US20190218261A1 - Targeted enhanced dna demethylation - Google Patents

Targeted enhanced dna demethylation Download PDF

Info

Publication number
US20190218261A1
US20190218261A1 US16/333,137 US201716333137A US2019218261A1 US 20190218261 A1 US20190218261 A1 US 20190218261A1 US 201716333137 A US201716333137 A US 201716333137A US 2019218261 A1 US2019218261 A1 US 2019218261A1
Authority
US
United States
Prior art keywords
domain
sequence
demethylation
complex
puf
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Pending
Application number
US16/333,137
Other languages
English (en)
Inventor
Albert Cheng
Aziz Taghbalout
Nathaniel Jillette
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Jackson Laboratory
Original Assignee
Jackson Laboratory
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Jackson Laboratory filed Critical Jackson Laboratory
Priority to US16/333,137 priority Critical patent/US20190218261A1/en
Publication of US20190218261A1 publication Critical patent/US20190218261A1/en
Assigned to THE JACKSON LABORATORY reassignment THE JACKSON LABORATORY ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: CHENG, ALBERT, JILLETTE, Nathaniel, TAGHBALOUT, Aziz
Pending legal-status Critical Current

Links

Images

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • C07K14/4701Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
    • C07K14/4702Regulators; Modulating activity
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • A61P35/02Antineoplastic agents specific for leukemia
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/195Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
    • C07K14/315Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Streptococcus (G), e.g. Enterococci
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/11DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • C12N15/113Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/85Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/87Introduction of foreign genetic material using processes not otherwise provided for, e.g. co-transformation
    • C12N15/90Stable introduction of foreign DNA into chromosome
    • C12N15/902Stable introduction of foreign DNA into chromosome using homologous recombination
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/0004Oxidoreductases (1.)
    • C12N9/0012Oxidoreductases (1.) acting on nitrogen containing compounds as donors (1.4, 1.5, 1.6, 1.7)
    • C12N9/0026Oxidoreductases (1.) acting on nitrogen containing compounds as donors (1.4, 1.5, 1.6, 1.7) acting on CH-NH groups of donors (1.5)
    • C12N9/0032Oxidoreductases (1.) acting on nitrogen containing compounds as donors (1.4, 1.5, 1.6, 1.7) acting on CH-NH groups of donors (1.5) with oxygen as acceptor (1.5.3)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/0004Oxidoreductases (1.)
    • C12N9/0069Oxidoreductases (1.) acting on single donors with incorporation of molecular oxygen, i.e. oxygenases (1.13)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/0004Oxidoreductases (1.)
    • C12N9/0071Oxidoreductases (1.) acting on paired donors with incorporation of molecular oxygen (1.14)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14Hydrolases (3)
    • C12N9/16Hydrolases (3) acting on ester bonds (3.1)
    • C12N9/22Ribonucleases RNAses, DNAses
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14Hydrolases (3)
    • C12N9/24Hydrolases (3) acting on glycosyl compounds (3.2)
    • C12N9/2497Hydrolases (3) acting on glycosyl compounds (3.2) hydrolysing N- glycosyl compounds (3.2.2)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12YENZYMES
    • C12Y114/00Oxidoreductases acting on paired donors, with incorporation or reduction of molecular oxygen (1.14)
    • C12Y114/11Oxidoreductases acting on paired donors, with incorporation or reduction of molecular oxygen (1.14) with 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors (1.14.11)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12YENZYMES
    • C12Y302/00Hydrolases acting on glycosyl compounds, i.e. glycosylases (3.2)
    • C12Y302/02Hydrolases acting on glycosyl compounds, i.e. glycosylases (3.2) hydrolysing N-glycosyl compounds (3.2.2)
    • C12Y302/02029Thymine-DNA glycosylase (3.2.2.29)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/09Fusion polypeptide containing a localisation/targetting motif containing a nuclear localisation signal
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/85Fusion polypeptide containing an RNA binding domain
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/90Fusion polypeptide containing a motif for post-translational modification
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12YENZYMES
    • C12Y113/00Oxidoreductases acting on single donors with incorporation of molecular oxygen (oxygenases) (1.13)
    • C12Y113/11Oxidoreductases acting on single donors with incorporation of molecular oxygen (oxygenases) (1.13) with incorporation of two atoms of oxygen (1.13.11)
    • C12Y113/1102Cysteine dioxygenase (1.13.11.20)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12YENZYMES
    • C12Y301/00Hydrolases acting on ester bonds (3.1)
    • C12Y301/21Endodeoxyribonucleases producing 5'-phosphomonoesters (3.1.21)
    • C12Y301/21001Deoxyribonuclease I (3.1.21.1)

Definitions

  • Cas9 protein and sgRNA constitute a sufficient two-component DNA endonuclease whose specificity is provided by target-matching sequence on the sgRNA while endonuclease activity resides on the Cas9 protein.
  • Nuclease-defective or nuclease-deficient Cas9 protein e.g., dCas9 with mutations on its nuclease domains retains DNA binding activity when complexed with sgRNA.
  • dCas9 protein can tether and localize effector domains or protein tags by means of protein fusions to sites matched by sgRNA, thus constituting an RNA-guided DNA binding enzyme.
  • dCas9 can be fused to transcriptional activation domain (e.g., VP64) or repressor domain (e.g., KRAB), and be guided by sgRNA to activate or repress target genes, respectively.
  • transcriptional activation domain e.g., VP64
  • repressor domain e.g., KRAB
  • dCas9 can also be fused with fluorescent proteins and achieve live-cell fluorescent labeling of chromosomal regions.
  • Cas9-effector fusion is possible because sgRNA:Cas9 pairing is exclusive.
  • multimerization of effector or protein tags by direct fusion with dCas9 protein is technically limited, by constraints such as difficulty in delivering the large DNA encoding such fusions, or difficulty in translating or translocating such large proteins into the nucleus due to protein size.
  • Methylcytosine is an epigenetic mark generated via a process that covalently adds a methyl group at position 5 of the cytosine ring of a CpG DNA sequence.
