 1 to 6 residues (e.g. 1 to 4 residues) are deleted at any one site within the protein molecule.
  • insertion or “addition” (including other tenses thereof such as “inserted”) means the addition of one or more non-native amino acid residues in the protein sequence or, as the context requires, addition of one or more non-native nucleotides in the polynucleotide sequence. Typically, no more than about from 1 to 10 residues, (e.g. 1 to 7 residues, 1 to 6 residues, or 1 to 4 residues) are inserted at any one site within the protein molecule.
  • the term “added next to” is the addition of one or more non-native amino acid residues in the protein sequence at a position adjacent to the referenced amino acid or amino acid region.
  • “added next to one or more amino acids between amino acid residues 198-218” means the addition at a position adjacent to any one of amino acid residues 198-218 (including adjacent to amino acid residues 198 or 218).
  • glycosite refers to an amino acid sequence recognized by a bacterial oligosaccharyltransferase, e.g. PglB of C. jejuni.
  • a “consensus sequence” is a sequence have a specific structure and/or function. As used herein, the term “consensus sequence” is a sequence comprising a glycosite.
  • a consensus sequence may be selected from: a five amino acid consensus sequence D/E-X-N-Z-S/T (SEQ ID NO: 2), a seven amino acid consensus sequence K-D/E-X-N-Z-S/T-K (SEQ ID NO: 3) or an extended consensus sequence (e.g. J-D/E-X-N-Z-S/T-U (SEQ ID NO: 5)).
  • the term “introduced at” is used herein to reference the location and manner of inserting a consensus sequence into an amino acid sequence.
  • a glycosite which is introduced at an N-terminal or C-terminal position of a protein may be added next to the amino acid sequence at the N-terminus or C-terminus, whereas a consensus sequence (or glycosite) which is introduced at a specific amino acid residue within the protein, e.g. Y208, may be substituted for that amino acid.
  • numeric range e.g. “25-30” is inclusive of endpoints (i.e. includes the values 25 and 30).
  • endpoints i.e. includes the values 25 and 30.
  • “between amino acids 198 to 218 . . . of SEQ ID NO: 1” refers to position in the amino acid sequence between amino acid 198 and amino acid 218 of SEQ ID NO: 1 including both amino acids 198 and 218.
  • nucleotide sequences or amino acid sequences that are the same or have a specified percentage of nucleotide residues or amino acid residues that are the same (e.g. 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identity over a specified region), when compared and aligned for maximum correspondence using, for example, sequence comparison algorithms or by manual alignment and visual inspection.
  • Identity between polypeptides may be calculated by various algorithms. In general, when calculating percentage identity the two sequences to be compared are aligned to give a maximum correlation between the sequences. This may include inserting “gaps” in either one or both sequences, to enhance the degree of alignment.
  • Needleman Wunsch algorithm (Needleman and Wunsch 1970, J. Mol. Biol. 48: 443-453) for global alignment, or the Smith Waterman algorithm (Smith and Waterman 1981, J. Mol. Biol. 147: 195-197) for local alignment may be used, e.g. using the default parameters (Smith Waterman uses BLOSUM 62 scoring matrix with a Gap opening penalty of 10 and a Gap extension penalty of 1).
  • a preferred algorithm is described by Dufresne et al. in Nature Biotechnology in 2002 (vol. 20, pp. 1269-71) and is used in the software GenePAST (Genome Quest Life Sciences, Inc. Boston, Mass.).
  • the GenePAST “percent identity” algorithm finds the best fit between the query sequence and the subject sequence, and expresses the alignment as an exact percentage. GenePAST makes no alignment scoring adjustments based on considerations of biological relevance between query and subject sequences. Identity between two sequences is calculated across the entire length of both sequences and is expressed as a percentage of the reference sequence (e.g. SEQ ID NO: 1 of the present invention).
  • recombinant means artificial or synthetic.
  • a “recombinant protein” refers to a protein that has been made using recombinant nucleotide sequences (nucleotide sequences introduced into a host cell).
  • the nucleotide sequence that encodes a “recombinant protein” is heterologous to the host cell.
  • an isolated or purified protein mean a protein, conjugate (e.g. bioconjugate), polynucleotide, or vector in a form not found in nature. This includes, for example, a a protein, conjugate (e.g. bioconjugate), polynucleotide, or vector having been separated from host cell or organism (including crude extracts) or otherwise removed from its natural environment.
  • an isolated or purified protein is a protein essentially free from all other polypeptides with which the protein is innately associated (or innately in contact with).
  • the term “subject” refers to an animal, in particular a mammal such as a primate (e.g. human).
  • an “effective amount” in the context of administering a therapy (e.g. an immunogenic composition or vaccine of the invention) to a subject refers to the amount of a therapy which has a prophylactic and/or therapeutic effect(s).
  • an “effective amount” refers to the amount of a therapy which is sufficient to achieve one, two, three, four, or more of the following effects: (i) reduce or ameliorate the severity of a bacterial infection or symptom associated therewith; (ii) reduce the duration of a bacterial infection or symptom associated therewith; (iii) prevent the progression of a bacterial infection or symptom associated therewith; (iv) cause regression of a bacterial infection or symptom associated therewith; (v) prevent the development or onset of a bacterial infection, or symptom associated therewith; (vi) prevent the recurrence of a bacterial infection or symptom associated therewith; (vii) reduce organ failure associated with a bacterial infection; (viii) reduce hospitalization of a subject
  • the word “is” may be used as a substitute for “consists of” or “consisting of”.
  • the abbreviation, “e.g.” is derived from the Latin exempli gratia, and is used herein to indicate a non-limiting example. Thus, the abbreviation “e.g.” is synonymous with the term “for example”.
  • Exotoxin A of Pseudomonas aeruginosa is a secreted bacterial toxin, a member of the ADP-ribosyltransferasetoxin family.
  • An EPA protein useful in the invention can be produced by methods known in the art in view of the present disclosure, see for example Ihssen etas. (2010) Microbial Cell Factories 9:61, WO 2006/119987, WO 2009/104074 and WO2015124769A1.
  • Exotoxin A from Pseudomonas aeruginosa strain PA103 was cloned and sequenced by Gray etas. (1984) Proc. Nati. Acad. Sci.
  • a modified EPA protein of the invention may be genetically detoxified (i.e. by mutation).
  • the genetically detoxified sequences may remove undesirable activities such as ADP-ribosyltransferase activity, in order to reduce the toxicity, whilst retaining the ability to induce anti-EPA protective and/or neutralizing antibodies following administration to a human.
  • the genetically detoxified sequences may maintain their immunogenic epitopes.
  • a modified EPA protein may be genetically detoxified by one or more point mutations.
  • detoxification can be achieved by mutating and deleting catalytically essential residues, such as substitution of leucine 552 to valine (L552V) and by deletion of glutamic acid-553 ( ⁇ E553), according to Lukac et al. (1988), Infect Immun, 56: 3095-3098, and Ho et al. (2006), Hum Vaccin, 2:89-98.
  • Detoxification can be achieved by mutating/deleting the catalytically essential residues L552V ⁇ E553 using quick change mutagenesis (Stratagene) and phosphorylated oligonucleotides 5′-GAAGGCGGGCGCGTGACCATTCTCGGC (SEQ. ID NO.
  • Detoxification can be measured by determining the inhibition of ADP-ribosyltransferase and cytotoxic activity according to the methodology described in Lukac et al. (1988), Infect Immun, 56: 3095-3098, and references cited therein, namely Douglas et al (1987) J. Bacteriol 169: 4962-4966 and Douglas et al (1987).
  • a detoxified EPA has ADP-ribosyltransferase and cytotoxic activites lower than wild-type EPA, suitably the same as or less than that of the modified EPA described in Lukac et al (1988) i.e. ⁇ E553 EPA (EPA having deletion of glutamic acid-533).
  • the modified EPA protein of the invention may be the amino acid sequence of SEQ ID NO: 1 (or an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1).
  • the modified EPA protein may comprise substitution of leucine 552 to valine (L552V) and deletion of glutamine 553 ( ⁇ E553) with reference to the amino acid sequence of SEQ ID NO: 1 (or an equivalent position in an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1).
  • the modified EPA protein of the invention may be the amino acid sequence of SEQ ID NO: 1 (or an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1) comprising substitution of leucine 552 to valine (L552V).
  • the modified EPA protein of the invention may be the amino acid sequence of SEQ ID NO: 1 (or an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1) comprising deletion of glutamine 553 ( ⁇ E553).
  • the modified EPA protein of the invention is modified by substitution of leucine 552 to valine (L552V) and deletion of glutamine 553 ( ⁇ E553).
  • the modified EPA protein of the invention is the amino acid sequence of SEQ ID NO: 1 (or an equivalent position in an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1) comprising substitution of leucine 552 to valine (L552V) and deletion of glutamine 553 ( ⁇ E553).
  • EPA protein has the amino acid sequence of SEQ ID NO: 1:
  • modified EPA protein refers to a EPA amino acid sequence (for example, having a amino acid sequence of SEQ ID NO: 1 or an amino acid sequence at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1), which EPA amino acid sequence has been modified by the addition, substitution or deletion of one or more amino acids (for example, by addition of a consensus sequence(s) selected from D/E-X-N-Z-S/T (SEQ ID NO: 2), K-D/E-X-N-Z-S/T-K (SEQ ID NO: 3) and/or an extended consensus sequence (e.g.
  • J-D/E-X-N-Z-S/T-U (SEQ ID NO: 5)).; and/or by substitution of one or more amino acids by a consensus sequence(s) selected from D/E-X-N-Z-S/T (SEQ ID NO: 2) and K-D/E-X-N-Z-S/T-K (SEQ ID NO: 3)).
  • a modified EPA protein may be an EPA amino acid sequence of SEQ ID NO: 1 which has been modified in that the amino acid sequence comprises one (or more) consensus sequence(s) selected from D/E-X-N-Z-S/T (SEQ ID NO: 2), K-D/E-X-N-Z-S/T-K (SEQ ID NO: 3) and/or an extended consensus sequence (e.g. J-D/E-X-N-Z-S/T-U (SEQ ID NO: 5)).
  • SEQ ID NO: 2 D/E-X-N-Z-S/T
  • K-D/E-X-N-Z-S/T-K SEQ ID NO: 3
  • an extended consensus sequence e.g. J-D/E-X-N-Z-S/T-U (SEQ ID NO: 5)
  • X and Z are independently any amino acid except proline; preferably, X is Q (glutamine) and Z is A (alanine).
  • the modified EPA protein may also comprise further modifications (additions, substitutions, deletions).
  • the modified EPA protein of the invention comprises substitution of leucine 552 to valine (L552V) and deletion of glutamine 553 ( ⁇ E553) with reference to the amino acid sequence of SEQ ID NO: 1 (or an equivalent position in an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1).
  • the modified EPA protein of the invention is a non-naturally occurring EPA protein (i.e. not native).
  • a modified EPA protein of the invention may have an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1.
  • a modified EPA protein of the invention may have an amino acid sequence at least 80% identical to SEQ ID NO: 1.
  • a modified EPA protein of the invention may have an amino acid sequence at least 85% identical to SEQ ID NO: 1.
  • a modified EPA protein of the invention may have an amino acid sequence at least 90% identical to SEQ ID NO: 1.
  • a modified EPA protein of the invention may have an amino acid sequence at least 91% identical to SEQ ID NO: 1.
  • a modified EPA protein of the invention may have an amino acid sequence at least 92% identical to SEQ ID NO: 1.
  • a modified EPA protein of the invention may have an amino acid sequence at least 93% identical to SEQ ID NO: 1.
  • a modified EPA protein of the invention may have an amino acid sequence at least 94% identical to SEQ ID NO: 1.
  • a modified EPA protein of the invention may have an amino acid sequence at least 95% identical to SEQ ID NO: 1.
  • a modified EPA protein of the invention may have an amino acid sequence at least 96% identical to SEQ ID NO: 1.
  • a modified EPA protein of the invention may have an amino acid sequence at least 97% identical to SEQ ID NO: 1.
  • a modified EPA protein of the invention may have an amino acid sequence at least 98% identical to SEQ ID NO: 1.
  • a modified EPA protein of the invention may have an amino acid sequence at least 99% identical to SEQ ID NO: 1.
  • the present invention provides a modified EPA (Exotoxin A of Pseudomonas aeruginosa ) protein having an amino acid sequence of SEQ ID NO: 1 or an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1, modified in that the amino acid sequence comprises one (or more) consensus sequence(s) selected from: D/E-X-N-Z-S/T (SEQ ID NO: 2) and K-D/E-X-N-Z-S/T-K (SEQ ID NO: 3), wherein the one (or more) consensus sequences have each been added next to or substituted for one or more amino acids, selected from specific amino acid residues within the EPA protein (consensus sequence sites).
  • consensus sequence sites are independently selected from (i) one or more amino acids between amino acid residues 198-218 (e.g. one or more amino acids between amino acid residues 203-213, e.g. amino acid residue Y208), (ii) one or more amino acids between amino acid residues 264-284 (e.g. one or more amino acids between amino acid residues 269-279, e.g. amino acid residue R274), (iii) one or more amino acids between amino acid residues 308-328 (e.g. one or more amino acids between amino acid residues 313-323, e.g. amino acid residue S318), and (iv) one or more amino acids between amino acid residues 509-529 (e.g.
  • amino acids between amino acid residues 514-524 e.g. amino acid residue A519) of SEQ ID NO: 1 or at equivalent position(s) within an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1.
  • the present invention provides a modified EPA (Exotoxin A of Pseudomonas aeruginosa ) protein having an amino acid sequence of SEQ ID NO: 1 or an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1, modified in that the amino acid sequence comprises one (or more) consensus sequence(s) selected from: D/E-X-N-Z-S/T (SEQ ID NO: 2) and K-D/E-X-N-Z-S/T-K (SEQ ID NO: 3), wherein X and Z are independently any amino acid except proline, wherein the one (or more) consensus sequences have each been added next to or substituted for one or more amino acids, independently selected from: (i) one or more amino acids between amino acid residues 198-218 (e.g.
  • amino acids between amino acid residues 203-213, e.g. amino acid residue Y208 one or more amino acids between amino acid residues 203-213, e.g. amino acid residue Y208
  • amino acid residues 264-284 one or more amino acids between amino acid residues 269-279, e.g. amino acid residue R274
  • amino acid residues 308-328 one or more amino acids between amino acid residues 313-323, e.g. amino acid residue S318)
  • amino acids between amino acid residues 509-529 e.g. one or more amino acids between amino acid residues 514-524; e.g.
  • the present invention also provides a modified EPA (Exotoxin A of Pseudomonas aeruginosa ) protein having an amino acid sequence of SEQ ID NO: 1 or an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1, modified in that the amino acid sequence comprises one (or more) consensus sequence(s) selected from: D/E-X-N-Z-S/T (SEQ ID NO: 2) and K-D/E-X-N-Z-S/T-K (SEQ ID NO: 3), wherein X and Z are independently any amino acid except proline, wherein the one (or more) consensus sequences have each been added next to or substituted for one or more amino acids, independently selected from: (i) one or more amino acids between amino acid residues 198-218 (e.g.
  • the present invention also provides a modified EPA (Exotoxin A of Pseudomonas aeruginosa ) protein having an amino acid sequence of SEQ ID NO: 1 or an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1, modified in that the amino acid sequence comprises two (or more) consensus sequence(s) selected from: D/E-X-N-Z-S/T (SEQ ID NO: 2) and K-D/E-X-N-Z-S/T-K (SEQ ID NO: 3), wherein the two (or more) consensus sequences have each been added next to or substituted for one or more amino acids, selected from specific amino acid residues within the EPA protein (consensus sequence sites).
  • EPA Exotoxin A of Pseudomonas aeruginosa
  • consensus sequence sites are independently selected from: (i) one or more amino acids between amino acid residues 198-218 (e.g. one or more amino acids between amino acid residues 203-213, e.g. amino acid residue Y208), (ii) one or more amino acids between amino acid residues 264-284 (e.g. one or more amino acids between amino acid residues 269-279, e.g. amino acid residue R274), (iii) one or more amino acids between amino acid residues 308-328 (e.g. one or more amino acids between amino acid residues 313-323, e.g. amino acid residue S318), (iv) one or more amino acids between amino acid residues 509-529 (e.g.
  • the present invention provides a modified EPA (Exotoxin A of Pseudomonas aeruginosa ) having an amino acid sequence of SEQ ID NO: 1 or an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1, modified in that the amino acid sequence comprises two (or more) consensus sequence(s) selected from: D/E-X-N-Z-S/T (SEQ ID NO: 2) and K-D/E-X-N-Z-S/T-K (SEQ ID NO: 3), wherein X and Z are independently any amino acid except proline, wherein the two (or more) consensus sequences have each been added next to or substituted for one or more amino acids, independently selected from: (i) one or more amino acids between amino acid residues 198-218 (e.g.
  • amino acid residue A519) amino acid residue A517
  • amino acid residues 230-250 one or more amino acids between amino acid residues 235-245; e.g. amino acid residue K240
  • amino acid residue K240 amino acid residue K240
  • the present invention also provides a modified EPA (Exotoxin A of Pseudomonas aeruginosa ) having an amino acid sequence of SEQ ID NO: 1 or an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1, modified in that the amino acid sequence comprises two (or more) consensus sequence(s) selected from: D/E-X-N-Z-S/T (SEQ ID NO: 2) and K-D/E-X-N-Z-S/T-K (SEQ ID NO: 3), wherein the two (or more) consensus sequences have each been added next to or substituted for one or more amino acids, independently selected from: (i) one or more amino acids between amino acid residues 198-218 (e.g.
  • the two (or more) consensus sequences may also be independently selected from: (i) one or more amino acids between amino acid residues 198-218 (e.g. one or more amino acids between amino acid residues 203-213; or one or more amino acids between 205-211; e.g. amino acid residue D218; e.g. amino acid residue Y208), (ii) one or more amino acids between amino acid residues 264-284 (e.g. one or more amino acids between amino acid residues 269-279; or one or more amino acids between amino acid residues 271-277, e.g. amino acid residue R279, e.g. amino acid residue R274), (iii) one or more amino acids between amino acid residues 308-328 (e.g.
  • the present invention also provides a modified EPA (Exotoxin A of Pseudomonas aeruginosa ) protein having an amino acid sequence of SEQ ID NO: 1 or an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1, modified in that the amino acid sequence comprises three (or more) consensus sequence(s) selected from: D/E-X-N-Z-S/T (SEQ ID NO: 2) and K-D/E-X-N-Z-S/T-K (SEQ ID NO: 3), wherein the three (or more) consensus sequences have each been added next to or substituted for one or more amino acids, selected from specific amino acid residues within the EPA protein (consensus sequence sites).
  • EPA Exotoxin A of Pseudomonas aeruginosa
  • consensus sequence sites are independently selected from: (i) one or more amino acids between amino acid residues 198-218 (e.g. one or more amino acids between amino acid residues 203-213, e.g. amino acid residue Y208), (ii) one or more amino acids between amino acid residues 264-284 (e.g. one or more amino acids between amino acid residues 269-279, e.g. amino acid residue R274), (iii) one or more amino acids between amino acid residues 308-328 (e.g. one or more amino acids between amino acid residues 313-323, e.g. amino acid residue S318), (iv) one or more amino acids between amino acid residues 509-529 (e.g.
  • the present invention provides a modified EPA (Exotoxin A of Pseudomonas aeruginosa ) having an amino acid sequence of SEQ ID NO: 1 or an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1, modified in that the amino acid sequence comprises three (or more) consensus sequence(s) selected from: D/E-X-N-Z-S/T (SEQ ID NO: 2) and K-D/E-X-N-Z-S/T-K (SEQ ID NO: 3), wherein X and Z are independently any amino acid except proline, wherein the three (or more) consensus sequences have each been added next to or substituted for one or more amino acids, independently selected from: (i) one or more amino acids between amino acid residues 198-218 (e.g.