  • formation of 5-methylcytosine (5mC) is catalyzed and maintained by DNA methyltransferases.
  • Demethylation pathways which remove the methyl group to restore unmethylated DNA, involve the ten-eleven translocation (TET) family of proteins. These are TET methylcytosine dioxygenases that catalyze the initial and critical step leading to replacing 5mC with unmethylated cytosine.
  • CpG methylation is part of the multifaceted epigenetic modifications of chromatin that shape cellular differentiation, gene expression, and maintenance of cellular homeostasis.
  • DNA methylation is a major mechanism in imprinting, tuning allelic expression of genes. Aberrant DNA methylation is implicated in various diseases including but not limited to cancer, imprinting disorders and neurological diseases (Robertson, K. D., DNA methylation and human disease . Nat Rev Genet, 2005. 6(8): p. 597-610).
  • a demethylation complex in one aspect, includes:
  • a method of demethylating a target nucleic acid sequence in a mammalian cell includes:
  • a demethylation complex in one aspect, includes:
  • a method of demethylating a target nucleic acid sequence in a mammalian cell includes:
  • a demethylation complex in one aspect, includes:
  • a method of demethylating a target nucleic acid sequence in a mammalian cell includes:
  • kits in another aspect, includes:
  • kits in another aspect, includes:
  • a cell including a demethylation complex as provided herein including embodiments thereof is provided.
  • FIGS. 1A-1D show that insertion of PUF binding site (PBS) sequences to sgRNA 3′-end did not substantially impact dCas9/sgRNA function, and that independent recruitment and multimerization of activators can be achieved using the subject 3-component CRISPR/Cas complex/system.
  • FIG. 1A is a schematic drawing showing the subject 3-component CRISPR/Cas complex/system (upper right), which improves the conventional two-hybrid dCas9 fusion design (upper left) by splitting it into a three-hybrid system, in which sgRNA-PBS bridges the DNA binding activity of dCas9/sgRNA with the effector function provided by a PUF fusion.
  • the middle panels represent the structure of a representative PUF (i.e., Pumilio /FBF) domain, showing the 8 repeats in the C to N direction and the corresponding interaction with the 8-mer target RNA in the 5′ to 3′ direction.
  • PUF RNA recognition code table shows exemplary di-residues and the corresponding RNA base recognized.
  • PBS PUF binding sites
  • 1B upper panel, is a schematic for the experiment to test the ability of dCas9-VP64 to bind and activate a tdTomato transgene after inserting varying number of PBS at the 3′ end of the sgRNA, e.g., experimental set up for testing the effect of sgRNA-PBS (with 0, 5, 15, 25, or 47 PBS) on the ability of the dCas9::VP64 construct to activate a TetO::tdTomato transgene.
  • the lower panel is column plot showing the mean fold changes ( ⁇ S.E.M.) in tdTomato fluorescence (relative to the dCas9-VP64/sgCtl-0 ⁇ PBSa control), as measured by fluorescence activated cell sorting (FACS), of cells transfected with the different constructs indicated in the legend below the plot.
  • the legend describes the sgRNA used in three parameters: sgRNA match refers to the DNA target recognized by the sgRNA; #PBS and PBS Type indicate the number and the types of PBS, respectively, appended to the end of the sgRNA.
  • FIG. 1C upper panel, is a schematic describing the experiment to test activation of a TetO::tdTomato transgene by the subject activator with different numbers of appended PBS.
  • the lower panel is a column plot showing the fold changes ( ⁇ S.E.M.) of tdTomato fluorescence (relative to control dCas9/PUFb-VP64/sgCtl-0 ⁇ PBSb) of cells transfected with the different constructs indicated in the legend blow the plot.
  • the legend describes the PUF isotype (PUF-VP64) used and the sgRNA-PBS used in terms of the number and type of PBS as well as the DNA target recognized by sgRNA indicated by shaded boxes.
  • 1D upper panel, is a schematic illustrating the experiment to test the independency of the subject activator isotypes in activating a TetO::tdTomato transgene.
  • the lower panel is a column plot showing the mean fold changes ( ⁇ S.E.M.) of tdTomato fluorescence (relative to the respective controls dCas9/PUFx-VP64/sgCtl-5 ⁇ PBSx for PUF/PBS isotype x) of cells transfected with the different constructs indicated in the legend below the plot.
  • PUF-VP64 the PUF isotype used (PUF-VP64), the PBS isotype (5 ⁇ PBS; “-” indicates sgRNA without PBS) and DNA target indicated by shaded boxes (sgRNA Match). All plots show results of three replicate measurements.
  • FIGS. 2A-2C relate to the assembly of the subject 3-component CRISPR/Cas complex/system comprising VP64 and P65-HSF1.
  • FIG. 2A is a schematic of the experiment testing the assembly of PUF(3-2)::VP64 and PUF(6-2/7-2)::P65-HSF1 via recruitment by sgRNA containing both PBS32 and PBS6272. The activity was measured by the tdTomato fluorescent reporter activity.
  • FIG. 2A is a schematic of the experiment testing the assembly of PUF(3-2)::VP64 and PUF(6-2/7-2)::P65-HSF1 via recruitment by sgRNA containing both PBS32 and PBS6272. The activity was measured by the tdTomato fluorescent reporter activity.
  • FIG. 2B is a column chart showing the relative mean tdTomato fluorescence resulting from transfecting the activator protein(s) with non-targeting (sgControl) and Tet-targeting (sgTetO) sgRNAs with 4 ⁇ [PBS32-PBS6272] heterodimer sites.
  • FIG. 2C shows comparison of the subject 3-component system activator using VP64 (PUFa::VP64) versus p65HSF1 (PUFa::p65HSF1) as the activation domain in conjunction with Control sgRNA with 5 ⁇ PBSa or TetO-targeting sgRNA with 0, 1, 5, 15, or 25 copies of PBSa.
  • FIGS. 3A-3C The figures show Casilio-ME outperforms dCas9-direct tethering system in delivering TET1(CD) to genomic loci and mediating gene activation.
  • FIG. 3A is a schematic representation of the hMLH1 promoter with regions of CpG hypermethylation shown by lollipops. Numbering of nucleotide is according to previous study reporting a strong association of hypermethylation in region C with hMLH1 silencing (Deng, G., et al., Methylation of CpG in a small region of the hMLH 1 promoter invariably correlates with the absence of gene expression . Cancer Res, 1999. 59(9): p. 2029-33).
  • FIG. 3B shows relative change in hMLH1 mRNA levels in cells transfected with Casilio components PUFa-TET1(CD), TET1(CD)-PUFa or PUFa-p65HSF1 and the combination of sgRNAs indicated by shaded boxes under the graph.
  • Drawings depict the Casilio system showing the effector modules used in each set of experiments and data were plotted that reflect the respective effector in application.
  • 3C shows relative change in hMLH1 mRNA levels in cells transfected with dCas9-tethered effectors dCas9-TET1(CD)C-terminal fusion, TET1(CD)-dCas9 N-terminal fusion or dCas9-p65HSF1 and the combination of sgRNAs indicated by shaded boxes under the graph.
  • Drawings depict the dCas9 fusion used for each set of experiments and data were plotted to reflect the respective effector used.
  • N i.e., N-terminus
  • C i.e., C-terminus
  • FIGS. 4A-4C The figures show that Casilio-ME mediates robust demethylation of methylcytosine via targeting TET1 activity to hMLH1 promoter region.
  • FIG. 4A is a time course of relative change in hMLH1 mRNA levels in cells transfected with Casilio components PUFa-TET1(CD) and the combination of sgRNAs indicated by shaded boxes under the graph. Drawing over the plot depicts the Casilio-ME system showing the carboxyterminal-TET1(CD) fusion module used and relative changes in hMLH1 mRNA levels were plotted against post-transfection time in which cells were harvested for analyses. Error bars indicate s.e.m derived from triplicate experiments.
  • FIG. 4A is a time course of relative change in hMLH1 mRNA levels in cells transfected with Casilio components PUFa-TET1(CD) and the combination of sgRNAs indicated by shaded boxes under the graph. Drawing over the plot depicts the Ca
  • FIG. 4B is Western blot analysis of protein extracted from indicated cell samples using anti-hMLH1 or anti-3 Actin monoclonal antibodies as shown. Proteins extracted form untransfected cells HEK293T (untreated) or treated with 2.5 ⁇ M 5′-Azacytidine (AzaC), HEK293 cells (293), and transfected HEK293T cells in the presence of a non-targeting control guide RNA (NTC) were analyzed in parallel with extracts from time course samples that were transfected with Casilio-Me components targeting the hMLH1 promoter region.
  • FIG. 4C shows frequency of cytosine to thymine bisulfite-mediated conversion of individual CpGs of the hMLH1 promoter region.
  • FIGS. 5A-5C The figures show that different configurations of Casilio-ME Dnmt effectors were tested.
  • FIG. 5A shows a direct fusions of C-terminal regions of (i) Dnmt3a, (ii) Dnmt3L, and (iii) Dnmt3a-3L (hybrid) to N-terminus of dCas9; (iv) Dnmt3a, (v) Dnmt3L, and (vi) Dnmt3a-3L hybrid to C-terminus of dCas9.
  • FIG. 5A shows a direct fusions of C-terminal regions of (i) Dnmt3a, (ii) Dnmt3L, and (iii) Dnmt3a-3L (hybrid) to N-terminus of dCas9; (iv) Dnmt3a, (v) Dnmt3L, and (vi) Dnmt3
  • FIG. 5B shows PUF effector fusion of C-terminal regions of (i) Dnmt3a, (ii) Dnmt3L, and (iii) Dnmt3a-3L to N-terminus of PUF domain; (iv) Dnmt3a, (v) Dnmt3L and (vi) Dnmt3a-3L to C-terminus of PUF domain.
  • FIG. 5C shows Casilio can potentially recruit different Dnmt effectors fused to different PUF domains via a guide containing the corresponding PBS.
  • FIGS. 6A-6B show SOX2 gene expression changes induced by targeting of Casilio-ME Dnmt modules to SOX2 promoter.
  • FIG. 6A shows relative SOX2 expression level in cells transfected with different dCas9-Dnmt enzymes and control guides or guides targeting SOX2 promoter.
  • FIG. 6B shows relative SOX2 expression level in cells transfected with different dCas9-Dnmt enzymes and control guides or guides targeting SOX2 promoter.
  • FIGS. 7A-7E show that GADD45A boosts Casilio-ME capability to impart TET1-mediated activation to methylation-silenced gene.
  • FIG. 7A depicts the Casilio and Casilio-ME platforms to show the various combinations of effector modules used in each set of experiment. Engineered protein fusions are shown with amino-termini and carboxyl-termini located at the left and right sides of each drawing respectively. The scaffold of the gRNA was altered to include 5 copies of PUFa or PUFa and PUFc binding sites.
  • FIG. 7B is a schematic representation of the hMLH1 promoter with regions of CpG hypermethylation shown by lollipops. Numbering of nucleotide is based on a strong association of hypermethylation in region C with hMLH1 silencing (Deng, Cancer Res. 59(9):2029-2033, 1999). sgRNAs designed around the hypermethylated region B and C are shown by numbers over short lines.
  • FIG. 7B is a schematic representation of the hMLH1 promoter with regions of CpG hypermethylation shown by lollipops. Numbering of nucleotide is based on a strong association of hypermethylation in region C with hMLH1 silencing (Deng, Cancer Res. 59(9):2029-2033, 1999). sgRNAs designed around the hypermethylated region B and C are shown by numbers over short lines.
  • FIG. 7C shows relative change in hMLH1 mRNA levels in HEK293T cells transfected with Casilio-ME components as indicated. Shaded boxes in the matrix under the graph indicate effectors and sgRNAs used in each experiment. Error bars indicate s.e.m derived from triplicate experiments.