  • amino acid residue A519) of SEQ ID NO: 1 (v) one or more amino acids between amino acid residues 230-250 (e.g. one or more amino acids between amino acid residues 235-245; e.g. amino acid residue K240) or at equivalent position(s) within an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1.
  • the three (or more) consensus sequences may also be independently selected from: (i) one or more amino acids between amino acid residues 198-218 (e.g. one or more amino acids between amino acid residues 203-213; or one or more amino acids between 205-211; e.g. amino acid residue D218; e.g. amino acid residue Y208), (ii) one or more amino acids between amino acid residues 264-284 (e.g. one or more amino acids between amino acid residues 269-279; or one or more amino acids between amino acid residues 271-277, e.g. amino acid residue R279, e.g. amino acid residue R274), (iii) one or more amino acids between amino acid residues 308-328 (e.g.
  • the present invention also provides a modified EPA (Exotoxin A of Pseudomonas aeruginosa ) protein having an amino acid sequence of SEQ ID NO: 1 or an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1, modified in that the amino acid sequence comprises four (or more) consensus sequence(s) selected from: D/E-X-N-Z-S/T (SEQ ID NO: 2) and K-D/E-X-N-Z-S/T-K (SEQ ID NO: 3), wherein the four (or more) consensus sequences have each been added next to or substituted for one or more amino acids, selected from specific amino acid residues within the EPA protein (consensus sequence sites).
  • SEQ ID NO: 2 D/E-X-N-Z-S/T
  • SEQ ID NO: 3 K-D/E-X-N-Z-S/T-K
  • consensus sequence sites are independently selected from: (i) one or more amino acids between amino acid residues 198-218 (e.g. one or more amino acids between amino acid residues 203-213, e.g. amino acid residue Y208), (ii) one or more amino acids between amino acid residues 264-284 (e.g. one or more amino acids between amino acid residues 269-279, e.g. amino acid residue R274), (iii) one or more amino acids between amino acid residues 308-328 (e.g. one or more amino acids between amino acid residues 313-323, e.g. amino acid residue S318), (iv) one or more amino acids between amino acid residues 509-529 (e.g.
  • the present invention provides a modified EPA (Exotoxin A of Pseudomonas aeruginosa ) having an amino acid sequence of SEQ ID NO: 1 or an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1, modified in that the amino acid sequence comprises four (or more) consensus sequence(s) selected from: D/E-X-N-Z-S/T (SEQ ID NO: 2) and K-D/E-X-N-Z-S/T-K (SEQ ID NO: 3), wherein X and Z are independently any amino acid except proline, wherein the four (or more) consensus sequences have each been added next to or substituted for one or more amino acids, independently selected from: (i) one or more amino acids between amino acid residues 198-218 (e.g.
  • amino acid residue A519) of SEQ ID NO: 1 (v) one or more amino acids between amino acid residues 230-250 (e.g. one or more amino acids between amino acid residues 235-245; e.g. amino acid residue K240) or at equivalent position(s) within an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1.
  • the four (or more) consensus sequences may also be independently selected from: (i) one or more amino acids between amino acid residues 198-218 (e.g. one or more amino acids between amino acid residues 203-213; or one or more amino acids between 205-211; e.g. amino acid residue D218; e.g. amino acid residue Y208), (ii) one or more amino acids between amino acid residues 264-284 (e.g. one or more amino acids between amino acid residues 269-279; or one or more amino acids between amino acid residues 271-277, e.g. amino acid residue R279, e.g. amino acid residue R274), (iii) one or more amino acids between amino acid residues 308-328 (e.g.
  • the modified EPA protein of the invention may be derived from an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1 which is an immunogenic fragment and/or a variant of SEQ ID NO: 1.
  • the modified EPA protein of the invention may be derived from an immunogenic fragment of SEQ ID NO: 1 comprising at least about 15, at least about 20, at least about 40, or at least about 60 contiguous amino acid residues of SEQ ID NO: 1, wherein said polypeptide is capable of eliciting an antibodies which bind to SEQ ID NO: 1.
  • the immunogenic fragment of SEQ ID NO: 1 comprises the eight cysteines of SEQ ID NO: 1: Cys-11, Cys-15, Cys-197, Cys-214, Cys-265, Cys-287, Cys-372 and Cys-379 (i.e. these residues are not modified).
  • the modified EPA protein of the invention comprises the eight cysteines of SEQ ID NO: 1: Cys-11, Cys-15, Cys-197, Cys-214, Cys-265, Cys -287, Cys-372 and Cys-379 or equivalent cysteines within an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1.
  • the modified EPA protein of the invention may be derived from an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1 which is a variant of SEQ ID NO: 1 and differs from SEQ ID NO: 1 by the deletion and/or addition and/or substitution of one or more amino acids (e.g. 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 or 12 amino acids). Amino acid substitution may be conservative or non-conservative. In one aspect, amino acid substitution is conservative. Substitutions, deletions, additions or any combination thereof may be combined in a single variant so long as the variant is an immunogenic polypeptide.
  • the modified EPA protein of the present invention may be derived from a variant of SEQ ID NO: 1 in which 1 to 10, 5 to 10, 1 to 5, 1 to 3, 1 to 2 or 1 amino acids of SEQ ID NO: 1 have been substituted or deleted.
  • the immunogenic fragment and/or a variant of SEQ ID NO: 1 comprises a B-cell or T-cell epitope.
  • Such epitopes may be predicted using a combination of 2D-structure prediction, e.g. using the PSIPRED program (from David Jones, Brunel Bioinformatics Group, Dept. Biological Sciences, Brunel University, Uxbridge UB8 3PH, UK) and antigenic index calculated on the basis of the method described by Jameson and Wolf (CABIOS 4:181-186 [1988]).
  • one or more consensus sequences have each been added next to, or substituted for one or more amino acids of SEQ ID NO: 1 or a EPA amino acid sequence at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1.
  • one or more amino acids e.g. 1-7 amino acids, e.g.
  • one amino acid) of the EPA amino acid sequence (for example, having an amino acid sequence of SEQ ID NO: 1 or a EPA amino acid sequence at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1) is/are substituted by a five amino acid D/E-X-N-Z-S/T (SEQ ID NO: 2) or by a seven amino acid K-D/E-X-N-Z-S/T-K (SEQ ID NO: 3) (e.g. K-D-Q-N-A-T-K (SEQ ID NO: 4) also referred to as “KDQNATK”) consensus sequence.
  • a single amino acid in the EPA amino acid sequence may be substituted (i.e. replaced) with a D/E-X-N-Z-S/T (SEQ ID NO: 2) or K-D/E-X-N-Z-S/T-K (SEQ ID NO: 3) (e.g. K-D-Q-N-A-T-K (SEQ ID NO: 4)) consensus sequence.
  • SEQ ID NO: 1 a single amino acid in the EPA amino acid sequence
  • SEQ ID NO: 3 e.g. K-D-Q-N-A-T-K (SEQ ID NO: 4) consensus sequence.
  • 2, 3, 4, 5, 6 or 7 amino acids in the EPA amino acid sequence e.g.
  • SEQ ID NO: 1 or a EPA amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1) may be substituted (i.e. replaced) with a D/E-X-N-Z-S/T (SEQ ID NO: 2) or K-D/E-X-N-Z-S/T-K (SEQ ID NO: 3) (e.g. K-D-Q-N-A-T-K (SEQ ID NO: 4)) consensus sequence.
  • SEQ ID NO: 2 e.g. K-D-Q-N-A-T-K (SEQ ID NO: 4) consensus sequence.
  • an internal consensus sequence site i.e.
  • a consensus sequence site that is within the EPA amino acid sequence rather than added next to the N-terminal or C-terminal amino acid
  • a single amino acid in the EPA amino acid sequence e.g. SEQ ID NO: 1
  • a K-D-Q-N-A-T-K SEQ ID NO: 4
  • the classical 5 amino acid glycosylation consensus sequence D/E-X-N-Z-S/T (SEQ ID NO: 2)
  • SEQ ID NO: 2 may also be extended by 1-5 other amino acid residues either side of the consensus sequence for more efficient glycosylation.
  • an extended consensus sequence may be J-D/E-X-N-Z-S/T-U (SEQ ID NO: 5).
  • J and U are independently 1 to 5 naturally occurring amino acid residues, preferably J and U are independently 1 to 5 amino acid residues independently selected from glycine and/or serine, e.g. B may be G-S-G-G-G and U may be G-S-G-G.
  • an extended consensus sequence may be G-S-G-G-G-D/E-X-N-Z-S/T-G-S-G-G (SEQ ID NO: 25).
  • an extended consensus sequence such as J-D/E-X-N-Z-S/T-U (SEQ ID NO: 5) or G-S-G-G-G-D/E-X-N-Z-S/T-G-S-G-G (SEQ ID NO: 25) is used where the consensus sequence is added next to the N-terminal or C-terminal amino acid of the EPA protein.
  • a combination of consensus sequences selected from: a five amino acid consensus sequence D/E-X-N-Z-S/T (SEQ ID NO: 1), a seven amino acid consensus sequence K-D/E-X-N-Z-S/T-K (SEQ ID NO: 3) and an extended consensus sequence (e.g. J-D/E-X-N-Z-S/T-U (SEQ ID NO: 5)) may be used.
  • a five amino acid consensus sequence D/E-X-N-Z-S/T (SEQ ID NO: 1)
  • a seven amino acid consensus sequence K-D/E-X-N-Z-S/T-K SEQ ID NO: 3
  • an extended consensus sequence e.g. J-D/E-X-N-Z-S/T-U (SEQ ID NO: 5)
  • amino acids within the carrier protein amino acid sequence may each independently be substituted (i.e.
  • X and Z are independently any amino acid except proline (preferably wherein X is Q (glutamine), Z is A (alanine)) (e.g.
  • K-D-Q-N-A-T-K (SEQ ID NO: 4), and 1 or 2 consensus sequences J-D/E-X-N-Z-S/T-U (SEQ ID NO: 5) wherein J and U are independently 1 to 5 naturally occurring amino acid residues (preferably J and U are independently 1 to 5 amino acid residues independently selected from glycine and/or serine, e.g. G-S-G-G-G-D/E-X-N-Z-S/T-G-S-G-G (SEQ ID NO: 25)) may be added next to the N-terminal or C-terminal amino acids of the carrier protein.
  • a carrier protein may comprise 1, 2, 3, 4 or 5 consensus sequences selected from D/E-X-N-Z-S/T (SEQ ID NO: 2) and K-D/E-X-N-Z-S/T-K (SEQ ID NO: 3), wherein X and Z are independently any amino acid except proline (preferably wherein X is Q (glutamine), Z is A (alanine)), and the carrier protein may further comprise 1 or 2 extended consensus sequences J-D/E-X-N-Z-S/T-U (SEQ ID NO: 5) wherein J and U are independently 1 to 5 naturally occurring amino acid residues (preferably J and U are independently 1 to 5 amino acid residues independently selected from glycine and/or serine, e.g.
  • G-S-G-G-G-D/E-X-N-Z-S/T-G-S-G-G (SEQ ID NO: 25).
  • Introduction of one or more consensus sequence(s) selected from: a five amino acid consensus sequence D/E-X-N-Z-S/T (SEQ ID NO: 2), a seven amino acid consensus sequence K-D/E-X-N-Z-S/T-K (SEQ ID NO: 3) and/or an extended consensus sequence (e.g. J-D/E-X-N-Z-S/T-U (SEQ ID NO: 5)) enables the modified EPA protein to be glycosylated.
  • the present invention also provides a modified EPA protein of the invention wherein the modified EPA protein is glycosylated.
  • the present inventors have found that the position of the consensus sequence at specific regions/amino acids in the EPA amino acid sequence can increase glycosylation efficiency and/or optimize the operation of the N-glycosylation site.
  • a consensus sequence selected from D/E-X-N-Z-S/T (SEQ ID NO: 2) and K-D/E-X-N-Z-S/T-K (SEQ ID NO: 3) (e.g. K-D-Q-N-A-T-K (SEQ ID NO: 4)) may be added next to or substituted for one or more amino acids residue(s) between amino acids 198-218 of SEQ ID NO: 1 or an equivalent position in an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1.
  • a D/E-X-N-Z-S/T (SEQ ID NO: 2) or K-D/E-X-N-Z-S/T-K (SEQ ID NO: 3) (e.g. K-D-Q-N-A-T-K (SEQ ID NO: 4)) consensus sequence may be substituted for amino acid residue Y208 or D218 of SEQ ID NO: 1 or an equivalent position in an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1.
  • a D/E-X-N-Z-S/T (SEQ ID NO: 2) or K-D/E-X-N-Z-S/T-K (SEQ ID NO: 3) (e.g. K-D-Q-N-A-T-K (SEQ ID NO: 4)) consensus sequence may be added next to or substituted for one or more amino acids residues between amino acids 205-211 of SEQ ID NO: 1 or an equivalent position in an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1.
  • a D/E-X-N-Z-S/T (SEQ ID NO: 2) or K-D/E-X-N-Z-S/T-K (SEQ ID NO: 3) (e.g. K-D-Q-N-A-T-K (SEQ ID NO: 4)) consensus sequence may be substituted for amino acid residue Y208 of SEQ ID NO: 1 or an equivalent position in an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1.
  • a consensus sequence selected from D/E-X-N-Z-S/T (SEQ ID NO: 2) and K-D/E-X-N-Z-S/T-K (SEQ ID NO: 3) (e.g. K-D-Q-N-A-T-K (SEQ ID NO: 4)) may be added next to or substituted for one or more amino acids residue(s) between amino acids 264-284 of SEQ ID NO: 1 or an equivalent position in an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1.
  • a D/E-X-N-Z-S/T (SEQ ID NO: 2) or K-D/E-X-N-Z-S/T-K (SEQ ID NO: 3) (e.g. K-D-Q-N-A-T-K (SEQ ID NO: 4)) consensus sequence may be substituted for amino acid residue R274 or R279 of SEQ ID NO: 1 or an equivalent position in an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1.
  • a D/E-X-N-Z-S/T (SEQ ID NO: 2) or K-D/E-X-N-Z-S/T-K (SEQ ID NO: 3) (e.g. K-D-Q-N-A-T-K (SEQ ID NO: 4)) consensus sequence may be added next to or substituted for one or more amino acids residues between amino acids 271-277 of SEQ ID NO: 1 or an equivalent position in an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1.
  • a D/E-X-N-Z-S/T (SEQ ID NO: 2) or K-D/E-X-N-Z-S/T-K (SEQ ID NO: 3) (e.g. K-D-Q-N-A-T-K (SEQ ID NO: 4)) consensus sequence may be substituted for amino acid residue R274 of SEQ ID NO: 1 or an equivalent position in an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1.
  • a consensus sequence selected from D/E-X-N-Z-S/T (SEQ ID NO: 2) and K-D/E-X-N-Z-S/T-K (SEQ ID NO: 3) (e.g. K-D-Q-N-A-T-K (SEQ ID NO: 4)) may be added next to or substituted for one or more amino acids residue(s) between amino acids 308-328 of SEQ ID NO: 1 or an equivalent position in an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1.
  • a D/E-X-N-Z-S/T (SEQ ID NO: 2) or K-D/E-X-N-Z-S/T-K (SEQ ID NO: 3) (e.g. K-D-Q-N-A-T-K (SEQ ID NO: 4)) consensus sequence may be substituted for amino acid residue S318 or G323 of SEQ ID NO: 1 or an equivalent position in an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1.
  • a D/E-X-N-Z-S/T (SEQ ID NO: 2) or K-D/E-X-N-Z-S/T-K (SEQ ID NO: 3) (e.g. K-D-Q-N-A-T-K (SEQ ID NO: 4)) consensus sequence may be added next to or substituted for one or more amino acids residues between amino acids 313-323 of SEQ ID NO: 1 or an equivalent position in an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1.
  • a D/E-X-N-Z-S/T (SEQ ID NO: 2) or K-D/E-X-N-Z-S/T-K (SEQ ID NO: 3) (e.g. K-D-Q-N-A-T-K (SEQ ID NO: 4)) consensus sequence may be substituted for amino acid residue S318 of SEQ ID NO: 1 or an equivalent position in an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1.
  • a consensus sequence selected from D/E-X-N-Z-S/T (SEQ ID NO: 2) and K-D/E-X-N-Z-S/T-K (SEQ ID NO: 3) (e.g. K-D-Q-N-A-T-K (SEQ ID NO: 4)) may be added next to or substituted for one or more amino acids residue(s) between amino acids 509-529 of SEQ ID NO: 1 or an equivalent position in an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1.
  • a D/E-X-N-Z-S/T (SEQ ID NO: 2) or K-D/E-X-N-Z-S/T-K (SEQ ID NO: 3) (e.g. K-D-Q-N-A-T-K (SEQ ID NO: 4)) consensus sequence may be substituted for amino acid residue A519 or G525 of SEQ ID NO: 1 or an equivalent position in an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1.
  • a D/E-X-N-Z-S/T (SEQ ID NO: 2) or K-D/E-X-N-Z-S/T-K (SEQ ID NO: 3) (e.g. K-D-Q-N-A-T-K (SEQ ID NO: 4)) consensus sequence may be added next to or substituted for one or more amino acids residues between amino acids 516-522 of SEQ ID NO: 1 or an equivalent position in an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1.
  • a D/E-X-N-Z-S/T (SEQ ID NO: 2) or K-D/E-X-N-Z-S/T-K (SEQ ID NO: 3) (e.g. K-D-Q-N-A-T-K (SEQ ID NO: 4)) consensus sequence may be substituted for amino acid residue A519 of SEQ ID NO: 1 or an equivalent position in an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1.
  • a consensus sequence selected from D/E-X-N-Z-S/T (SEQ ID NO: 2) and K-D/E-X-N-Z-S/T-K (SEQ ID NO: 3) (e.g. K-D-Q-N-A-T-K (SEQ ID NO: 4)) may be added next to or substituted for one or more amino acids residue(s) between amino acids 230-250 of SEQ ID NO: 1 or an equivalent position in an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1.
  • a D/E-X-N-Z-S/T (SEQ ID NO: 2) or K-D/E-X-N-Z-S/T-K (SEQ ID NO: 3) (e.g. K-D-Q-N-A-T-K (SEQ ID NO: 4)) consensus sequence may be added next to or substituted for one or more amino acids residues between amino acids 237-243 of SEQ ID NO: 1 or an equivalent position in an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1.
  • a D/E-X-N-Z-S/T (SEQ ID NO: 2) or K-D/E-X-N-Z-S/T-K (SEQ ID NO: 3) (e.g. K-D-Q-N-A-T-K (SEQ ID NO: 4)) consensus sequence may be substituted for amino acid residue K240 of SEQ ID NO: 1 or an equivalent position in an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1.
  • a consensus sequence selected from D/E-X-N-Z-S/T (SEQ ID NO: 2), K-D/E-X-N-Z-S/T-K (SEQ ID NO: 3) (e.g. K-D-Q-N-A-T-K (SEQ ID NO: 4)) or an extended consensus sequence (e.g.
  • J-D/E-X-N-Z-S/T-U may be added next to or substituted for one or more amino acids residue(s) within the N-terminal 10 amino acids of SEQ ID NO: 1 or an equivalent position in an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1. More particularly, a consensus sequence selected from D/E-X-N-Z-S/T (SEQ ID NO: 2), K-D/E-X-N-Z-S/T-K (SEQ ID NO: 3) (e.g.
  • K-D-Q-N-A-T-K (SEQ ID NO: 4)) or an extended consensus sequence (e.g. J-D/E-X-N-Z-S/T-U (SEQ ID NO: 5)) may be added next to or substituted for one or more amino acids residue(s) within the N-terminal 5 amino acids of SEQ ID NO: 1 or an equivalent position in an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1.
  • a consensus sequence selected from D/E-X-N-Z-S/T (SEQ ID NO: 2), K-D/E-X-N-Z-S/T-K (SEQ ID NO: 3) (e.g. K-D-Q-N-A-T-K (SEQ ID NO: 4)) or an extended consensus sequence (e.g. J-D/E-X-N-Z-S/T-U (SEQ ID NO: 5))
  • SEQ ID NO: 5 e.g. J-D/E-X-N-Z-S/T-U
  • a consensus sequence selected from D/E-X-N-Z-S/T (SEQ ID NO: 2), K-D/E-X-N-Z-S/T-K (SEQ ID NO: 3) (e.g. K-D-Q-N-A-T-K (SEQ ID NO: 4)) or an extended consensus sequence (e.g.
  • J-D/E-X-N-Z-S/T-U may be added next to or substituted for one or more amino acids residue(s) within the C-terminal 10 amino acids of SEQ ID NO: 1 or an equivalent position in an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1. More particularly, a consensus sequence selected from D/E-X-N-Z-S/T (SEQ ID NO: 2), K-D/E-X-N-Z-S/T-K (SEQ ID NO: 3) (e.g.
  • K-D-Q-N-A-T-K (SEQ ID NO: 4)) or an extended consensus sequence (e.g. J-D/E-X-N-Z-S/T-U (SEQ ID NO: 5)) may be added next to or substituted for one or more amino acids residue(s) within the C-terminal 5 amino acids of SEQ ID NO: 1 or an equivalent position in an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1.
  • a consensus sequence selected from D/E-X-N-Z-S/T (SEQ ID NO: 2), K-D/E-X-N-Z-S/T-K (SEQ ID NO: 3) (e.g. K-D-Q-N-A-T-K (SEQ ID NO: 4)) or an extended consensus sequence (e.g. J-D/E-X-N-Z-S/T-U (SEQ ID NO: 5))
  • SEQ ID NO: 5 e.g. J-D/E-X-N-Z-S/T-U
  • the consensus sequence(s) selected from: D/E-X-N-Z-S/T (SEQ ID NO: 2) and K-D/E-X-N-Z-S/T-K (SEQ ID NO: 3), may each be independently substituted for one or more amino acids (e.g. each consensus sequence is substituted for a single amino acid residue, such as a single amino acid residue selected from Y208, D218, R274, R279, S318,
  • each consensus sequence is substituted for a single amino acid residue, such as a single amino acid residue selected from Y208, R274, S318 and A519) of the amino acid sequence of SEQ ID NO: 1 or an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1.
  • two or more consensus sequence(s) selected from: D/E-X-N-Z-S/T (SEQ ID NO: 2) and K-D/E-X-N-Z-S/T-K (SEQ ID NO: 3) may each be independently substituted for one or more amino acids (e.g.
  • each consensus sequence is substituted for a single amino acid residue, such as a single amino acid residue selected from Y208, D218, R274, R279, S318, G323, A519, G525 and K240; e.g. each consensus sequence is substituted for a single amino acid residue, such as a single amino acid residue selected from Y208, R274, S318, A519 and K240) of the amino acid sequence of SEQ ID NO: 1 or an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1.
  • three or more consensus sequence(s) selected from: D/E-X-N-Z-S/T (SEQ ID NO: 2) and K-D/E-X-N-Z-S/T-K (SEQ ID NO: 3) may each be independently substituted for one or more amino acids (e.g. each consensus sequence is substituted for a single amino acid residue, such as a single amino acid residue selected from Y208, D218, R274, R279, S318, G323, A519, G525 and K240; e.g.
  • each consensus sequence is substituted for a single amino acid residue, such as a single amino acid residue selected from Y208, R274, S318, A519 and K240) of the amino acid sequence of SEQ ID NO: 1 or an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1.
  • four or more consensus sequence(s) selected from: D/E-X-N-Z-S/T (SEQ ID NO: 2) and K-D/E-X-N-Z-S/T-K (SEQ ID NO: 3) may each be independently substituted for one or more amino acids (e.g.
  • five or more consensus sequence(s) selected from: D/E-X-N-Z-S/T (SEQ ID NO: 2) and K-D/E-X-N-Z-S/T-K (SEQ ID NO: 3) may each be independently substituted for one or more amino acids (e.g. each consensus sequence is substituted for a single amino acid residue, such as a single amino acid residue selected from Y208, D218, R274, R279, S318, G323, A519, G525 and K240; e.g.