  • FIG. 7D shows results of Western blot analysis of whole cell extracts from HEK293T cells transfected with the indicated Casilio-ME effector modules.
  • Lane 1-untransfected cells Lane 2-PUFa-GADD45A-TET1(CD); Lane 3-PUFa-GADDA45A-TET1(CD) with a slight variation in the Glycine-Serine linker; Lane 4-GADD45A-PUFa-TET1(CD); and Lane 5-PUFa-TET1(CD). 50 ⁇ g of protein were separated on 10% SDS-PAGE and immunoblotted with the indicated antibodies. Size marker in kDa is shown.
  • FIG. 7E shows relative change in hMLH1 mRNA levels in HEK293T cells transfected with Casilio-ME components as indicated.
  • FIG. 8A-8D NEIL2, but not NEIL1, NEIL3 or TDG, enhances Casilio-ME efficiency to deliver TET1-mediated activation to methylation-silenced gene.
  • FIG. 8A Drawings depict the Casilio-ME platform to show the PUFa-TET1(CD) effector and NEIL-based effector modules used in each experiment. For simplicity, NEIL1, NEIL2 and NEIL3 were depicted as NEIL. Engineered protein fusions are shown with amino and carboxyl termini located at the left and right sides of each drawing respectively. The shown gRNA scaffold was altered to include 5 copies of PUFa-binding sites (5 ⁇ PBSa).
  • Shapes are arbitrary drawn not to scale with NEIL1, NEIL2, and NEIL3 (NEIL), TET1(CD) (Ten eleven methylcytosine dioxygenase catalytic domain (1418 to 2136)), and PUFa are shown.
  • FIG. 8B Relative change in hMLH1 mRNA levels in HEK293T cells transfected with Casilio-ME components as indicated. Column shadings reflect different group of indicated PUFa fusions. Error bars indicate S.E.M derived from triplicate experiments.
  • FIG. 8C Drawings depict the Casilio-ME platform to show the PUFa-TET1(CD) and TDG-based PUFa fusions effectors used in each experiment.
  • Protein fusions are shown with amino and carboxyl termini located at the left and right sides of each drawing respectively.
  • the shown gRNA scaffold was altered to include 5 copies of PUFa-binding sites (5 ⁇ PBSa). Shapes are arbitrary drawn not to scale with TDG, TET1(CD) (Ten eleven methylcytosine dioxygenase catalytic domain (1418 to 2136)), and PUFa are shown.
  • FIG. 8D Relative change in hMLH1 mRNA levels in HEK293T cells transfected with Casilio-ME components as indicated. Column shadings reflect indicated PUFa fusions. Error bars indicate S.E.M. derived from triplicate experiments.
  • FIG. 9A-9B NEIL2 two-in-one effector enhances Casilio-ME efficiency to deliver TET1-mediated activation to methylation-silenced MLH1 gene.
  • FIG. 9A Drawings depict the Casilio-ME platform to show the PUFa-TET1(CD) effector and NEIL2-based effector modules used in each experiment. Protein fusions are shown with amino and carboxyl termini located at the left and right sides of each drawing respectively. The shown gRNA scaffold was altered to include 5 copies of PUFa-binding sites (5 ⁇ PBSa). Shapes are arbitrary drawn not to scale with NEIL2, TET1(CD), and PUFa are shown.
  • FIG. 9A Drawings depict the Casilio-ME platform to show the PUFa-TET1(CD) effector and NEIL2-based effector modules used in each experiment. Protein fusions are shown with amino and carboxyl termini located at the left and right sides of each drawing respectively. The shown gRNA scaffold was altered to include
  • FIG. 10A-10B Co-targeting of NEIL2 and TET1 effector modules robustly enhances TET1 mediated MLH1 activation.
  • FIG. 10A Drawings depict the Casilio-ME platform to show the PUFa-TET1(CD) effector and NEIL2 effector modules used in each experiment. Engineered protein fusions are shown with amino and carboxyl termini located at the left and right sides of each drawing respectively. The shown gRNA scaffold was altered to include 5 copies of PUFa and PUFc-binding sites (5 ⁇ PBSa and 5 ⁇ PBSc). Shapes are arbitrary drawn not to scale with NEIL2, TET1(CD), PUFa, and PUFc are shown.
  • FIG. 10A Drawings depict the Casilio-ME platform to show the PUFa-TET1(CD) effector and NEIL2 effector modules used in each experiment. Engineered protein fusions are shown with amino and carboxyl termini located at the left and right sides of each drawing respectively. The shown
  • FIG. 11A-11B TET1 mediated MLH1 activation without NEIL2 recruitment to target site.
  • FIG. 11A Drawings depict the Casilio-ME platform to show the PUFa-TET1(CD) effector and NEIL2 effector modules used in each experiment. Protein fusions are shown with amino and carboxyl termini located at the left and right sides of each drawing respectively. The shown gRNA scaffold was altered to include 5 copies of PUFa-binding sites (5 ⁇ PBSa) with no PUFc-binding site. Shapes are arbitrary drawn not to scale with NEIL2, TET1(CD), PUFa, and PUFc are shown.
  • FIG. 11A Drawings depict the Casilio-ME platform to show the PUFa-TET1(CD) effector and NEIL2 effector modules used in each experiment. Protein fusions are shown with amino and carboxyl termini located at the left and right sides of each drawing respectively. The shown gRNA scaffold was altered to include 5 copies of PUFa-binding sites
  • compositions and methods provided herein including embodiments thereof provide a methylation-editing (ME) platform allowing for targeted delivery of enhanced demethylation activity by delivering a TET demethylation domain (e.g., TET catalytic domain) or functional fragment thereof together with a demethylation enhancer domain (e.g., a GADD45A domain, a NEIL2 domain), to specific genomic loci, such as CpG islands, and thereby inducing enhanced demethylation DNA of said loci relative to the absence of said enhancer domain.