  • each consensus sequence is substituted for a single amino acid residue, such as a single amino acid residue selected from Y208, R274, S318, A519 and K240) of the amino acid sequence of SEQ ID NO: 1 or an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1.
  • a consensus sequence selected from D/E-X-N-Z-S/T (SEQ ID NO: 2), K-D/E-X-N-Z-S/T-K (SEQ ID NO: 3) (e.g. K-D-Q-N-A-T-K (SEQ ID NO: 4)) or an extended consensus sequence J-D/E-X-N-Z-S/T-U (SEQ ID NO: 5) (e.g.
  • G-S-G-G-G-D/E-X-N-Z-S/T-G-S-G-G (SEQ ID NO: 25)) may be added next to or substituted for one or more amino acids residue(s) at the N-terminus of SEQ ID NO: 1 or an equivalent position in an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1.
  • the modified EPA protein of the invention may comprise a further consensus sequence selected from: D/E-X-N-Z-S/T (SEQ ID NO: 2) and J-D/E-X-N-Z-S/T-U (SEQ ID NO: 5), wherein X and Z are independently any amino acid except proline and J and U are independently 1 to 5 naturally occurring amino acid residues, added next to, or substituted for, one or more amino acids, at the N-terminus of SEQ ID NO: 1 or at an equivalent position within an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1.
  • the modified EPA protein of the invention may comprise a further consensus sequence selected from: D/E-X-N-Z-S/T (SEQ ID NO: 2) and J-D/E-X-N-Z-S/T-U (SEQ ID NO: 5), wherein X and Z are independently any amino acid except proline and J and U are independently 1 to 5 naturally occurring amino acid residues, added next to the N-terminal amino acid of SEQ ID NO: 1 or at an equivalent position within an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1.
  • a consensus sequence selected from D/E-X-N-Z-S/T (SEQ ID NO: 2), K-D/E-X-N-Z-S/T-K (SEQ ID NO: 3) (e.g. K-D-Q-N-A-T-K (SEQ ID NO: 4)) or an extended consensus sequence J-D/E-X-N-Z-S/T-U (SEQ ID NO: 5) (e.g.
  • G-S-G-G-G-D/E-X-N-Z-S/T-G-S-G-G (SEQ ID NO: 25)) may be added next to or substituted for one or more amino acids residue(s) at the C-terminus of SEQ ID NO: 1 or an equivalent position in an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1.
  • the modified EPA protein of the invention may comprise a further consensus sequence selected from: D/E-X-N-Z-S/T (SEQ ID NO: 2) and J-D/E-X-N-Z-S/T-U (SEQ ID NO: 5), wherein X and Z are independently any amino acid except proline and J and U are independently 1 to 5 naturally occurring amino acid residues, added next to, or substituted for, one or more amino acids, at the C-terminus of SEQ ID NO: 1 or at an equivalent position within an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1.
  • the modified EPA protein of the invention may comprise a further consensus sequence selected from: D/E-X-N-Z-S/T (SEQ ID NO: 2) and J-D/E-X-N-Z-S/T-U (SEQ ID NO: 5), wherein X and Z are independently any amino acid except proline and J and U are independently 1 to 5 naturally occurring amino acid residues, added next to the C-terminal amino acid of SEQ ID NO: 1 or at an equivalent position within an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1.
  • three or more consensus sequence(s) selected from: D/E-X-N-Z-S/T (SEQ ID NO: 2) and K-D/E-X-N-Z-S/T-K (SEQ ID NO: 3) may each be independently substituted for one or more amino acids (e.g. each consensus sequence is substituted for a single amino acid residue, such as a single amino acid residue selected from Y208, R274, S318, A519 and K240) and a consensus sequence selected from D/E-X-N-Z-S/T (SEQ ID NO: 2) and K-D/E-X-N-Z-S/T-K (SEQ ID NO: 3) (e.g.
  • K-D-Q-N-A-T-K (SEQ ID NO: 4)) may be added next to or substituted for one or more amino acids residue(s) at the N-terminus (e.g. added next to the N-terminal amino acid) and a consensus sequence selected from D/E-X-N-Z-S/T (SEQ ID NO: 2) and K-D/E-X-N-Z-S/T-K (SEQ ID NO: 3) (e.g. K-D-Q-N-A-T-K (SEQ ID NO: 4)) may be added next to or substituted for one or more amino acids residue(s) C-terminus (e.g. added next to the C-terminal amino acid) of SEQ ID NO: 1 or an equivalent position in an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1.
  • each consensus sequence is substituted for a single amino acid residue, such as a single amino acid residue selected from Y208, R274, S318, A519 and K240
  • a consensus sequence selected from D/E-X-N-Z-S/T (SEQ ID NO: 2) and K-D/E-X-N-Z-S/T-K (SEQ ID NO: 3) e.g.
  • K-D-Q-N-A-T-K (SEQ ID NO: 4) may be added next to or substituted for one or more amino acids residue(s) at the N-terminus (e.g. added next to the N-terminal amino acid) and/or a consensus sequence selected from D/E-X-N-Z-S/T (SEQ ID NO: 2) and K-D/E-X-N-Z-S/T-K (SEQ ID NO: 3) (e.g. K-D-Q-N-A-T-K (SEQ ID NO: 4)) may be added next to or substituted for one or more amino acids residue(s) C-terminus (e.g. added next to the C-terminal amino acid) of SEQ ID NO: 1 or an equivalent position in an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1.
  • five or more consensus sequence(s) selected from: D/E-X-N-Z-S/T (SEQ ID NO: 2) and K-D/E-X-N-Z-S/T-K (SEQ ID NO: 3) may be substituted for one or more amino acids (e.g. each consensus sequence is substituted for a single amino acid residue, such as a single amino acid residue selected from Y208, R274, S318, A519 and K240) and a consensus sequence selected from D/E-X-N-Z-S/T (SEQ ID NO: 2) and K-D/E-X-N-Z-S/T-K (SEQ ID NO: 3) (e.g.
  • K-D-Q-N-A-T-K (SEQ ID NO: 4) may be added next to or substituted for one or more amino acids residue(s) at the N-terminus (e.g. added next to the N-terminal amino acid) and/or a consensus sequence selected from D/E-X-N-Z-S/T (SEQ ID NO: 2) and K-D/E-X-N-Z-S/T-K (SEQ ID NO: 3) (e.g. K-D-Q-N-A-T-K (SEQ ID NO: 4)) may be added next to or substituted for one or more amino acids residue(s) C-terminus (e.g. added next to the C-terminal amino acid) of SEQ ID NO: 1 or an equivalent position in an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1.
  • the modified EPA protein of the invention may comprise at least one consensus sequence selected from: D/E-X-N-Z-S/T (SEQ ID NO: 2) and K-D/E-X-N-Z-S/T-K (SEQ ID NO: 3), wherein X and Z are independently any amino acid except proline, has been added next to, or substituted for: (i) one or more amino acids between amino acid residues 198-218 (e.g. one or more amino acids between amino acid residues 203-213, e.g. amino acid residue Y208), (ii) one or more amino acids between amino acid residues 308-328 (e.g. one or more amino acids between amino acid residues 313-323, e.g.
  • amino acid residue S318) amino acid residue S318), or (iii) one or more amino acids between amino acid residues 509-529 (e.g. one or more amino acids between amino acid residues 514-524; e.g. amino acid residue A519) of SEQ ID NO: 1 or at equivalent position(s) within an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1.
  • the modified EPA protein of the invention may contain a consensus sequence selected from: D/E-X-N-Z-S/T (SEQ ID NO: 2) and K-D/E-X-N-Z-S/T-K (SEQ ID NO: 3), which has been added next to, or substituted for one or more amino acids between amino acid residues 198-218 (e.g. one or more amino acids between amino acid residues 203-213, e.g. amino acid residue Y208) of SEQ ID NO: 1 or at an equivalent position within an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1.
  • the modified EPA protein of the invention may contain a consensus sequence selected from: D/E-X-N-Z-S/T (SEQ ID NO: 2) and K-D/E-X-N-Z-S/T-K (SEQ ID NO: 3), which has been added next to, or substituted for one or more amino acids between amino acid residues 308-328 (e.g. one or more amino acids between amino acid residues 313-323, e.g. amino acid residue S318) of SEQ ID NO: 1 or at an equivalent position within an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1.
  • SEQ ID NO: 2 D/E-X-N-Z-S/T
  • SEQ ID NO: 3 K-D/E-X-N-Z-S/T-K
  • the modified EPA protein of the invention may contain a consensus sequence selected from: D/E-X-N-Z-S/T (SEQ ID NO: 2) and K-D/E-X-N-Z-S/T-K (SEQ ID NO: 3), which has been added next to, or substituted for one or more amino acids between amino acid residues 509-529 (e.g. one or more amino acids between amino acid residues 514-524; e.g. amino acid residue A519) of SEQ ID NO: 1 or at an equivalent position within an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1.
  • SEQ ID NO: 2 D/E-X-N-Z-S/T
  • SEQ ID NO: 3 K-D/E-X-N-Z-S/T-K
  • the modified EPA protein of the invention may contain two consensus sequences.
  • the modified EPA protein may have an amino acid sequence of SEQ ID NO: 1 or an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1 modified in that the amino acid sequence comprises two consensus sequences, e.g. wherein two consensus sequences are added next to or substituted for two amino acid residues of SEQ ID NO: 1 or an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1.
  • modified EPA protein of the invention may contain two consensus sequences, optionally substituted for amino acid residues selected from: (i) Y208 and R274, (ii) Y208 and S318, (iii) Y208 and A519, (iv) R274 and S318, (v) R274 and A519, or (vi) S318 and A519 of SEQ ID NO: 1 or an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1.
  • the modified EPA protein of the invention may contain two consensus sequences substituted for amino acid residues Y208 and R274 of SEQ ID NO: 1 or an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1.
  • the modified EPA protein of the invention may comprise (or consist of) an amino acid sequence which is at least 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 6.
  • the modified EPA protein of the invention may contain two consensus sequences substituted for amino acid residues Y208 and S318 of SEQ ID NO: 1 or an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1.
  • the modified EPA protein of the invention may comprise (or consist of) an amino acid sequence which is at least 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 28.
  • the modified EPA protein of the invention may contain two consensus sequences substituted for amino acid residues Y208 and A519 of SEQ ID NO: 1 or an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1.
  • the modified EPA protein of the invention may comprise (or consist of) an amino acid sequence which is at least 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 29.
  • the modified EPA protein of the invention may contain two consensus sequences substituted for amino acid residues R274 and S318 of SEQ ID NO: 1 or an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1.
  • the modified EPA protein of the invention may comprise (or consist of) an amino acid sequence which is at least 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 30.
  • the modified EPA protein of the invention may contain two consensus sequences substituted for amino acid residues R274 and A519 of SEQ ID NO: 1 or an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1.
  • the modified EPA protein of the invention may comprise (or consist of) an amino acid sequence which is at least 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 31.
  • the modified EPA protein of the invention may contain two consensus sequences substituted for amino acid residues S318 and A519 of SEQ ID NO: 1 or an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1.
  • the modified EPA protein of the invention may comprise (or consist of) an amino acid sequence which is at least 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 7.
  • the modified EPA protein of the invention may contain three consensus sequences.
  • the modified EPA protein may have an amino acid sequence of SEQ ID NO: 1 or an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1 modified in that the amino acid sequence comprises three consensus sequences, e.g. wherein three consensus sequences are added next to or substituted for three independently selected amino acid residues of SEQ ID NO: 1 or an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1.
  • the modified EPA protein of the invention may contain three consensus sequences, optionally substituted for amino acid residues Y208, R274 and A519 of SEQ ID NO: 1 or an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1.
  • the modified EPA protein of the invention may comprise (or consist of) an amino acid sequence which is at least 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 7.
  • the modified EPA protein of the invention may contain four consensus sequences.
  • the modified EPA protein may have an amino acid sequence of SEQ ID NO: 1 or an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1 modified in that the amino acid sequence comprises four consensus sequences, e.g. wherein four consensus sequences are added next to or substituted for four independently selected amino acid residues of SEQ ID NO: 1 or an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1.
  • the modified EPA protein of the invention may contain four consensus sequences, optionally substituted for amino acid residues Y208, R274, A519 and added next to the N-terminal amino acid of SEQ ID NO: 1 or an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1.
  • the modified EPA protein of the invention may comprise (or consist of) an amino acid sequence which is at least 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 8.
  • the modified EPA protein of the invention may contain five consensus sequences.
  • the modified EPA protein may have an amino acid sequence of SEQ ID NO: 1 or an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1 modified in that the amino acid sequence comprises five consensus sequences, e.g. wherein five consensus sequences are added next to or substituted for five independently selected amino acid residues of SEQ ID NO: 1 or an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1.
  • modified EPA protein of the invention may contain five consensus sequences, optionally selected from: substitution of amino acid residue Y208, substitution of amino acid residue R274, substitution of amino acid residue S318, substitution of amino acid residue A519, addition at the N-terminus (i.e. added at the N-terminus) and addition at the C-terminus (i.e. added at the C-terminus) of SEQ ID NO: 1 or an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1.
  • a modified EPA protein may comprise (or consist of) (i) an amino acid sequence which is at least 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 9, (ii) an amino acid sequence which is at least 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 10, or (iii) an amino acid sequence which is at least 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 11.
  • the modified EPA protein of the invention may contain six consensus sequences.
  • the modified EPA protein may have an amino acid sequence of SEQ ID NO: 1 or an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1 modified in that the amino acid sequence comprises six consensus sequences, e.g. wherein six consensus sequences are added next to or substituted for six independently selected amino acid residues of SEQ ID NO: 1 or an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1.
  • modified EPA protein of the invention may contain six consensus sequences, optionally selected from: substitution of amino acid residue Y208, substitution of amino acid residue K240, substitution of amino acid residue R274, substitution of amino acid residue S318, substitution of amino acid residue A519, addition at the N-terminus (i.e. added at the N-terminus) and addition at the C-terminus (i.e. added at the C-terminus) of SEQ ID NO: 1 or an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1.
  • a modified EPA protein of the invention may comprise (or consist of) (i) an amino acid sequence which is at least 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 12, or (ii) an amino acid sequence which is at least 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 13.
  • the modified EPA protein of the invention may contain seven consensus sequences.
  • the modified EPA protein may have an amino acid sequence of SEQ ID NO: 1 or an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1 modified in that the amino acid sequence comprises seven consensus sequences, e.g. wherein seven consensus sequences are added next to or substituted for seven independently selected amino acid residues of SEQ ID NO: 1 or an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1.
  • the modified EPA protein of the invention may contain seven consensus sequences, optionally substitution of amino acid residues Y208, K240, R274, S318, A519, addition at the N-terminus (i.e. added at the N-terminus) and addition at the C-terminus (i.e. added at the C-terminus) of SEQ ID NO: 1 or an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1.
  • a modified EPA protein of the invention may comprise (or consist of) an amino acid sequence which is at least 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 14.
  • K-D-Q-N-A-T-K (SEQ ID NO: 4)) has been added next to or substituted for one or more amino acids between amino acid residues 198-218”, the consensus sequence may have been added next to or substituted for any one (or more) of amino acid numbers 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218 in SEQ ID NO: 1.
  • the EPA amino acid sequence is a variant and/or fragment of an amino acid sequence of SEQ ID NO: 1, such as an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1, the reference to “between amino acids . . .
  • sequence alignment tools are not limited to Clustal Omega (www(.)ebi(.)ac(.)ac(.)uk) MUSCLE (www(.)ebi(.)ac(.)uk), or T-coffee (www(.)tcoffee(.)org).
  • the sequence alignment tool used is Clustal Omega (www(.)ebi(.)ac(.)ac(.)uk).
  • amino acid numbers referred to herein correspond to the amino acids in SEQ ID NO: 1 and as described above, a person skilled in the art can determine equivalent amino acid positions in an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1 by alignment.
  • the addition or deletion of amino acids from the variant and/or fragment of SEQ ID NO:1 could lead to a difference in the actual amino acid position of the consensus sequence in the mutated sequence, however, by lining the mutated sequence up with the reference sequence, the amino acid in in an equivalent position to the corresponding amino acid in the reference sequence can be identified and hence the appropriate position for addition or substitution of the consensus sequence can be established.
  • the modified EPA protein of the invention may be an isolated modified EPA protein.
  • the modified EPA protein of the invention may be a recombinant modified EPA protein.
  • the modified EPA protein of the invention may be an isolated recombinant modified EPA protein.
  • the modified EPA protein of the invention comprises a D/E-X-N-Z-S/T (SEQ ID NO: 2), K-D/E-X-N-Z-S/T-K (SEQ ID NO: 3) or J-D/E-X-N-Z-S/T-U (SEQ ID NO: 5) consensus sequence, wherein X and Z are independently any amino acid except proline and J and U are independently 1 to 5 naturally occurring amino acid residues.
  • the classical 5 amino acid glycosylation consensus sequence (D/E-X-N-Z-S/T (SEQ ID NO: 2)) may be extended by 1-5 other amino acid residues either side of the consensus sequence for more efficient glycosylation J-D/E-X-N-Z-S/T-U (SEQ ID NO: 5) (e.g. G-S-G-G-G-D/E-X-N-Z-S/T-G-S-G-G (SEQ ID NO: 25)).
  • the classical 5 amino acid glycosylation consensus sequence (D/E-X-N-Z-S/T (SEQ ID NO: 2)) may be extended by lysine residues for more efficient glycosylation (e.g.
  • consensus sequences in the modified EPA protein of the invention may comprises (or consist) of a D/E-X-N-Z-S/T (SEQ ID NO: 2) consensus sequence.
  • the consensus sequence(s) may be selected from: D/E-X-N-Z-S/T (SEQ ID NO: 2), K-D/E-X-N-Z-S/T-K (SEQ ID NO: 3) or J-D/E-X-N-Z-S/T-U (SEQ ID NO: 5) wherein X is Q (glutamine) and Z is A (alanine).
  • the consensus sequence(s) may be selected from: D/E-X-N-Z-S/T (SEQ ID NO: 2) and K-D/E-X-N-Z-S/T-K (SEQ ID NO: 3), wherein X is Q (glutamine) and Z is A (alanine).
  • the consensus sequence is D/E-X-N-Z-S/T (SEQ ID NO: 2), wherein X is Q (glutamine) and Z is A (alanine), e.g. D-Q-N-A-T (SEQ ID NO: 25) also referred to as “DQNAT”.
  • the consensus sequence is K-D/E-X-N-Z-S/T-K (SEQ ID NO: 3), wherein X is Q (glutamine) and Z is A (alanine), e.g. K-D-Q-N-A-T-K (SEQ ID NO: 4) also referred to as “KDQNATK”.
  • the consensus sequence(s) may be selected from: D/E-X-N-Z-S/T (SEQ ID NO: 2), K-D/E-X-N-Z-S/T-K (SEQ ID NO: 3) or J-D/E-X-N-Z-S/T-U (SEQ ID NO: 5) wherein X is Q (glutamine), Z is A (alanine), J and U are independently 1 to 5 amino acid residues independently selected from glycine and/or serine.
  • the modified EPA protein of the invention comprises at least two D/E-X-N-Z-S/T (SEQ ID NO: 2) or K-D/E-X-N-Z-S/T-K (SEQ ID NO: 3) consensus sequences. In an embodiment, the modified EPA protein of the invention comprises at least three D/E-X-N-Z-S/T (SEQ ID NO: 2) or K-D/E-X-N-Z-S/T-K (SEQ ID NO: 3) consensus sequences.
  • the modified EPA protein of the invention comprises at least four D/E-X-N-Z-S/T (SEQ ID NO: 2) or K-D/E-X-N-Z-S/T-K (SEQ ID NO: 3) consensus sequences. In an embodiment, the modified EPA protein of the invention comprises at least five D/E-X-N-Z-S/T (SEQ ID NO: 2) or K-D/E-X-N-Z-S/T-K (SEQ ID NO: 3) consensus sequences.
  • the modified EPA protein of the invention comprises at least six D/E-X-N-Z-S/T (SEQ ID NO: 2) or K-D/E-X-N-Z-S/T-K (SEQ ID NO: 3) consensus sequences. In an embodiment, the modified EPA protein of the invention comprises at least seven D/E-X-N-Z-S/T (SEQ ID NO: 2) or K-D/E-X-N-Z-S/T-K (SEQ ID NO: 3) consensus sequences.