  • a TET demethylation domain e.g., TET catalytic domain
  • a demethylation enhancer domain e.g., a GADD45A domain, a NEIL2 domain
  • demethylation domains and demethylation enhancer domains provided herein may be delivered to a specific site in the genome of a mammalian cell by using a complex which includes a polynucleotide (e.g., guide RNA) bound to a nuclease-deficient DNA endonuclease (e.g., dCas9) and protein conjugates including a PUF domain, a demethylation domain (e.g., TET1 catalytic domain) and a demethylation enhancer domain (e.g., a GADD45A domain or a NEIL2 domain).
  • a polynucleotide e.g., guide RNA
  • a nuclease-deficient DNA endonuclease e.g., dCas9
  • protein conjugates including a PUF domain, a demethylation domain (e.g., TET1 catalytic domain) and a demethylation enhancer domain (e.g.,
  • the demethylation protein conjugate includes: (i) a PUF domain having a C-terminus and a N-terminus; (ii) a TET demethylation domain operably linked to the C-terminus of the PUF domain; and (iii) a demethylation enhancer domain operably linked to the N-terminus of the PUF domain, to form a protein conjugate, and the demethylation protein conjugate binds to the ribonucleoprotein complex via the PUF domain binding to the one or more PBS sequences to form a demethylation complex.
  • the demethylation protein conjugate includes (i) a PUF domain having a C-terminus; (ii) a demethylation enhancer domain, having a N-terminus and a C-terminus, wherein the N-terminus of the demethylation enhancer domain is operably linked to the C-terminus of the PUF domain; and (iii) a TET demethylation domain operably linked to the C-terminus of said demethylation enhancer domain; and the demethylation protein conjugate binds to the ribonucleoprotein complex via the PUF domain binding to the one or more PBS sequences to form a demethylation complex.
  • a demethylation protein conjugate includes (i) a first PUF domain having a C-terminus, and (ii) a TET demethylation domain operably linked to the C-terminus of the first PUF domain, wherein the demethylation protein conjugate binds to the ribonucleoprotein complex via the first PUF domain binding to the first PBS sequence; and a demethylation enhancer conjugate including (i) a second PUF domain; and (ii) a demethylation enhancer domain operably linked to the second PUF domain, wherein the demethylation enhancer conjugate binds to the ribonucleoprotein complex via the second PUF domain binding to the second PBS sequence to form a demethylation complex.
  • the demethylation enhancer domain may be linked to the same PUF domain as the demethylation domain (demethylation protein conjugate).
  • the demethylation enhancer domain may be connected to the guide RNA through a separate PUF domain (demethylation enhancer conjugate).
  • the demethylation complexes provided herein including embodiments thereof are based on a three-component hybrid system that includes CRISPR/Cas9 and Pumilio proteins.
  • the three-component hybrid system that includes CRISPR/Cas9 and Pumilio proteins may also be referred to interchangeably as the Casilio system, and the methylation-editing (ME) platform based on the Casilio system is sometimes referred to as Casilio-ME.
  • the demethylation domain e.g., TET demethylase
  • PAF domains Pumilio proteins or functional fragments thereof
  • compositions and methods provided herein including embodiments thereof are advantageous over the past attempts to modulate methylation status of a target gene by introducing a DNA demethylase into a target cell, in that the present invention allows for increased demethylation of the targeted gene locus by delivering a demethylation enzyme together with an enhancer of said demethylation enzyme.
  • Such system provides a superior demethylation activity to a target gene to alter the methylation status.
  • the demethylation efficiency of complexes including a TET demethylation domain can be significantly increased by including demethylation enhancers in the complex.
  • the present inventors discovered that the increase in demethylation efficiency upon inclusion of an enhancer domain depends on: (i) the type of enhancer protein present; (ii) the orientation in which the enhancer domain is linked to the PUF domain of the demethylation protein conjugate and (iii) the manner in which the demethylation enhancer domain is linked to the PUF domain and connected to the demethylation domain (e.g., from N- to C-terminus the conjugate may include a PUF domain linked to a demethylation enhancer domain linked to a demethylation domain, or a PUF domain linked to a demethylation domain linked to a demethylation enhancer domain).
  • Applicants have found that complexes where the demethylation domain (e.g., TET1 catalytic domain) is linked to the C-terminus of the PUF domain are significantly more effective relative to complexes with the demethylation domain (e.g., TET1 catalytic domain) linked to the N-terminus of the PUF domain.
  • C-terminal linked TET activity demethylation activity of TET1, TET2, or TET3
  • specific demethylation enhancers e.g., GADD45A, NEIL2
  • the enhancer is a NEIL glycosylase (e.g., NEIL1, NEIL2, or NEIL3)
  • NEIL1 NEIL2
  • NEIL3 NEIL3 glycosylase
  • a demethylation domain as referred to herein is a protein domain capable of demethylating a target nucleic acid.
  • the demethylation domain includes the catalytic domain of a demethylation enzyme (e.g., the catalytic domain of TET1).
  • the demethylation domain is the catalytic domain of a demethylation enzyme.
  • a “demethylation enhancer domain”, “demethylation enhancer protein” or “demethylation enhancer enzyme” as provided herein refers to a protein, protein domain or protein moiety capable of positively affecting (e.g. increasing) the activity or function of a demethylation enzyme or demethylation domain, relative to the activity or function of the demethylation enzyme or demethylation domain in the absence of the activator (e.g. demethylation enhancer domain described herein).
  • the demethylation enhancer domain may, at least in part, partially or totally increase stimulation, increase or enable activation, or activate the demethylation enzyme.
  • the amount of increase in activity may be 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100% or more in comparison to a control in the absence of the demethylation enhancer domain.
  • the activity is 1.5-fold, 2-fold, 3-fold, 4-fold, 5-fold, 10-fold, or more than the activity in the absence of the demethylation enhancer domain.
  • the demethylation enhancer domain increases demethylation of the TET demethylation domain by 2-, 3-, 4-, 5-, 6-, 7-, 8-, 9-, 10-, 11-, 12-, 13-, 14-, 15-, 16-, 17-, 18-, 19-, or 20-fold.
  • the demethylation enhancer domain increases demethylation of the TET demethylation domain at least by 2-, 3-, 4-, 5-, 6-, 7-, 8-, 9-, 10-, 11-, 12-, 13-, 14-, 15-, 16-, 17-, 18-, 19-, or 20-fold.
  • demethylation protein conjugates and demethylation enhancer conjugates useful for demethylating target loci in a cell.
  • the demethylation protein conjugates include a PUF domain described herein, a TET demethylation domain (e.g., a TET1 domain, a TET1 catalytic domain) linked to the C-terminus of the PUF domain and a demethylation enhancer domain (e.g., a NEIL2 domain or a GADD45A domain).
  • the demethylation enhancer domain may be linked to the N-terminus or the C-terminus of the PUF domain.
  • the demethylation enhancer domain is linked to the N-terminus of the PUF domain the TET demethylation domain and the demethylation enhancer domain are not directly linked, but connected through the PUF domain.
  • the demethylation enhancer domain is linked to the C-terminus of the PUF domain it connects the PUF domain to the TET demethylation domain.
  • the C-terminus of the PUF domain is linked to the demethylation enhancer domain and the C-terminus of the demethylation enhancer domain is linked to the TET demethylation domain.
  • the complexes provided herein may include a demethylation protein conjugate including a first PUF domain and a demethylation domain (e.g., a TET1 domain), wherein the TET demethylation domain is linked to the C-terminus of the PUF domain, and a demethylation enhancer conjugate including a second PUF domain and a demethylation enhancer domain (e.g., a NEIL2 domain or a GADD45A domain).
  • a demethylation protein conjugate including a first PUF domain and a demethylation domain (e.g., a TET1 domain), wherein the TET demethylation domain is linked to the C-terminus of the PUF domain
  • a demethylation enhancer conjugate including a second PUF domain and a demethylation enhancer domain (e.g., a NEIL2 domain or a GADD45A domain).
  • the demethylation enhancer domain is operably linked to the N-terminus of the PUF domain. In certain embodiments, the demethylation enhancer domain is operably linked to the C-terminus of the PUF domain. In certain embodiments, the demethylation enhancer domain is operably linked to the N-terminus of the second PUF domain. In certain embodiments, the demethylation enhancer domain is operably linked to the C-terminus of the second PUF domain.
  • the demethylation enhancer domain is a Growth Arrest and DNA-Damage-inducible Alpha (GADD45A) domain.
  • the GADD45 domain has the amino acid sequence of SEQ ID NO:85.
  • the demethylation enhancer domain is a NEIL2 domain.
  • the NEIL2 domain has the amino acid sequence of SEQ ID NO:86.
  • the demethylation enhancer domain is not a NEIL1 domain. In certain embodiments, the demethylation enhancer domain is not a NEIL3 domain.
  • demethylation conjugates e.g., demethylation protein conjugate, demethylation enhancer conjugate
  • demethylation conjugates including (i) a PUF domain operably linked to a demethylation domain and a demethylation enhancer domain (demethylation protein conjugate), (ii) a first PUF domain operably linked to a demethylation domain (demethylation protein conjugate) or (iii) a second PUF domain operably linked to a demethylation enhancer domain, respectively (demethylation enhancer conjugate).
  • a demethylation protein conjugate as provided herein includes (i) a PUF domain linked to demethylation domain and a demethylation enhancer domain or (ii) a first PUF domain linked to a demethylation domain.
  • a demethylation enhancer domain includes a second PUF domain linked to a demethylation enhancer domain.
  • the demethylation domain is operably linked to the C-terminus of the PUF domain to form a protein conjugate.
  • the demethylation enhancer domain may be linked to the C-terminus of the PUF domain, to the N-terminus of the PUF domain, or the demethylation enhancer domain may bind the polynucleotide (e.g., gRNA) linked to a separate PUF domain (i.e., a PUF domain not linked to the demethylation domain).
  • the demethylation domain forms part of a demethylation protein conjugate and is linked to a first PUF domain
  • the demethylation enhancer domain forms part of a demethylation enhancer protein conjugate and is linked to a second PUF domain.
  • the demethylation protein conjugate binds the polynucleotide through binding of the first PUF domain to the first PBS sequence and the demethylation enhancer protein conjugate binds the polynucleotide through binding of the second PUF domain to the second PBS sequence.
  • a demethylation complex includes:
  • a demethylation complex in one aspect, includes:
  • a demethylation complex in one aspect, includes:
  • the TET demethylation domain is a TET1 domain (i.e., TET1 catalytic domain), a TET2 domain (i.e., TET2 catalytic domain) or a TET3 domain (i.e., TET3 catalytic domain).
  • the TET demethylation domain is a TET1 domain.
  • the TET demethylation domain is a TET2 domain.
  • the TET demethylation domain is a TET3 domain.
  • the TET demethylation domain is a TET1 catalytic domain.
  • the TET demethylation domain is a TET2 catalytic domain.
  • the TET demethylation domain is a TET3 catalytic domain. In certain embodiments, the TET1 domain has the sequence of SEQ ID NO:51. In certain embodiments, the demethylation enhancer domain is a Growth Arrest and DNA-Damage-inducible Alpha (GADD45A) domain. In certain embodiments, the GADD45 domain has the amino acid sequence of SEQ ID NO:85. In certain embodiments, the demethylation enhancer domain is a NEIL2 domain. In certain embodiments, the NEIL2 domain has the amino acid sequence of SEQ ID NO:86.
  • a “ribonucleoprotein complex” as provided herein refers to a complex including a nucleoprotein and a ribonucleic acid.
  • a “nucleoprotein” as provided herein refers to a protein capable of binding a nucleic acid (e.g., RNA, DNA). Where the nucleoprotein binds a ribonucleic acid it is referred to as “ribonucleoprotein.”
  • the interaction between the ribonucleoprotein and the ribonucleic acid may be direct, e.g., by covalent bond, or indirect, e.g., by non-covalent bond (e.g. electrostatic interactions (e.g.