  • the modified EPA protein of the invention contains three to seven D/E-X-N-X-S/T (SEQ ID NO: 2) or K-D/E-X-N-Z-S/T-K (SEQ ID NO: 3) consensus sequences. In an embodiment, the modified EPA protein of the invention contains four to seven D/E-X-N-X-S/T (SEQ ID NO: 2) or K-D/E-X-N-Z-S/T-K (SEQ ID NO: 3) consensus sequences.
  • the modified EPA protein of the invention contains five to seven D/E-X-N-X-S/T (SEQ ID NO: 2) or K-D/E-X-N-Z-S/T-K (SEQ ID NO: 3) consensus sequences.
  • glycosylation sites can be accomplished by, e.g. adding new amino acids to the primary structure of the protein (i.e. the glycosylation sites are added, in full or in part), or by mutating existing amino acids in the protein in order to generate the glycosylation sites (i.e. amino acids are not added to the protein, but selected amino acids of the protein are mutated so as to form glycosylation sites).
  • the consensus sequence(s) are recombinantly introduced into the EPA amino acid sequence of SEQ ID NO: 1 or a EPA amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1.
  • the modified EPA protein of the invention may further comprise a “peptide tag” or “tag”, i.e. a sequence of amino acids that allows for the isolation and/or identification of the modified EPA protein.
  • a tag i.e. a sequence of amino acids that allows for the isolation and/or identification of the modified EPA protein.
  • adding a tag to a modified EPA protein of the invention can be useful in the purification of that protein and, hence, the purification of conjugate (e.g. bioconjugate) vaccines comprising the tagged modified EPA protein.
  • Exemplary tags that can be used herein include, without limitation, histidine (HIS) tags (e.g. hexa histidine-tag, or 6XHis-Tag), FLAG-TAG, and HA tags.
  • the tag is a hexa-histidine tag.
  • the modified EPA protein of the invention may further comprise a peptide tag.
  • the peptide tag is located at the C-terminus of the amino acid sequence.
  • the peptide tag comprises six histidine residues at the C-terminus of the amino acid sequence.
  • the modified EPA protein of the invention comprises (or consists of) an amino acid sequence which is at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or 100% identical to any one of the sequences of SEQ ID NOs: 6 to 14 and a peptide tag (e.g. six histidine residues at the C-terminus of the amino acid sequence).
  • a peptide tag e.g. six histidine residues at the C-terminus of the amino acid sequence.
  • the modified EPA protein of the invention comprises a signal sequence which is capable of directing the EPA protein to the periplasm of a host cell (e.g. bacterium).
  • Signal sequences including periplasmic signal sequences, are usually removed during translocation of the protein into, for example, the periplasm by signal peptidases (i.e. a mature protein is a protein from which at least the signal sequence has been removed).
  • the signal sequence may be from E. coli flagellin (FlgI) [MIKFLSALILLLVTTAAQA (SEQ ID NO: 15)], E. coli outer membrane porin A (OmpA) [MKKTAIAIAVALAGFATVAQA (SEQ ID NO: 16)], E.
  • E. coli maltose binding protein [MKIKTGARILALSALTTMMFSASALA (SEQ ID NO: 17)], Erwin carotovorans pectate lyase (PelB) [MKYLLPTAAAGLLLLAAQPAMA (SEQ ID NO: 18)], heat labile E. coli enterotoxin LTIIb [MSFKKIIKAFVIMAALVSVQAHA (SEQ ID NO: 19)], Bacillus subtilis endoxylanase XynA [MFKFKKKFLVGLTAAFMSISMFSATASA (SEQ ID NO: 20)], E.
  • the signal sequence is from E. coli DsbA [MKKIWLALAGLVLAFSASA (SEQ ID NO: 21)].
  • the present invention provides a modified EPA protein, wherein the amino acid sequence further comprises a signal sequence which is capable of directing the EPA protein to the periplasm of a host cell (e.g. bacterium), optionally said signal sequence being DsbA (SEQ ID NO: 21).
  • a signal sequence of the protein DsbA from E. coli can be genetically fused to the N-terminus of the mature EPA sequence.
  • a plasmid derived from pEC415 [Schulz, H., Hennecke, H., and Thony-Meyer, L., Science, 281, 1197-1200, 1998] containing the DsbA signal peptide code followed by a RNase sequence can be digested (NdeI to EcoRI) to keep the DsbA signal and remove the RNase insert.
  • EPA is then amplified using PCR (forward oligo 5′-AAGCTAGCGCCGCCGAGGAAGCCTTCGACC (SEQ. ID NO. 32) and reverse oligo 5′-AAGAA TTCTCAGTGGTGGTGGTGGTGGTGCTTCAGGTCCTCGCGCGGCGG (SEQ. ID NO.
  • pGVXN69 encodes a protein product with an DsbA signal peptide, the mature EPA sequence and a hexa-histag.
  • a further aspect of the invention is a polynucleotide encoding a modified EPA protein of the invention.
  • a polynucleotide encoding a modified EPA protein having a nucleotide sequence that encodes a polypeptide with an amino acid sequence that is at least 97%, 98%, 99% or 100% identical to any one of SEQ ID NOs: 6 to 14.
  • nucleotide sequence for example, a nucleotide sequence according to SEQ ID NO: 43 or a nucleotide sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 43.
  • the nucleotide sequence comprises nucleotides encoding for amino acids corresponding to one (or more) consensus sequence(s) selected from: D/E-X-N-Z-S/T (SEQ ID NO: 2) and K-D/E-X-N-Z-S/T-K (SEQ ID NO: 3).
  • a modified EPA protein having a consensus sequence substituted at one or more of positions Y208, R274, S318 and/or A519 in an amino acid sequence of SEQ ID NO: 1 or at an equivalent position(s) within an amino acid sequence at least 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1.
  • a vector comprising such a polynucleotide is a further aspect of the invention.
  • the present invention also provides a conjugate (e.g. bioconjugate) comprising (or consisting of) a modified EPA protein of the invention linked to an antigen (e.g. a saccharide antigen, optionally a bacterial polysaccharide antigen).
  • an antigen e.g. a saccharide antigen, optionally a bacterial polysaccharide antigen.
  • the antigen may be a bacterial polysaccharide antigen, or a yeast polysaccharide antigen, or a mammalian polysaccharide antigen.
  • the conjugate comprises a conjugate (e.g. bioconjugate) comprising (or consisting of) a modified EPA protein of the invention covalently linked to an antigen (e.g. a saccharide antigen, optionally a bacterial polysaccharide antigen), wherein the antigen is linked (either directly or through a linker).
  • an antigen e.g. a saccharide antigen, optionally a bacterial polysaccharide antigen
  • the antigen is directly linked to the modified EPA protein of the invention.
  • the antigen is directly linked to an amino acid residue of the modified EPA protein.
  • the modified EPA protein is covalently linked to the antigen through a chemical linkage obtainable using a chemical conjugation method (i.e. the conjugate is produced by chemical conjugation).
  • the chemical conjugation method may be selected from the group consisting of carbodiimide chemistry, reductive animation, cyanylation chemistry (for example CDAP chemistry), maleimide chemistry, hydrazide chemistry, ester chemistry, and N-hydroysuccinimide chemistry.
  • Conjugates can be prepared by direct reductive amination methods as described in, US200710184072 (Hausdorff) U.S. Pat. No. 4,365,170 (Jennings) and U.S. Pat. No. 4,673,574 (Anderson).
  • conjugation method may alternatively rely on activation of the saccharide with 1-cyano-4-dimethylamino pyridinium tetrafluoroborate (CDAP) to form a cyanate ester.
  • CDAP 1-cyano-4-dimethylamino pyridinium tetrafluoroborate
  • Such conjugates are described in PCT published application WO 93/15760 Uniformed Services University and WO 95/08348 and WO 96/29094. See also Chu C. et al. Infect. Immunity, 1983 245 256.
  • Carboxyl for instance via aspartic acid or glutamic acid.
  • this group is linked to amino groups on saccharides directly or to an amino group on a linker with carbodiimide chemistry e.g. with EDAC.
  • Amino group (for instance via lysine).
  • this group is linked to carboxyl groups on saccharides directly or to a carboxyl group on a linker with carbodiimide chemistry e.g. with EDAC.
  • this group is linked to hydroxyl groups activated with CDAP or CNBr on saccharides directly or to such groups on a linker; to saccharides or linkers having an aldehyde group; to saccharides or linkers having a succinimide ester group.
  • Sulphydryl for instance via cysteine.
  • this group is linked to a bromo or chloro acetylated saccharide or linker with maleimide chemistry.
  • this group is activated/modified with bis diazobenzidine.
  • Imidazolyl group (for instance via histidine). In one embodiment this group is activated/modified with bis diazobenzidine.
  • Aldehyde groups can be generated after different treatments such as: periodate, acid hydrolysis, hydrogen peroxide, etc.
  • Conjugates can be purified by any method known in the art for purification of a protein, for example, by chromatography (e.g. ion exchange, anionic exchange, affinity, and sizing column chromatography), centrifugation, differential solubility, or by any other standard technique for the purification of proteins. See, e.g., Saraswat et al. , 2013, Biomed. Res. Int. ID0312709 (p. 1-18); see also the methods described in WO 2009/104074.
  • the actual conditions used to purify a particular conjugate will depend, in past, on the synthesis strategy (e.g., synthetic production vs. recombinant production) and on factors such as net charge, hydrophobicity, and/or hydrophilicity of the bioconjugate.
  • the amino acid residue on the modified EPA protein to which the antigen is linked is selected from the group consisting of: Ala, Arg, Asp, Cys, Gly, Glu, Gln, His, Ile, Leu, Lys, Met, Phe, Pro, Ser, Thr, Trp, Tyr, and Val.
  • the amino acid is: an amino acid containing a terminal amine group, a lysine, an arginine, a glutaminic acid, an aspartic acid, a cysteine, a tyrosine, a histidine or a tryptophan.
  • the amino acid residue on the modified EPA protein to which the antigen is linked is not an asparagine residue and in this case, the conjugate is typically produced by chemical conjugation.
  • the antigen is linked to an amino acid on the modified EPA protein selected from asparagine, aspartic acid, glutamic acid, lysine, cysteine, tyrosine, histidine, arginine or tryptophan (e.g. asparagine) and in the case of asparagine, the conjugate may be a bioconjugate (for example an enzymatic conjugation using a oligosaccharyltransferase such as PglB).
  • the amino acid residue on the modified EPA protein to which the antigen is linked is an asparagine residue.
  • the amino acid residue on the modified EPA protein to which the antigen is linked is part of the consensus sequence, e.g. the asparagine in D/E-X-N-Z-S/T (SEQ ID NO: 2), K-D/E-X-N-Z-S/T-K (SEQ ID NO: 3) or J-D/E-X-N-Z-S/T-U (SEQ ID NO: 5) consensus sequence.
  • the conjugate of the invention may be a conjugate of a recombinant modified EPA protein (e.g. chemical conjugate or bioconjugate).
  • the conjugate of the invention may be a conjugate of an isolated recombinant modified EPA protein and a recombinant antigen, e.g. recombinant saccharide (i.e. bioconjugate).
  • the antigen may be a saccharide antigen, e.g. a bacterial polysaccharide, for example an O-antigen or a capsular polysaccharide, a yeast polysaccharide or a mammalian polysaccharide.
  • Polysaccharides comprise 2 or more monosaccharides, typically greater than 10 monosaccharides.
  • the antigen in a conjugate (e.g. bioconjugate) of the invention is a bacterial polysaccharide selected from a Shigella species, Pseudomonas species, Klebsiella species, Streptococcus species, or Staphylococcus species (e.g.
  • the antigen is a bacterial polysaccharide antigen (e.g.
  • an O-antigen from a Gram negative bacterium optionally from Shigella dysenteriae, Shigella flexneri, Shigella sonnei, Pseudomonas aeruginosa, Klebsiella pneumoniae, or a capsular polysaccharide from a Gram positive bacterium, optionally Streptococcus pneumoniae or Staphylococcus aureus ).
  • the antigen is an O-antigen from a Gram negative bacterium.
  • the antigen in a conjugate (e.g. bioconjugate) of the invention is a bacterial polysaccharide selected from from a Shigella species, Klebsiella species, or Streptococcus species (e.g.
  • the antigen in a conjugate (e.g. bioconjugate) of the invention is a bacterial polysaccharide selected from Shigella flexneri, Klebsiella pneumoniae and Streptococcus pneumoniae ).
  • the antigen is a bacterial polysaccharide from Klebsiella pneumoniae.
  • the present invention provides a conjugate (e.g.
  • bioconjugate comprising a modified EPA protein of the invention linked to an antigen wherein the antigen is a saccharide, optionally a bacterial polysaccharide (e.g. from Shigella dysenteriae, Shigella flexneri, Shigella sonnei, Pseudomonas aeruginosa, Klebsiella pneumoniae, Streptococcus pneumoniae or Staphylococcus aureus ).
  • the antigen is an O-antigen.
  • the antigen is a capsular polysaccharide.
  • the antigen is an O-antigen e.g. from a Gram-negative bacterium. In certain embodiments, the antigen is an O-antigen from Salmonella species, Shigella species, Pseudomonas species or Klebsiella species. In certain embodiments, the antigen is an O-antigen from Shigella species, Pseudomonas species or Klebsiella species (e.g. Shigella dysenteriae, Shigella flexneri, Shigella sonnei, Pseudomonas aeruginosa, or Klebsiella pneumoniae ).
  • Shigella dysenteriae Shigella flexneri
  • Shigella sonnei Shigella sonnei
  • Pseudomonas aeruginosa or Klebsiella pneumoniae
  • the antigen is an O-antigen from Shigella dysenteriae, Shigella flexneri or Shigella sonnei.
  • the antigen may be an O-antigen from S. dysenteriae type 1, S. sonnei, and S. flexneri type 6, and S. flexneri 2a and 3a 0 (Dmitriev, B.A., et al. Somatic Antigens of Shigella Eur J. Biochem, 1979. 98: p. 8; Liu et al Structure and genetics of Shigella O antigens FEMS Microbiology Review, 2008. 32: p. 27).
  • the antigen is an O-antigen from Pseudomonas aeruginosa.
  • the antigen may be an O-antigen from Pseudomonas aeruginosa serotypes 1-20 (Raymond et al., J Bacteriol. 2002 184(13):3614-22).
  • the antigen is an O-antigen from Klebsiella pneumoniae.
  • the antigen is a capsular polysaccharide from Neisseria meningitidis serogroup A (MenA), N. meningitidis serogroup C (MenC), N. meningitidis serogroup Y (MenY), N. meningitidis serogroup W (MenW), H. influenzae type b (Hib), Group B Streptococcus (GBS), Streptococcus pneumoniae, or Staphylococcus aureus.
  • the antigen is a capsular polysaccharide from Streptococcus species or Staphylococcus species. (e.g.
  • the antigen is a capsular polysaccharide from Staphylococcus aureus.
  • the antigen may be a capsular polysaccharide from Staphylococcus aureus type 5 and 8.
  • the antigen is a capsular polysaccharide from Streptococcus pneumoniae.
  • the present invention also provides a host cell comprising:
  • nucleotide sequences comprising polysaccharide synthesis genes, optionally for producing a bacterial polysaccharide antigen (e.g. an O-antigen from a Gram negative bacterium optionally from Shigella dysenteriae, Shigella flexneri, Shigella sonnei, Pseudomonas aeruginosa, Klebsiella pneumoniae, or a capsular polysaccharide from a Gram positive bacterium optionally from Streptococcus pneumoniae or Staphylococcus aureus ) or a yeast polysaccharide antigen or a mammalian polysaccharide antigen, optionally integrated into the host cell genome;
  • a bacterial polysaccharide antigen e.g. an O-antigen from a Gram negative bacterium optionally from Shigella dysenteriae, Shigella flexneri, Shigella sonnei, Pseudomonas aeruginosa, Klebsi
  • a nucleotide sequence that encodes a modified EPA protein of the invention optionally within a plasmid.
  • Host cells that can be used to produce the bioconjugates of the invention include archea, prokaryotic host cells, and eukaryotic host cells.
  • the host cell is a non-human host cell.
  • Exemplary prokaryotic host cells for use in production of the bioconjugates of the invention include Escherichia species, Shigella species, Klebsiella species, Xhantomonas species, Salmonella species, Yersinia species, Lactococcus species, Lactobacillus species, Pseudomonas species, Corynebacterium species, Streptomyces species, Streptococcus species, Staphylococcus species, Bacillus species, and Clostridium species.
  • the host cell is E. coli (e.g. E. coli K12 W3110).
  • Host cells may be modified to delete or modify genes in the host cell genetic background (genome) that compete or interfere with the synthesis of the polysaccharide of interest (e.g. compete or interfere with one or more heterologous polysaccharide synthesis genes that are recombinantly introduced into the host cell).
  • These genes can be deleted or modified in the host cell background (genome) in a manner that makes them inactive/dysfunctional (i.e. the host cell nucleotide sequences that are deleted/modified do not encode a functional protein or do not encode a protein whatsoever).
  • nucleotide sequences are deleted from the genome of the host cells of the invention, they are replaced by a desirable sequence, e.g.
  • genes that can be deleted in host cells include genes of host cells involved in glycolipid biosynthesis, such as waaL (see, e.g. Feldman et al. 2005, PNAS USA 102:3016-3021), the O antigen cluster (rfb or wb), enterobacterial common antigen cluster (wec), the lipid A core biosynthesis cluster (waa), galactose cluster (gal), arabinose cluster (ara), colonic acid cluster (wc), capsular polysaccharide cluster, undecaprenol-pyrophosphate biosynthesis genes (e.g.
  • uppS Undecaprenyl pyrophosphate synthase
  • uppP Undecaprenyl diphosphatase
  • Und-P recycling genes metabolic enzymes involved in nucleotide activated sugar biosynthesis, enterobacterial common antigen cluster, and prophage O antigen modification clusters like the gtrABS cluster.
  • one or more of the waaL gene, gtrA gene, gtrBgene, gtrSgene, or a gene or genes from the wec cluster or a gene, or a gene or genes from the colonic acid cluster (wc), or a gene or genes from the rfb gene cluster are deleted or functionally inactivated from the genome of a prokaryotic host cell of the invention.
  • one or more of the waaL gene, gtrA gene, gtrB gene, gtrS gene, or a gene or genes from the wec cluster or a gene or genes from the rfb gene cluster are deleted or functionally inactivated from the genome of a prokaryotic host cell of the invention.
  • the host cell of the invention is E. coli, wherein the native enterobacterial common antigen cluster (ECA, wec) with the exception of wecA, the colanic acid cluster (wca), and the 016-antigen cluster have been deleted.
  • ECA enterobacterial common antigen cluster
  • wca colanic acid cluster
  • 016-antigen cluster the native lipopolysaccharide O-antigen ligase waaL may be deleted from the host cell of the invention.
  • the native gtrA gene, gtrB gene and gtrS gene may be deleted from the host cell of the invention.
  • the host cells of the present invention are engineered to comprise heterologous nucleotide sequences.
  • the host cells of the present invention are engineered to comprise a nucleotide sequence that encodes a modified EPA protein of the invention, optionally within a plasmid.
  • the host cells of the invention also comprise one or more nucleotide sequences comprising polysaccharide synthesis genes.
  • host cells of the invention can produce a bioconjugate comprising an antigen, for example a saccharide antigen (e.g. a bacterial, yeast or mammalian polysaccharide antigen) which is attached to a modified EPA protein of the invention.
  • a saccharide antigen e.g. a bacterial, yeast or mammalian polysaccharide antigen
  • One or more heterologous nucleotide sequences may encode for the polysaccharide synthesis proteins to produce the bacterial polysaccharide antigen, yeast polysaccharide antigen or mammalian polysaccharide antigen.
  • a host cell comprising:
  • one or more heterologous nucleotide sequences comprising polysaccharide synthesis genes for producing a bacterial polysaccharide antigen (e.g. an O-antigen from a Gram negative bacterium optionally from Shigella dysenteriae, Shigella flexneri, Shigella sonnei, Pseudomonas aeruginosa, Klebsiella pneumoniae, or a capsular polysaccharide from a Gram positive bacterium optionally from Streptococcus pneumoniae or Staphylococcus aureus ) or a yeast polysaccharide antigen or a mammalian polysaccharide antigen, optionally integrated into the host cell genome;
  • a bacterial polysaccharide antigen e.g. an O-antigen from a Gram negative bacterium optionally from Shigella dysenteriae, Shigella flexneri, Shigella sonnei, Pseudomonas aeruginosa, Kle
  • a nucleotide sequence that encodes a modified EPA protein of the invention optionally within a plasmid.
  • the host cells of the invention may comprise one or more nucleotide sequences sufficient for producing a saccharide antigen (e.g. a bacterial polysaccharide antigen), in particular for producing a saccharide antigen (e.g. a bacterial polysaccharide antigen) that is heterologous to the host cell.
  • a saccharide antigen e.g. a bacterial polysaccharide antigen
  • the host cell may comprise one more nucleotide sequences comprising polysaccharide synthesis genes sufficient for producing a bacterial polysaccharide antigen of a bacteria which is not an E. coli polysaccharide antigen.
  • the bacterial polysaccharide antigen may be an O-antigen or a capsular polysaccharide antigen.
  • the present invention also provides a host cell comprising:
  • nucleotide sequences comprising polysaccharide synthesis genes, for producing a bacterial polysaccharide antigen (e.g. an O-antigen from a Gram negative bacterium, optionally from Shigella dysenteriae, Shigella flexneri, Shigella sonnei, Pseudomonas aeruginosa, Klebsiella pneumoniae, or a capsular polysaccharide from a Gram positive bacterium optionally from Streptococcus pneumoniae or Staphylococcus aureus ), optionally integrated into the host cell genome;
  • a bacterial polysaccharide antigen e.g. an O-antigen from a Gram negative bacterium, optionally from Shigella dysenteriae, Shigella flexneri, Shigella sonnei, Pseudomonas aeruginosa, Klebsiella pneumoniae, or a capsular polysaccharide from a Gram positive bacterium optionally from Str
  • a nucleotide sequence that encodes a modified EPA protein of the invention optionally within a plasmid.
  • Polysaccharide synthesis genes encode proteins involved in synthesis of a polysaccharide (polysaccharide synthesis proteins).
  • the host cells may comprise one or more nucleotide sequences comprising polysaccharide synthesis genes for producing an O-antigen from a Gram negative bacterium selected from Shigella dysenteriae, Shigella flexneri, Shigella sonnei, Pseudomonas aeruginosa and Klebsiella pneumoniae, or a capsular polysaccharide from a Gram positive bacterium selected from Streptococcus pneumoniae and Staphylococcus aureus.
  • the host cells may comprise one or more nucleotide sequences comprising polysaccharide synthesis genes for producing an O-antigen from a Gram negative bacterium selected from Shigella flexneri and Klebsiella pneumoniae, or a capsular polysaccharide from a Gram positive bacterium selected from Streptococcus pneumoniae and Staphylococcus aureus.
  • the host cells of the invention may comprise one or more nucleotide sequences comprising polysaccharide synthesis genes for producing an O-antigen.
  • the host cell comprises one or more nucleotide sequences comprising polysaccharide synthesis genes for producing an O-antigen from Salmonella species, Shigella species, Pseudomonas species or Klebsiella species.
  • the host cell comprises one or more nucleotide sequences comprising polysaccharide synthesis genes for producing an O-antigen from Shigella species, Pseudomonas species or Klebsiella species. (e.g.
  • the host cell comprises one or more nucleotide sequences comprising polysaccharide synthesis genes for producing an O-antigen from Shigella species or Klebsiella species. (e.g. Shigella dysenteriae, Shigella flexneri, Shigella sonnei or Klebsiella pneumoniae ).
  • the host cell comprises one or more nucleotide sequences comprising polysaccharide synthesis genes for producing an O-antigen from Shigella dysenteriae, Shigella flexneri or Shigella sonnei.
  • the host cell may comprise one or more nucleotide sequences comprising polysaccharide synthesis genes for producing an O-antigen from S. dysenteriae type 1, S. sonnei, and S. flexneri type 6, and S. flexneri 2a and 3a 0 (Dmitriev, B. A., et al Somatic Antigens of Shigella Eur J. Biochem, 1979. 98: p.
  • the host cell comprises one or more nucleotide sequences comprising polysaccharide synthesis genes for producing an O-antigen from Pseudomonas aeruginosa e.g. Pseudomonas aeruginosa serotypes 1-20.
  • the host cell comprises one or more nucleotide sequences comprising polysaccharide synthesis genes for producing an O-antigen from Klebsiella pneumoniae.
  • the host cells of the invention may comprise one or more nucleotide sequences comprising polysaccharide synthesis genes for producing a capsular polysaccharide.
  • the host cell comprises one or more nucleotide sequences comprising polysaccharide synthesis genes for producing a capsular polysaccharide from N. meningitidis serogroup A (MenA), N. meningitidis serogroup C (MenC), N. meningitidis serogroup Y (MenY), N. meningitidis serogroup W (MenW), H.
  • the host cell comprises one or more nucleotide sequences comprising polysaccharide synthesis genes for producing a capsular polysaccharide from Streptococcus species, or Staphylococcus species. (e.g. Streptococcus pneumoniae or Staphylococcus aureus ).
  • the host cell comprises one or more nucleotide sequences comprising polysaccharide synthesis genes for producing a capsular polysaccharide from Staphylococcus aureus, e.g. from Staphylococcus aureus type 5 and 8.
  • the host cell comprises one or more nucleotide sequences comprising polysaccharide synthesis genes for producing a capsular polysaccharide from Streptococcus pneumoniae.
  • Host Cells Comprising Heterologous Nucleotide Sequences for Producing a Bacterial Polysaccharide Antigen
  • the host cells of the present invention may naturally express one or more nucleotide sequences comprising polysaccharide synthesis genes for production of a saccharide antigen (e.g. a bacterial polysaccharide antigen), or the host cells may be engineered to express one or more such nucleotide sequences.
  • host cells of the present invention may utilize endogenous or heterologous glycosyltransferases for sequential assembly of oligosaccharides in the cytosol (cytosolic glycosyltransferases).
  • Heterologous nucleotide sequences e.g. nucleotide sequences that encode carrier proteins and/or nucleotide sequences that encode other proteins, e.g.
  • heterologous nucleotide sequences are introduced into the host cells of the invention using a plasmid, e.g. the heterologous nucleotide sequences are expressed in the host cells by a plasmid (e.g. an expression vector).
  • heterologous nucleotide sequences are introduced into the host cells of the invention using the method of insertion described in WO14/037585.
  • the host cell of the present invention comprises one or more nucleotide sequences comprising polysaccharide synthesis genes which are heterologous to the host cell.
  • one or more of said nucleotide sequences comprising polysaccharide synthesis genes which are heterologous to the host cell are integrated into the genome of the host cell.
  • the heterologous nucleotide sequences may encode, without limitation, glycosyltransferases, oligosaccharyl transferases, epimerases, flippases, and/or polymerases.
  • the host cells of the invention comprise one or more heterologous nucleotide sequences encoding glycosyltransferase(s).
  • Said glycosyltransferase(s) can be derived from, e.g. Escherichia species, Shigella species, Klebsiella species, Salmonella species, Pseudomonas species, Streptococcus species, or Staphylococcus species.
  • the host cells of the invention may comprise one or more heterologous nucleotide sequences comprising polysaccharide synthesis genes for producing an O-antigen.
  • the host cell comprises one or more nucleotide sequences from Salmonella species, Shigella species, Pseudomonas species or Klebsiella species that encode polysaccharide synthesis proteins for producing an O-antigen.
  • the host cell comprises one or more nucleotide sequences from Shigella species, Pseudomonas species or Klebsiella species. (e.g.
  • the host cell comprises one or more nucleotide sequences from Shigella species or Klebsiella species. (e.g. Shigella dysenteriae, Shigella flexneri, Shigella sonnei, or Klebsiella pneumoniae ) that encode polysaccharide synthesis proteins for producing an O-antigen.
  • the host cell comprises one or more nucleotide sequences from Shigella dysenteriae, Shigella flexneri or Shigella sonnei. that encode polysaccharide synthesis proteins for producing an O-antigen.
  • the host cell may comprise one or more nucleotide sequences from S. dysenteriae type 1, S. sonnei, and S. flexneri type 6, and S. flexneri 2a and 3a that encode polysaccharide synthesis proteins for producing an O-antigen.
  • the host cell comprises one or more nucleotide sequences from Pseudomonas aeruginosa, e.g.
  • the host cell comprises one or more nucleotide sequences from Klebsiella pneumoniae that encode polysaccharide synthesis proteins for producing an O-antigen.
  • the nucleotide sequences that encode an O-antigen may be an rfb cluster.
  • rfb cluster refer to a gene cluster that encodes enzymatic machinery capable of synthesis of an O antigen.
  • the host cells may comprise an rfb gene cluster from Shigella dysenteriae, Shigella flexneri, Shigella sonnei, Pseudomonas aeruginosa, Klebsiella pneumoniae.
  • the host cells of the invention may comprise one or more heterologous nucleotide sequences comprising polysaccharide synthesis genes for producing a capsular saccharide.
  • the host cell comprises one or more nucleotide sequences from N. meningitidis serogroup A (MenA), N. meningitidis serogroup C (MenC), N. meningitidis serogroup Y (MenY), N. meningitidis serogroup W (MenW), H. influenzae type b (Hib), Group B Streptococcus (GBS), Streptococcus pneumoniae, or Staphylococcus aureus that encode polysaccharide synthesis proteins for producing a capsular saccharide.
  • MenA N. meningitidis serogroup A
  • MenC N. meningitidis serogroup C
  • MenY N. meningitidis serogroup Y
  • MenW N. meningitidis
  • the host cell comprises one or more nucleotide sequences from Streptococcus species, or Staphylococcus species. (e.g. Streptococcus pneumoniae or Staphylococcus aureus ) that encode polysaccharide synthesis proteins for producing a capsular polysaccharide.
  • the host cell comprises one or more nucleotide sequences from Staphylococcus aureus, e.g. from Staphylococcus aureus type 5 and 8, that encode polysaccharide synthesis proteins for producing a capsular polysaccharide.
  • the host cell comprises one or more nucleotide sequences comprising polysaccharide synthesis genes for producing a capsular polysaccharide from Streptococcus pneumoniae.
  • the nucleotide sequences may be a capsular polysaccharide gene cluster.
  • the host cells may comprise a capsular polysaccharide gene cluster from a Streptococcus strain (e.g. S. pneumoniae, S. pyrogens, S. agalacticae ), a Staphylococcus strain (e.g. S. aureus ).
  • the capsular polysaccharide gene cluster for Streptococcus pneumoniae maps between dexB and aliA in the pneumococcal chromosome (Llull et al., 1999, J. Exp. Med. 190, 241-251). There are typically four relatively conserved genes: (wzg), (wzh), (wza), (wze) at the 5′ end of the capsular polysaccharide gene cluster (Jiang et al., 2001, Infect. Immun. 69, 1244-1255). Also included in the capsular polysaccharide gene cluster of S. pneumoniae are wzx (polysaccharide flippase gene) and wzy (polysaccharide polymerase gene).
  • the host cells of the invention may further comprise a nucleotide sequence encoding a polymerase (e.g. wzy), a flippase (e.g. wzx) and optionally a nucleotide sequence encoding and/or a chain length regulator (e.g. wzz).
  • a polymerase e.g. wzy
  • the host cells may also comprise heterologous nucleotide sequences that are located outside of an rfb cluster or a capsular polysaccharide cluster.
  • heterologous nucleotide sequences that are located outside of an rfb cluster or a capsular polysaccharide cluster.
  • nucleotide sequences encoding glycosyltransferases and acetyltransferases that are found outside of rfb clusters or capsular polysaccharide clusters and that modify recombinant polysaccharides can be introduced into the host cells.
  • N-linked protein glycosylation (the addition of carbohydrate molecules to an asparagine residue in the polypeptide chain of the target protein) is the most common type of post-translational modification occurring in the endoplasmic reticulum of eukaryotic organisms.
  • the process is accomplished by the enzymatic oligosaccharyltransferase complex (OST) responsible for the transfer of a preassembled oligosaccharide from a lipid carrier (dolichol phosphate) to an asparagine residue of a nascent protein within the conserved sequence Asn-X-Ser/Thr (where X is any amino acid except proline) in the Endoplasmic reticulum.
  • OST enzymatic oligosaccharyltransferase complex
  • the host cells of the present invention comprise a nucleotide sequence encoding a heterologous oligosaccharyl transferase, optionally within a plasmid.
  • the oligosaccharyl transferase is an oligosaccharyl transferase from Campylobacter.
  • the oligosaccharyl transferase is a pglB, optionally from Campylobacter jejuni (i.e. pglB; see, e.g. Wacker et al. 2002, Science 298:1790-1793; see also, e.g. NCBI Gene ID: 3231775, UniProt Accession No. 086154) SEQ ID NO: 24:
  • host cells of the present invention may comprise a nucleotide sequence encoding pglB, optionally pglB from Campylobacter jejuni, optionally a nucleotide sequence encoding pglB from Campylobacter jejuni having a sequence at least 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 24, optionally within a plasmid.
  • Host cells of the present invention may also comprise a nucleotide sequence that encodes a polymerase (e.g. wzy).
  • the polymerase e.g. wzy
  • the polymerase is introduced into a host cell of the invention (i.e. the polymerase is heterologous to the host cell).
  • the polymerase is a bacterial polymerase.
  • the polymerase is a capsular polysaccharide polymerase (e.g. wzy) or an O antigen polymerase (e.g. wzy).
  • the polymerase is an O-antigen polysaccharide polymerase (e.g. wzy), e.g.
  • the polymerase is a capsular polysaccharide polymerase (e.g. wzy), e.g. from N. meningitidis serogroup A (MenA), N. meningitidis serogroup C (MenC), N. meningitidis serogroup Y (MenY), N. meningitidis serogroup W (MenW), H.
  • MenA meningitidis serogroup A
  • MenC N. meningitidis serogroup C
  • MenY N. meningitidis serogroup W
  • H H.
  • the polymerase is a capsular polysaccharide polymerase (e.g. wzy) of Streptococcus pneumoniae.
  • Said wzy polymerase may be incorporated (e.g. inserted into the genome or expressed by a plasmid) in said host cell as part of a rfb cluster or capsular polysaccharide cluster.
  • a host cell of the invention may further comprise a nucleotide sequence encoding a heterologous wzy polymerase.
  • a host cell of the invention may also comprise a nucleotide sequence encoding a flippase (e.g. wzx), e.g. a heterologous flippase.
  • Flippases translocate wild type repeating units and/or their corresponding engineered (hybrid) repeat units from the cytoplasm into the periplam of host cells (e.g. E. coli ).
  • the flippase is a bacterial flippase, e.g. a flippase of the polysaccharide biosynthetic pathway of interest.
  • the host cell of the invention comprises a nucleotide sequence encoding a flippase (e.g.
  • the flippase is a capsular polysaccharide flippase (e.g. wzx) of Streptococcus pneumoniae.
  • Other flippases that can be introduced into the host cells of the invention are for example from Campylobacter jejuni (e.g. pglK).
  • nucleotide sequences encoding one or more accessory enzymes are introduced into the host cells of the invention.
  • a host cell of the invention may further comprise one or more of these accessory enzymes.
  • Such nucleotide sequences encoding one or more accessory enzymes can be either plasmid-borne or integrated into the genome of the host cells of the invention.
  • Exemplary accessory enzymes include, without limitation, epimerases (see e.g. WO2011/062615), branching, modifying (e.g. to add cholins, glycerolphosphates, pyruvates), amidating, chain length regulating, acetylating, formylating, polymerizing enzymes.
  • a host cell of the invention may also comprise a nucleotide sequence encoding a chain length regulator (e.g. wzz), e.g. a heterologous chain length regulator.
  • a chain length regulator e.g. wzz
  • the chain length regulator is a capsular polysaccharide chain length regulator (e.g. wzz) of Streptococcus pneumoniae.
  • the present invention provides a bioconjugate comprising a modified EPA protein of the invention linked to an antigen (e.g. a bacterial polysaccharide antigen or a yeast polysaccharide antigen or a mammalian polysaccharide antigen).
  • an antigen e.g. a bacterial polysaccharide antigen or a yeast polysaccharide antigen or a mammalian polysaccharide antigen.
  • said antigen is an O-antigen or a capsular polysaccharide.
  • the antigen is an O-antigen from a Gram negative bacterium.
  • the present invention provides a bioconjugate comprising a modified EPA protein of the invention linked to an antigen wherein the antigen is a saccharide, optionally a bacterial polysaccharide (e.g.
  • the present invention provides a bioconjugate comprising a modified EPA protein of the invention linked to an antigen wherein the antigen is a bacterial polysaccharide (e.g. from Shigella dysenteriae, Shigella flexneri, Shigella sonnei, Klebsiella pneumoniae, or Streptococcus pneumoniae ).
  • a bioconjugate comprising a modified EPA protein of the invention linked to an antigen wherein the antigen is a bacterial polysaccharide (e.g. from Shigella dysenteriae, Shigella flexneri, Shigella sonnei, Klebsiella pneumoniae, or Streptococcus pneumoniae ).
  • the present invention provides a bioconjugate comprising a modified EPA protein of the invention linked to an antigen wherein the antigen is a bacterial polysaccharide from Shigella flexneri, Klebsiella pneumoniae or Streptococcus pneumoniae.
  • the antigen is linked to an amino acid on the modified EPA protein selected from asparagine, aspartic acid, glutamic acid, lysine, cysteine, tyrosine, histidine, arginine or tryptophan (e.g. asparagine).
  • Bioconjugates, as described herein have advantageous properties over chemical conjugates of antigen-carrier protein, in that they require less chemicals in manufacture and are more consistent in terms of the final product generated.
  • a further aspect of the invention is a process for producing a bioconjugate that comprises (or consists of) a modified EPA protein linked to a saccharide, said process comprising (i) culturing the host cell of the invention under conditions suitable for the production of glycoproteins and (ii) isolating the bioconjugate produced by said host cell, optionally isolating the bioconjugate from a periplasmic extract from the host cell.
  • bioconjugates can be made using the shakeflask process, e.g. in a LB shake flask.
  • a fed-batch process for the production of recombinant glycosylated proteins in bacteria can be used to produce bioconjugates of the invention.
  • Bioconjugates of the present invention can be manufactured on a commercial scale by developing an optimized manufacturing method using typical E. coli production processes.
  • feed strategies such as batch, chemostat and fed-batch can be used.
  • the bioconjugates of the invention can be purified for example, by chromatography (e.g. ion exchange, anionic exchange, affinity, and sizing column chromatography), centrifugation, differential solubility, or by any other standard technique for the purification of proteins. See, e.g. Saraswat et al. 2013, Biomed. Res. Int. ID #312709 (p. 1-18); see also the methods described in WO 2009/104074. Further, the bioconjugates may be fused to heterologous polypeptide sequences described herein or otherwise known in the art to facilitate purification.
  • Hydrazinolysis can be used to analyze glycans.
  • polysaccharides are released from their protein carriers by incubation with hydrazine according to the manufacturer's instructions (Ludger Liberate Hydrazinolysis Glycan Release Kit, Oxfordshire, UK).
  • the nucleophile hydrazine attacks the glycosidic bond between the polysaccharide and the carrier protein and allows release of the attached glycans.
  • N-acetyl groups are lost during this treatment and have to be reconstituted by re-N-acetylation.
  • the free glycans are purified on carbon columns and subsequently labeled at the reducing end with the fluorophor 2-amino benzamide.
  • the resulting fluorescence chromatogram indicates the polysaccharide length and number of repeating units. Structural information can be gathered by collecting individual peaks and subsequently performing MS/MS analysis. Thereby the monosaccharide composition and sequence of the repeating unit can be confirmed and additionally in homogeneity of the polysaccharide composition can be identified. Alternatively, high mass MS and size exclusion HPLC can be applied to measure the size of the complete bioconjugates.
  • Yield may be measured as carbohydrate amount derived from a liter of bacterial production culture grown in a bioreactor under controlled and optimized conditions. After purification of bioconjugate, the carbohydrate yields can be directly measured by either the anthrone assay or ELISA using carbohydrate specific antisera. Indirect measurements are possible by using the protein amount (measured by BCA, Lowry, or bardford assays) and the glycan length and structure to calculate a theoretical carbohydrate amount per gram of protein. In addition, yield can also be measured by drying the glycoprotein preparation from a volatile buffer and using a balance to measure the weight.
  • PAGE (or other techniques that separate by size) differ by only a single repeat unit. These discrete differences are exploited when analyzing glycoproteins for glycan size: the unglycosylated carrier protein and the bioconjugate with different polymer chain lengths separate according to their electrophoretic mobilities.
  • the first detectable repeat unit number (n 1 ) and the average repeat unit number (n average ) present on a bioconjugate are measured. These parameters can be used to demonstrate batch to batch consistency or polysaccharide stability, for example.