  • the ribonucleoprotein includes an RNA-binding motif non-covalently bound to the ribonucleic acid.
  • positively charged aromatic amino acid residues e.g., lysine residues
  • the RNA-binding motif may form electrostatic interactions with the negative nucleic acid phosphate backbones of the RNA, thereby forming a ribonucleoprotein complex.
  • Non-limiting examples of ribonucleoproteins include ribosomes, telomerase, RNAseP, hnRNP, CRISPR associated protein 9 (Cas9) and small nuclear RNPs (snRNPs).
  • the ribonucleoprotein may be an enzyme.
  • the ribonucleoprotein is an endonuclease.
  • the ribonucleoprotein is a nuclease-deficient RNA-guided DNA endonuclease enzyme.
  • the ribonucleoprotein complex includes an nuclease-deficient RNA-guided DNA endonuclease enzyme and a ribonucleic acid.
  • the nuclease-deficient RNA-guided DNA endonuclease enzyme includes a nuclear localization signal (NLS).
  • the nuclear localization signal (NLS) provided herein provides for nuclear transport of the protein domain or protein, for example the nuclease-deficient RNA-guided DNA endonuclease enzyme, the NLS is linked to.
  • the nuclease-deficient RNA-guided DNA endonuclease enzyme is nuclease-deficient CRISPR associated protein 9 (dCas9). In certain embodiments, the nuclease-deficient RNA-guided DNA endonuclease enzyme is nuclease-deficient Clustered Regularly Interspaced Short Palindromic Repeats from Prevotella and Francisella 1 (Cpfl).
  • the polynucleotide provided herein includes (1) a DNA-targeting sequence that is complementary to a target polynucleotide sequence, (2) a binding sequence for the nuclease-deficient RNA-guided DNA endonuclease enzyme (e.g., dCas9), and (3) one or more PUF binding site (PBS) sequences (e.g., a first (3) and a second (4) PBS sequence).
  • the complex includes dCas9 bound to the polynucleotide thereby forming a ribonucleoprotein complex.
  • the polynucleotide is a ribonucleic acid.
  • the polynucleotide is a guide RNA.
  • a “guide RNA” or “gRNA” as provided herein refers to a ribonucleotide sequence capable of binding a nucleoprotein, thereby forming ribonucleoprotein complex.
  • the polynucleotide (e.g., gRNA) is a single-stranded ribonucleic acid. In certain embodiments, the polynucleotide (e.g., gRNA) is 10, 20, 30, 40, 50, 60, 70, 80, 90, 100 or more nucleic acid residues in length. In certain embodiments, the polynucleotide (e.g., gRNA) is from 10 to 30 nucleic acid residues in length. In certain embodiments, the polynucleotide (e.g., gRNA) is 20 nucleic acid residues in length.
  • the length of the polynucleotide can be at least 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100 or more nucleic acid residues or sugar residues in length.
  • the polynucleotide (e.g., gRNA) is from 5 to 50, 10 to 50, 15 to 50, 20 to 50, 25 to 50, 30 to 50, 35 to 50, 40 to 50, 45 to 50, 5 to 75, 10 to 75, 15 to 75, 20 to 75, 25 to 75, 30 to 75, 35 to 75, 40 to 75, 45 to 75, 50 to 75, 55 to 75, 60 to 75, 65 to 75, 70 to 75, 5 to 100, 10 to 100, 15 to 100, 20 to 100, 25 to 100, 30 to 100, 35 to 100, 40 to 100, 45 to 100, 50 to 100, 55 to 100, 60 to 100, 65 to 100, 70 to 100, 75 to 100, 80 to 100, 85 to 100, 90 to 100, 95 to 100, or more residues in length.
  • the polynucleotide (e.g., gRNA) is from 10 to 15, 10 to 20, 10 to 30, 10 to 40, or 10 to 50 residues in length.
  • transcription of the polynucleotide is under the control of a constitutive promoter, such as a CMV promoter or a Ubc promoter, or an inducible promoter, such as a tetracycline-responsive promoter or a steroid-responsive promoter.
  • a constitutive promoter such as a CMV promoter or a Ubc promoter
  • an inducible promoter such as a tetracycline-responsive promoter or a steroid-responsive promoter.
  • the polynucleotide is a vector.
  • the vector encoding the polynucleotide (for use in the methods of the invention) is active in a cell from a mammal (a human; a non-human primate; a non-human mammal; a rodent such as a mouse, a rat, a hamster, a guinea pig; a livestock mammal such as a pig, a sheep, a goat, a horse, a camel, cattle; or a pet mammal such as a cat or a dog); a bird, a fish, an insect, a worm, a yeast, or a bacterium.
  • a mammal a human; a non-human primate; a non-human mammal; a rodent such as a mouse, a rat, a hamster, a guinea pig; a livestock mammal such as a pig, a sheep, a goat, a horse, a camel, cattle; or
  • the vector is a plasmid, a viral vector (such as adenoviral, retroviral, or lentiviral vector, or AAV vector), or a transposon (such as piggyBac transposon).
  • the vector can be transiently transfected into a host cell, or be integrated into a host genome by infection or transposition.
  • the polynucleotide includes a nucleotide sequence complementary to a target site (e.g., target polynucleotide sequence), which is referred to herein as “DNA-targeting sequence.”
  • the DNA-targeting sequence may mediate binding of the ribonucleoprotein complex to a complementary target polynucleotide sequence thereby providing the sequence specificity of the ribonucleoprotein complex.
  • the polynucleotide e.g., gRNA
  • the polynucleotide e.g., gRNA
  • the polynucleotide binds a target polynucleotide sequence.
  • the complement of the polynucleotide has a sequence identity of 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% to the target polynucleotide sequence.
  • the complement of the DNA-targeting sequence has a sequence identity of 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% to the target polynucleotide sequence.
  • the DNA-targeting sequence may or may not be 100% complementary to the target polynucleotide sequence.
  • the DNA-targeting sequence is complementary to the target polynucleotide sequence over 8-25 nucleotides (nts), 12-22 nucleotides, 14-20 nts, 16-20 nts, 18-20 nts, or 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, or 25 nts.