  • Glycosylation site usage may be quantified by, for example, glycopeptide LC-MS/MS: conjugates are digested with protease(s), and the peptides are separated by a suitable chromatographic method (C18, Hydrophilic interaction HPLC HILIC, GlycoSepN columns, SE HPLC, AE HPLC), and the different peptides are identified using MS/MS. This method can be used with or without previous sugar chain shortening by chemical (smith degradation) or enzymatic methods. Quantification of glycopeptide peaks using UV detection at 215 to 280 nm allows relative determination of glycosylation site usage.
  • site usage may be quantified by size exclusion HPLC: Higher glycosylation site usage is reflected by an earlier elution time from a SE HPLC column.
  • site usage may be quantified by quantitative densitometry of purified bioconjugates stained with Coomassie Briliant Blue following sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE).
  • conjugates e.g. bioconjugate
  • the conjugates are particularly suited for inclusion in immunogenic compositions and vaccines.
  • the present invention provides an immunogenic composition
  • a conjugate e.g. bioconjugate
  • a pharmaceutically acceptable excipient and/or carrier optionally a pharmaceutically acceptable excipient and/or carrier.
  • Immunogenic compositions comprise an immunologically effective amount of the modified EPA protein or conjugate (e.g. bioconjugate) of the invention, as well as any other components.
  • immunologically effective amount it is meant that the administration of that amount to an individual, either as a single dose or as part of a series is effective for treatment or prevention. This amount varies depending on the health and physical condition of the individual to be treated, age, the degree of protection desired, the formulation of the vaccine and other relevant factors.
  • Pharmaceutically acceptable excipients and carriers are described, for example, in Remington's Pharmaceutical Sciences, by E. W. Martin, Mack Publishing Co. Easton, Pa., 5th Edition (1975).
  • Pharmaceutically acceptable excipients can include a buffer, such as a phosphate buffer (e.g. sodium phosphate).
  • Pharmaceutically acceptable excipients can include a salt, for example sodium chloride.
  • Pharmaceutically acceptable excipients can include a solubilizing/stabilizing agent, for example, polysorbate (e.g. TWEEN 80).
  • Pharmaceutically acceptable excipients can include a preservative, for example 2-phenoxyethanol or thiomersal.
  • Pharmaceutically acceptable excipients can include a carrier such as water or saline.
  • Also provided is a method of making the immunogenic composition of the invention comprising the step of mixing the modified EPA protein or the conjugate (e.g. bioconjugate) of the invention with a pharmaceutically acceptable excipient and/or carrier.
  • the present invention also provides an immunogenic composition (e.g., a vaccine composition) optionally comprising an adjuvant.
  • an immunogenic composition e.g., a vaccine composition
  • an adjuvant e.g., an adjuvant
  • adjuvant refers to a compound that when administered in conjunction with or as part of an immunogenic composition of vaccine of the invention augments, enhances and/or boosts the immune response to modified EPA protein conjugate/bioconjugate, but when the compound is administered alone does not generate an immune response to the modified EPA protein conjugate/bioconjugate.
  • adjuvants can enhance an immune response by several mechanisms including, e.g. lymphocyte recruitment, stimulation of B and/or T cells, and stimulation of macrophages.
  • adjuvants include, but are not limited to, aluminum salts (alum) (such as aluminum hydroxide, aluminum phosphate, and aluminum sulfate), 3 De-O-acylated monophosphoryl lipid A (MPL) (see United Kingdom Patent GB2220211), MF59 (Novartis), AS01 (GlaxoSmithKline), and saponins, such as QS21 (see Kensil et al. in Vaccine Design: The Subunit and Adjuvant Approach (eds. Powell & Newman, Plenum Press, NY, 1995); U.S. Pat. No. 5,057,540).
  • the adjuvant is Freund's adjuvant (complete or incomplete).
  • adjuvants are oil in water emulsions (such as squalene or peanut oil), optionally in combination with immune stimulants, such as monophosphoryl lipid A (see Stoute et al. N. Engl. J. Med. 336, 86-91 (1997)).
  • Vaccine preparation is generally described in Vaccine Design (“The subunit and adjuvant approach” (eds Powell M. F. & Newman M. J.) (1995) Plenum Press New York).
  • the immunogenic compositions of the invention can be included in a container, pack, or dispenser together with instructions for administration.
  • the immunogenic compositions or vaccines of the invention can be stored before use, e.g.
  • compositions can be stored frozen (e.g. at about ⁇ 20° C. or at about ⁇ 70° C.); stored in refrigerated conditions (e.g. at about 4° C.); or stored at room temperature.
  • the immunogenic compositions or vaccines of the invention may be stored in solution or lyophilized.
  • the solution is lyophilized in the presence of a sugar such as sucrose, trehalose or lactose.
  • the vaccines of the invention are lyophilized and extemporaneously reconstituted prior to use.
  • Immunogenic compositions or vaccines of the invention may be used to protect or treat a subject (e.g. mammal), by means of administering said immunogenic composition or vaccine via systemic or mucosal route.
  • administrations may include injection via the intramuscular (IM), intraperitoneal, intradermal (ID) or subcutaneous (SC) routes; or via mucosal administration to the oral/alimentary, respiratory, genitourinary tracts.
  • the immunogenic composition or vaccine of the invention is administered by the intramuscular delivery route.
  • Intramuscular administration may be to the thigh or the upper arm. Injection is typically via a needle (e.g. a hypodermic needle), but needle-free injection may alternatively be used.
  • a typical intramuscular dose is 0.5 ml.
  • the immunogenic composition or vaccine of the invention is administered by the intradermal administration.
  • Human skin comprises an outer “horny” cuticle, called the stratum corneum, which overlays the epidermis. Underneath this epidermis is a layer called the dermis, which in turn overlays the subcutaneous tissue.
  • the conventional technique of intradermal injection, the “mantoux procedure”, comprises steps of cleaning the skin, and then stretching with one hand, and with the bevel of a narrow gauge needle (26 to 31 gauge) facing upwards the needle is inserted at an angle of between 10 to 15° . Once the bevel of the needle is inserted, the barrel of the needle is lowered and further advanced whilst providing a slight pressure to elevate it under the skin. The liquid is then injected very slowly thereby forming a bleb or bump on the skin surface, followed by slow withdrawal of the needle.
  • the immunogenic composition or vaccine of the invention is administered by the intranasal administration.
  • the immunogenic composition or vaccine is administered locally to the nasopharyngeal area, e.g. without being inhaled into the lungs.
  • an intranasal delivery device which delivers the immunogenic composition or vaccine formulation to the nasopharyngeal area, without or substantially without it entering the lungs.
  • Suitable devices for intranasal administration of the vaccines according to the invention are spray devices. Suitable commercially available nasal spray devices include ACCUSPRAYTM (Becton Dickinson).
  • the amount of conjugate (e.g. bioconjugate) in each immunogenic composition or vaccine dose is selected as an amount which induces an immunoprotective response without significant, adverse side effects in typical vaccines. Such amount will vary depending upon which specific immunogen is employed and how it is presented.
  • the content of conjugate (e.g. bioconjugate) will typically be in the range 1-100 ⁇ g, suitably 5-50 ⁇ g.
  • the present invention also provides an immunogenic composition of the invention, or the vaccine of the invention, for use in medicine.
  • the present invention provides a method of inducing an immune response in a subject (e.g. human), the method comprising administering a therapeutically or prophylactically effective amount of a conjugate (e.g. bioconjugate) of the invention, an immunogenic composition of the invention or a vaccine of the invention, to a subject (e.g. human) in need thereof.
  • a conjugate e.g. bioconjugate
  • an immunogenic composition of the invention or a vaccine of the invention for use in inducing an immune response in a subject (e.g. human).
  • the present invention also provides a conjugate (e.g. bioconjugate) of the invention, the immunogenic composition of the invention or the vaccine of the invention for use in the manufacture of a medicament for inducing an immune response in a subject (e.g. human).
  • a conjugate e.g. bioconjugate
  • the conjugate (e.g. bioconjugate) of the invention an immunogenic composition of the invention or a vaccine of the invention can be used to induce an immune response against a bacterium, e.g. Shigella species, Pseudomonas aeruginosa, Klebsiella pneumoniae, N. meningitidis, H.
  • the conjugate (e.g. bioconjugate) of the invention an immunogenic composition of the invention or a vaccine of the invention can be used to induce an immune response against a bacterium, e.g. Streptococcus species, Shigella species, Pseudomonas species, Klebsiella species, or Staphylococcus species.
  • a bacterium e.g. Streptococcus species, Shigella species, Pseudomonas species, Klebsiella species, or Staphylococcus species.
  • said subject has bacterial infection at the time of administration. In another embodiment, said subject does not have a bacterial infection at the time of administration.
  • Also provided herein are methods of inducing the production of opsonophagocytic antibodies in a subject against a bacterium comprising administering to the subject a conjugate (e.g. bioconjugate) of the invention an immunogenic composition of the invention or a vaccine of the invention.
  • the conjugate (e.g. bioconjugate) of the invention an immunogenic composition of the invention or a vaccine of the invention can be used to induce the production of opsonophagocytic antibodies in a subject against a bacterium, e.g. Shigella species, Pseudomonas aeruginosa, Klebsiella pneumoniae, N. meningitidis, H.
  • the conjugate (e.g. bioconjugate) of the invention an immunogenic composition of the invention or a vaccine of the invention can be used to induce the production of opsonophagocytic antibodies in a subject against a bacterium, e.g. Streptococcus species, Shigella species, Pseudomonas species, Klebsiella species, or Staphylococcus species.
  • a bacterium e.g. Streptococcus species, Shigella species, Pseudomonas species, Klebsiella species, or Staphylococcus species.
  • Shigella dysenteriae Shigella flexneri, Shigella sonnei, Pseudomonas aeruginosa, Klebsiella pneumoniae, Streptococcus pneumoniae or Staphylococcus aureus ).
  • the present invention also provides methods of treating and/or preventing a yeast or bacterial infection in a subject comprising administering to the subject a conjugate (e.g. bioconjugate) of the invention.
  • the conjugate e.g. bioconjugate
  • the conjugate may be in the form of an immunogenic composition or vaccine.
  • the present invention provides a method of treating and/or preventing a yeast or bacterial infection in a subject (e.g. human), the method comprising administering a therapeutically or prophylactically effective amount of a conjugate (e.g. bioconjugate) of the invention, an immunogenic composition of the invention or a vaccine of the invention, to a subject (e.g. human) in need thereof.
  • the present invention also provides a conjugate (e.g.
  • bioconjugate of the invention, an immunogenic composition of the invention or a vaccine of the invention, for use in treating and/or preventing a yeast or bacterial infection in a subject (e.g. human).
  • the present invention also provides a conjugate (e.g. bioconjugate) of the invention, the immunogenic composition of the invention or the vaccine of the invention for use in the manufacture of a medicament for treating and/or preventing a yeast or bacterial infections in a subject (e.g. human).
  • the immunogenic composition or vaccine of the invention is used in the prevention of infection of a subject by a bacterium.
  • Bacteria infections that can be treated and/or prevented using the conjugate (e.g. bioconjugate) of the invention include those caused by N.
  • H. influenzae type b Hib
  • Streptococcus species Shigella species, Pseudomonas species, Klebsiella species, or Staphylococcus species.
  • Shigella dysenteriae Shigella flexneri, Shigella sonnei, Pseudomonas aeruginosa, Klebsiella pneumoniae, Streptococcus pneumoniae or Staphylococcus aureus ).
  • SEQ NO: 9 GSGGG DQNAT GSGGGAEEAFDLWNECAKACVLDLKDGVRSSRMSVDPAI ADTNGQGVLHYSMVLEGGNDALKLAIDNALSITSDGLTIRLEGGVEPNK PVRYSYTRQARGSWSLNWLVPIGHEKPSNIKVFIHELNAGNQLSHMSPI YTIEMGDELLAKLARDATFFVRAHESNEMQPTLAISHAGVSVVMAQAQP RREKRWSEWASGKVLCLLDPLDGVYN KDQNATK LAQQRCNLDDTWEGKI YRVLAGNPAKHDLDIKPTVISHRLHFPEGGSLAALTAHQACHLPLEAFT KDQNATK HRQPRGWEQLEQCGYPVQRLVALYLAARLSWNQVDQVIRNAL ASPGSGGDLGEAIREQPEQARLALTLAAAESERFVRQGTGNDEAGAASA DVVSLTCPVAAGECAGPADSGDALLERNYPTGAEFLGDGGDVSF
  • SEQ ID NO: 12 GSGGG DQNAT GSGGGAEEAFDLWNECAKACVLDLKDGVRSSRMSVDPAI ADTNGQGVLHYSMVLEGGNDALKLAIDNALSITSDGLTIRLEGGVEPNK PVRYSYTRQARGSWSLNWLVPIGHEKPSNIKVFIHELNAGNQLSHMSPI YTIEMGDELLAKLARDATFFVRAHESNEMQPTLAISHAGVSVVMAQAQP RREKRWSEWASGKVLCLLDPLDGVYN KDQNATK LAQQRCNLDDTWEGKI YRVLAGNPAKHDLDIKPTVISHRLHFPEGGSLAALTAHQACHLPLEAFT KDQNATK HRQPRGWEQLEQCGYPVQRLVALYLAARLSWNQVDQVIRNAL A KDQNATK SPGSGGDLGEAIREQPEQARLALTLAAAESERFVRQGTGND EAGAASADVVSLTCPVAAGECAGPADSGDALLERNYPT
  • SEQ ID NO: 14 GSGGG DQNAT GSGGGAEEAFDLWNECAKACVLDLKDGVRSSRMSVDPAI ADTNGQGVLHYSMVLEGGNDALKLAIDNALSITSDGLTIRLEGGVEPNK PVRYSYTRQARGSWSLNWLVPIGHEKPSNIKVFIHELNAGNQLSHMSPI YTIEMGDELLAKLARDATFFVRAHESNEMQPTLAISHAGVSVVMAQAQP RREKRWSEWASGKVLCLLDPLDGVYN KDQNATK LAQQRCNLDDTWEGKI YRVLAGNPAKHDLDIK DNNNST PTVISHRLHFPEGGSLAALTAHQACHL PLEAFT KDQNATK HRQPRGWEQLEQCGYPVQRLVALYLAARLSWNQVDQ VIRNALA KDQNATK SPGSGGDLGEAIREQPEQARLALTLAAAESERFVR QGTGNDEAGAASADVVSLTCPVAAGECAGPADSGDALLERN
  • This gene was cloned with the DsbA signal sequence at the N-terminus and a His 6 tag at C-terminus into a plasmid derived from pEC415 (Schulz, H., Hennecke, H., Thony-Meyer, L., Prototype of a heme chaperone essential for cytochrome c maturation. In Science 281, 1197-1200, 1998).
  • Each selected amino acid residue was substituted with the glycosylation sequon KDQNATK (SEQ ID NO: 4) leading to 67 EPA variants in total, each containing a single glycosylation site (glycosite).
  • E. coli strain W3110 ⁇ waaL was transformed with three plasmids: a pEC415 plasmid carrying an EPA variant, a plasmid expressing PglB and with a plasmid expressing enzyme for the biosynthesis of the polysaccharide of interest (as described below).
  • the non-pathogenic E. coli K12 strain W3110 was obtained from the Coli Genetic Stock Center (Yale University, New Haven (Conn.), USA, product number CGSC #4474). In some cases, glycosylation test were performed with an E.
  • the selection criteria for EPA variants with single glycosite included the total expression level and the level of produced glycoconjugate, the later indicating suitability of glycosite position for modification by PglB.
  • the used E. coli strains are derivatives of strain W3110, which include a deletion in the lipopolysaccharide O-antigen ligase gene waaL, the deletion or replacement of the O16 O-antigen cluster rfband the replacement of a genomic cluster with the cluster responsible for the biosynthesis of the wanted recombinant glycan of Klebsiella pneumoniae O-antigen (KpO-antigen) Shigella flexneri 2a (Sf2a) or Streptococcus pneumoniae 11A (Sp11A) and 33F (Sp33F) capsular polysaccharides and Pseudomonas aeruginosa O-antigens (PaO6 and PaO11).
  • KpO-antigen Shigella flexneri 2a
  • Sp11A Streptococcus pneumoniae 11A
  • Sp33F capsular polysaccharides and Pseudomonas aeruginosa O-antigens
  • the E. coli strain used for the recombinant production of the K. pneumoniae O-antigen in FIG. 6 and FIG. 8 contains in addition genomic deletions of potentially interfering elements: genes wzzE-wecG from the enterobacterial common antigen (ECA) wec cluster, the colanic acid wca cluster, gtrABSand wzzBgenes involved in the O16 biosynthesis.
  • ECA enterobacterial common antigen
  • the E. coli strain producing KpO-antigen for FIG. 1 - 5 or KpO-antigen for FIG. 8 (P018_0167) glycan was transformed with a pEC415 plasmid carrying an EPA variant and a plasmid expressing PglB.
  • 5 ml TB (Terrific Broth) medium containing 10 mM MgCl 2 and appropriate antibiotics was inoculated with a streak of colonies from the transformation plate and grown at 37° C. o/n (overnight).
  • the E. coli strain producing KpO-antigen for FIG. 6 and FIG. 8 (P018-0183) was transformed with a plasmid expressing both EPA variant and PglB. These cultures were induced only by addition of 0.1 mM Isopropyl ⁇ -D-1-thiogalactopyranoside (IPTG) and expression and glycosylation of EPA variants was continued at 37° C. o/n.
  • IPTG Isopropyl ⁇ -D-1-thiogalactopyranoside
  • the amount of cells from o/n cultures corresponding to OD 600 60 (measured using a spectrophotometer) was harvested by centrifugation.
  • the cell pellets were resuspended in 1.5 ml of lysis buffer (30 mM Tris-HCl pH 8.5, 1 mM EDTA (Ethylenediaminetetraacetic acid), 20% sucrose) and lysozyme was added to a final concentration of 1 mg/ml.
  • the suspensions were incubated with slight shaking for 25 minutes at 4° C. and then centrifuged at 16,000 rcf for 10 min. After centrifugation, the supernatant corresponding to periplasmic extract (PPE) was transferred to a fresh tube.
  • PPE periplasmic extract
  • the His-tagged EPA variants were purified using one-step purification on Ni-NTA (Nickel Nitrilo-triacetic Acid) agarose.
  • 1 ml of PPE was mixed with 250 ⁇ l of 5 ⁇ binding buffer (150 mM Tris-HCl pH 8.0, 50 mM imidazole, 2.5 M NaCl, 20 mM MgCl 2 ) followed by addition of 200 ⁇ l of pre-equilibrated Ni-NTA slurry and incubated with slight shaking for 30 min.
  • the IMAC enriched PPE was analysed by SDS-PAGE (Laemmli, U. K. (1970). “Cleavage of Structural Proteins during the Assembly of the Head of Bacteriophage T4”. Nature. 227 (5259): 680-685. Bibcode:1970Natur.227.680L. doi:10.1038/227680a0. ISSN 0028-0836.
  • Periplasmic extracts were also analysed by immunoblots against EPA (Sigma-Aldrich, Cat. number P2318) and against polysaccharide attached to EPA.
  • EPA Sigma-Aldrich, Cat. number P2318
  • polysaccharide attached to EPA For detection of KpO-antigen, anti-serum against a K-capsular mutant of Klebsiella pneumoniae was used.
  • SDS-PAGE analysis was carried out on IMAC enriched periplasmic extract of E. coli strains producing KpO-antigen polysaccharide and expressing PglB and EPA variants with a glycosite KDQNATK (SEQ ID NO: 4) introduced at the following positions into SEQ ID NO: 1: Y208 (lane 1), K240 (lane 2), R274 (lane 3), S318 (lane 4), A376 (lane 5), A519 (lane 6), and K240 and A376 (lane 7).
  • the bands shown in FIG. 3 correspond to the unglycosylated EPA carrier, and to KpO-antigen-EPA bioconjugates with one and two occupied glycosites.
  • Glycosylation of EPA with KpO-antigen at each of the new positions was confirmed to be equally good or superior compared to positions K240 and A376.
  • Y208, S318 and A519 look superior compared to positions K240 and A376.
  • Y208 has higher total expression and all 3 have higher amount of conjugates than positions K240 and A376.
  • the upper panel represents the immunoblot probed with anti-KpO-antigen anti-serum
  • the bottom panel represents the immunoblot probed with anti-EPA antibody.
  • the bands correspond to the unglycosylated EPA carrier, and to KpO-antigen-EPA bioconjugates with one to seven occupied glycosites.
  • glycosylation at up to 7 glycosites is possible by combining the glycosite positions when using a variant of EPA which includes the combination of seven consensus sequences.
  • Klebsiella pneumoniae serotype O-antigen can be used to show glycosylation efficiency of EPA having more than 3 glycosites.
  • Immunoblot analysis was carried out on periplasmic extract of E. coli strains producing Sf2a-, Sp33F, PaO6 or PaO11 antigen polysaccharide and expressing PglB and EPA variants with 1 glycosite introduced at the following positions: Y208 (lane 1), D218 (lane 2), R274 (lane 3), R279 (lane 4), S318 (lane 5), G323 (lane 6), A376 (lane 7), A519 (lane 8), and G525 (lane 9).
  • the panel with Sf2a represents the immunoblot probed with anti-EPA antibody, while the other three panels represent the immunoblot probed with anti-His antibody.
  • the bands correspond to the unglycosylated EPA carrier, and to O-antigen-EPA bioconjugates with one occupied glycosite.
  • SEQUENCE LISTINGS SEQ ID NO: 1 EPA sequence from Pseudomonas aeruginosa AEEAFDLWNECAKACVLDLKDGVRSSRMSVDPAIADTNGQGVLHYSMVLEGGNDALKLAIDNALSITSDGLTIR LEGGVEPNKPVRYSYTRQARGSWSLNWLVPIGHEKPSNIKVFIHELNAGNQLSHMSPIYTIEMGDELLAKLARDA TFFVRAHESNEMQPTLAISHAGVSVVMAQAQPRREKRWSEWASGKVLCLLDPLDGVYNYLAQQRCNLDDTWE GKIYRVLAGNPAKHDLDIKPTVISHRLHFPEGGSLAALTAHQACHLPLEAFTRHRQPRGWEQLEQCGYPVQRLV ALYLAARLSWNQVDQVIRNALASPGSGGDLGEAIREQPEQARLALTLAAAESERFVRQGTGNDEAGAASADWS LTCPVAAGECAGPADSGDALLERNYPTGAEF
  • coli flagellin FLSALILLLVTTAAQA SEQ ID NO: 16
  • E. coli outer membrane porin A OmpA
  • MKKTAIAIAVALAGFATVAQA SEQ ID NO: 17
  • E. coli maltose binding protein MKIKTGARILALSALTTMMFSASALA
  • Edwinia carotovorans pectate lyase PelB
  • MKYLLPTAAAGLLLLAAQPAMA SEQ ID NO: 19 heat labile E .

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Engineering & Computer Science (AREA)
  • General Health & Medical Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Medicinal Chemistry (AREA)
  • Wood Science & Technology (AREA)
  • Zoology (AREA)
  • Biochemistry (AREA)
  • Molecular Biology (AREA)
  • General Engineering & Computer Science (AREA)
  • Microbiology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Epidemiology (AREA)
  • Immunology (AREA)
  • Biotechnology (AREA)
  • Biomedical Technology (AREA)
  • Mycology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Biophysics (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Communicable Diseases (AREA)
  • Oncology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Virology (AREA)
  • Toxicology (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Peptides Or Proteins (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Medicinal Preparation (AREA)
US18/001,498 2020-06-25 2021-06-17 Modified exotoxin a proteins Pending US20230226175A1 (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
US18/001,498 US20230226175A1 (en) 2020-06-25 2021-06-17 Modified exotoxin a proteins

Applications Claiming Priority (7)

Application Number Priority Date Filing Date Title
US202063043883P 2020-06-25 2020-06-25
EP20182139 2020-06-25
EP20182138.6 2020-06-25
EP20182139.4 2020-06-25
EP20182138 2020-06-25
US18/001,498 US20230226175A1 (en) 2020-06-25 2021-06-17 Modified exotoxin a proteins
PCT/EP2021/066336 WO2021259742A1 (en) 2020-06-25 2021-06-17 Modified exotoxin a proteins

Publications (1)

Publication Number Publication Date
US20230226175A1 true US20230226175A1 (en) 2023-07-20

Family

ID=76375084

Family Applications (2)

Application Number Title Priority Date Filing Date
US18/001,498 Pending US20230226175A1 (en) 2020-06-25 2021-06-17 Modified exotoxin a proteins
US18/001,525 Pending US20230293657A1 (en) 2020-06-25 2021-06-17 Vaccine

Family Applications After (1)

Application Number Title Priority Date Filing Date
US18/001,525 Pending US20230293657A1 (en) 2020-06-25 2021-06-17 Vaccine

Country Status (8)

Country Link
US (2) US20230226175A1 (https=)
EP (2) EP4171624A1 (https=)
JP (2) JP2023531242A (https=)
CN (2) CN116209753A (https=)
BR (2) BR112022023234A2 (https=)
CA (2) CA3185642A1 (https=)
MX (2) MX2022015734A (https=)
WO (2) WO2021259743A2 (https=)

Families Citing this family (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20240066109A1 (en) * 2020-12-31 2024-02-29 Vaxnewmo Llc Klebsiella Pneumoniae O-Antigen Glycosylated Proteins and Methods of Making and Uses Thereof
US20240263132A1 (en) * 2021-05-26 2024-08-08 Pfizer Inc. Recombinant expression of klebsiella pneumoniae o-antigens in escherichia coli
WO2023118033A1 (en) * 2021-12-22 2023-06-29 Glaxosmithkline Biologicals Sa Vaccine
TW202432182A (zh) * 2022-10-24 2024-08-16 瑞士商愛杜西亞製藥有限公司 對抗克雷伯氏肺炎桿菌之疫苗
KR20250120353A (ko) * 2022-12-08 2025-08-08 이도르시아 파마슈티컬스 리미티드 클렙시엘라 뉴모니아에의 백신
WO2024146325A1 (zh) * 2023-01-06 2024-07-11 中国人民解放军军事科学院军事医学研究院 用于生产抗原多糖-载体蛋白生物偶联产物的工程菌及其应用
GB202302579D0 (en) * 2023-02-23 2023-04-12 Glaxosmithkline Biologicals Sa Immunogenic composition
WO2025032534A2 (en) * 2023-08-09 2025-02-13 Glaxosmithkline Biologicals Sa Modified proteins
CN120192388B (zh) * 2025-03-04 2025-12-02 江西澄实生物科技有限公司 一种预防肺炎克雷伯氏菌感染的疫苗及其应用

Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2019241672A2 (en) * 2018-06-16 2019-12-19 Vaxnewmo Llc Glycosylated comp pilin variants, methods of making and uses thereof

Family Cites Families (29)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP0027888B1 (en) 1979-09-21 1986-04-16 Hitachi, Ltd. Semiconductor switch
US4673574A (en) 1981-08-31 1987-06-16 Anderson Porter W Immunogenic conjugates
US4695624A (en) 1984-05-10 1987-09-22 Merck & Co., Inc. Covalently-modified polyanionic bacterial polysaccharides, stable covalent conjugates of such polysaccharides and immunogenic proteins with bigeneric spacers, and methods of preparing such polysaccharides and conjugates and of confirming covalency
IT1187753B (it) 1985-07-05 1987-12-23 Sclavo Spa Coniugati glicoproteici ad attivita' immunogenica trivalente
US5057540A (en) 1987-05-29 1991-10-15 Cambridge Biotech Corporation Saponin adjuvant
US4912094B1 (en) 1988-06-29 1994-02-15 Ribi Immunochem Research Inc. Modified lipopolysaccharides and process of preparation
US5153312A (en) 1990-09-28 1992-10-06 American Cyanamid Company Oligosaccharide conjugate vaccines
ES2204900T3 (es) 1992-02-11 2004-05-01 Henry M. Jackson Foundation For The Advancement Of Military Medicine Estructura inmuinogena de doble vector.
WO1995008348A1 (en) 1993-09-22 1995-03-30 Henry M. Jackson Foundation For The Advancement Of Military Medicine Method of activating soluble carbohydrate using novel cyanylating reagents for the production of immunogenic constructs
NZ304715A (en) 1995-03-22 1999-07-29 Jackson H M Found Military Med Production of immunogenic constructs using organic cyanylating reagents to activate carbohydrates and then coupling the carbohydrate to a protein, peptide or hapten
IL163806A0 (en) 2002-03-07 2005-12-18 Eidgenoess Tech Hochschule System and method for the production of recombinant glycosylated proteins in a prokaryotic host
US20070184072A1 (en) 2005-04-08 2007-08-09 Wyeth Multivalent pneumococcal polysaccharide-protein conjugate composition
ES2353814T3 (es) 2005-05-11 2011-03-07 Eth Zuerich Proteinas n-glicosiladas recombinantes de celulas procariotas.
CN101983070B (zh) 2008-02-20 2016-03-30 格林考瓦因有限公司 由来源于原核细胞的重组n-糖基化蛋白制备生物共轭物
JP2012533285A (ja) 2009-07-17 2012-12-27 オーシャン ハーベスト テクノロジー (カナダ) インコーポレイテッド 魚用飼料中の合成添加物を置換する、天然かつ持続可能な海藻配合物
NO2501406T3 (https=) 2009-11-19 2018-05-19
EP3281639B1 (en) 2010-05-06 2020-11-11 GlaxoSmithKline Biologicals S.A. Capsular gram-positive bacteria bioconjugate vaccines
BR112015004817A2 (pt) 2012-09-10 2017-07-04 Glycovaxyn Ag bioconjugados compreendendo antígenos modificados e seus usos
ES2905107T3 (es) 2012-10-12 2022-04-07 Glaxosmithkline Biologicals Sa Procedimientos de modificación de células hospedadoras
EP3508579B1 (en) 2012-11-07 2021-06-30 GlaxoSmithKline Biologicals SA Production of recombinant vaccine in e. coli by enzymatic conjugation
GB201301085D0 (en) * 2013-01-22 2013-03-06 London School Hygiene & Tropical Medicine Glycoconjugate Vaccine
MX371513B (es) * 2013-10-11 2020-01-31 Glaxosmithkline Biologicals Sa Metodos de modificacion de celulas huespedes.
WO2015124769A1 (en) 2014-02-24 2015-08-27 Glycovaxyn Ag Novel polysaccharide and uses thereof
WO2016020499A2 (en) 2014-08-08 2016-02-11 Glycovaxyn Ag Modified host cells for use in bioconjugate production
US9988426B2 (en) * 2014-09-18 2018-06-05 University Of Maryland, Baltimore Broad spectrum conjugate vaccine to prevent Klebsiella pneumoniae and Pseudomonas aeruginosa infections
TWI715617B (zh) 2015-08-24 2021-01-11 比利時商葛蘭素史密斯克藍生物品公司 對抗腸道外病原性大腸桿菌之免疫保護之方法及組合物
GB201712678D0 (en) 2017-08-07 2017-09-20 Glaxosmithkline Biologicals Sa Process for the manipulation of nucleic acids
EP3492481A1 (en) * 2017-11-30 2019-06-05 Vaxxilon AG Vaccine against klebsiella pneumoniae
BR112022014555A2 (pt) * 2020-02-23 2022-09-20 Pfizer Composições de escherichia coli e métodos das mesmas.

Patent Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2019241672A2 (en) * 2018-06-16 2019-12-19 Vaxnewmo Llc Glycosylated comp pilin variants, methods of making and uses thereof

Also Published As

Publication number Publication date
BR112022024267A2 (pt) 2023-01-17
EP4171625A2 (en) 2023-05-03
MX2022016589A (es) 2023-02-01
MX2022015734A (es) 2023-01-18
US20230293657A1 (en) 2023-09-21
BR112022023234A2 (pt) 2023-01-03
JP2023531059A (ja) 2023-07-20
CN115996749A (zh) 2023-04-21
WO2021259743A3 (en) 2022-04-21
EP4171624A1 (en) 2023-05-03
JP7847091B2 (ja) 2026-04-16
JP2023531242A (ja) 2023-07-21
CN116209753A (zh) 2023-06-02
CA3185639A1 (en) 2021-12-30
CA3185642A1 (en) 2021-12-30
WO2021259743A2 (en) 2021-12-30
WO2021259742A1 (en) 2021-12-30

Similar Documents

Publication Publication Date Title
US20230226175A1 (en) Modified exotoxin a proteins
CN103079591B (zh) 荚膜革兰氏阳性细菌生物缀合物疫苗
JP7551618B2 (ja) O-結合型グリコシル化のための修飾キャリアタンパク質
JP6682451B2 (ja) 改変型宿主細胞およびその使用
CA3125293A1 (en) Production of recombinant vaccine in e. coli by enzymatic conjugation
US11819544B2 (en) Immunogenic composition
Duke et al. Development and immunogenicity of a prototype multivalent group B Streptococcus bioconjugate vaccine
JP2022541911A (ja) バイオコンジュゲートグリコシル化の定量化
US20240207383A1 (en) Minimal Sequons Sufficient for O-Linking Glycosylation
US20250381257A1 (en) Vaccine
WO2024175620A1 (en) Immunogenic composition
WO2025172892A1 (en) Modified proteins and methods
WO2025032534A2 (en) Modified proteins
WO2025032535A2 (en) Modified proteins
KR20260052081A (ko) 변형된 단백질
AU2024229999A1 (en) Compositions and methods for producing glycoconjugate polypeptides having isopeptide bonds with a second polypeptide partner and uses thereof

Legal Events

Date Code Title Description
AS Assignment

Owner name: GLAXOSMITHKLINE BIOLOGICALS SA, BELGIUM

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:KEMMLER, STEFAN JOCHEN;LIZAK, CHRISTIAN;POSCH, GERALD JOHANN;AND OTHERS;SIGNING DATES FROM 20220108 TO 20220115;REEL/FRAME:062053/0169

STPP Information on status: patent application and granting procedure in general

Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION

STPP Information on status: patent application and granting procedure in general

Free format text: NON FINAL ACTION MAILED

STPP Information on status: patent application and granting procedure in general

Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER

STPP Information on status: patent application and granting procedure in general

Free format text: NON FINAL ACTION COUNTED, NOT YET MAILED

STPP Information on status: patent application and granting procedure in general

Free format text: NON FINAL ACTION MAILED

STPP Information on status: patent application and granting procedure in general

Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER

STPP Information on status: patent application and granting procedure in general

Free format text: NON FINAL ACTION COUNTED, NOT YET MAILED

STPP Information on status: patent application and granting procedure in general

Free format text: NON FINAL ACTION MAILED

STPP Information on status: patent application and granting procedure in general

Free format text: NON FINAL ACTION MAILED