  • the complementary region comprises a continuous stretch of 12-22 nts, preferably at the 3′ end of the DNA-targeting sequence.
  • the 5′ end of the DNA-targeting sequence has up to 8 nucleotide mismatches with the target polynucleotide sequence.
  • the DNA-binding sequence is 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, or 100% complementary to the target polynucleotide sequence.
  • nuclease-deficient RNA-guided DNA endonuclease in the complex is a nuclease-deficient wildtype Cas9 protein (nuclease-deficient wt Cas9 protein) which, under the circumstance, binds but does not cut a target DNA (e.g., dCas9 protein).
  • the nuclease-deficient RNA-guided DNA endonuclease is a nuclease-deficient Clustered Regularly Interspaced Short Palindromic Repeats from Prevotella and Francisella 1 (Cpfl).
  • the DNA-targeting sequence is functionally similar or equivalent to the crRNA or guide RNA or gRNA of the CRISPR/Cas complex/system.
  • the DNA-targeting sequence may not originate from any particular crRNA or gRNA, but can be arbitrarily designed based on the sequence of the target polynucleotide sequence.
  • the DNA-targeting sequence includes a nucleotide sequence that is complementary to a specific sequence within a target DNA (or the complementary strand of the target DNA).
  • the DNA-targeting sequence interacts with a target polynucleotide sequence of the target DNA in a sequence-specific manner via hybridization (i.e., base pairing).
  • the nucleotide sequence of the DNA-targeting sequence may vary, and it determines the location within the target DNA that the subject polynucleotide and the target DNA will interact.
  • the DNA-targeting sequence can be modified or designed (e.g., by genetic engineering) to hybridize to any desired sequence within the target DNA.
  • the target polynucleotide sequence is immediately 3′ to a PAM (protospacer adjacent motif) sequence of the complementary strand, which can be 5′-CCN-3′, wherein N is any DNA nucleotide. That is, in this embodiment, the complementary strand of the target polynucleotide sequence is immediately 5′ to a PAM sequence that is 5′-NGG-3′, wherein N is any DNA nucleotide.
  • the PAM sequence of the complementary strand matches the nuclease-deficient wt Cas9 protein or dCas9.
  • the DNA-targeting sequence can have a length of from 12 nucleotides to 100 nucleotides.
  • the DNA-targeting sequence can have a length of from 12 nucleotides (nt) to 80 nt, from 12 nt to 50 nt, from 12 nt to 40 nt, from 12 nt to 30 nt, from 12 nt to 25 nt, from 12 nt to 20 nt, or from 12 nt to 19 nt.
  • the DNA-targeting sequence can have a length of from 19 nt to 20 nt, from 19 nt to 25 nt, from 19 nt to 30 nt, from 19 nt to 35 nt, from 19 nt to 40 nt, from 19 nt to 45 nt, from 19 nt to 50 nt, from 19 nt to 60 nt, from 19 nt to 70 nt, from 19 nt to 80 nt, from 19 nt to 90 nt, from 19 nt to 100 nt, from 20 nt to 25 nt, from 20 nt to 30 nt, from 20 nt to 35 nt, from 20 nt to 40 nt, from 20 nt to 45 nt, from 20 nt to 50 nt, from 20 nt to 60 nt, from 20 nt to 70 nt, from 20 nt to 80 nt, from 20 nt to 90 n, from
  • the nucleotide sequence of the DNA-targeting sequence that is complementary to a target polynucleotide sequence of the target DNA can have a length of at least 12 nt.
  • the DNA-targeting sequence that is complementary to a target polynucleotide sequence of the target DNA can have a length at least 12 nt, at least 15 nt, at least 18 nt, at least 19 nt, at least 20 nt, at least 25 nt, at least 30 nt, at least 35 nt or at least 40 nt.
  • the DNA-targeting sequence that is complementary to a target polynucleotide sequence of a target DNA can have a length of from 12 nucleotides (nt) to 80 nt, from 12 nt to 50 nt, from 12 nt to 45 nt, from 12 nt to 40 nt, from 12 nt to 35 nt, from 12 nt to 30 nt, from 12 nt to 25 nt, from 12 nt to 20 nt, from 12 nt to 19 nt, from 19 nt to 20 nt, from 19 nt to 25 nt, from 19 nt to 30 nt, from 19 nt to 35 nt, from 19 nt to 40 nt, from 19 nt to 45 nt, from 19 nt to 50 nt, from 19 nt to 60 nt, from 20 nt to 25 nt, from 20 nt to 30 nt, from 20 nt, from
  • the DNA-targeting sequence that is complementary to a target polynucleotide sequence of the target DNA is 20 nucleotides in length. In some cases, the DNA-targeting sequence that is complementary to a target polynucleotide sequence of the target DNA is 19 nucleotides in length.
  • the percent complementarity between the DNA-targeting sequence and the target polynucleotide sequence of the target DNA can be at 50% (e.g., at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 97%, at least 98%, at least 99%, or 100%). In some cases, the percent complementarity between the DNA-targeting sequence and the target polynucleotide sequence is 100% over the seven or eight contiguous 5′-most nucleotides of the target polynucleotide sequence.
  • the percent complementarity between the DNA-targeting sequence and the target polynucleotide sequence is at least 60% over 20 contiguous nucleotides. In some cases, the percent complementarity between the DNA-targeting sequence and the target polynucleotide sequence is 100% over the 7, 8, 9, 10, 11, 12, 13, or 14 contiguous 5′-most nucleotides of the target polynucleotide sequence (i.e., the 7, 8, 9, 10, 11, 12, 13, or 14 contiguous 3′-most nucleotides of the DNA-targeting sequence), and as low as 0% over the remainder. In such a case, the DNA-targeting sequence can be considered to be 7, 8, 9, 10, 11, 12, 13, or 14 nucleotides in length, respectively.
  • a “target polynucleotide sequence” as provided herein is a nucleic acid sequence expressed by a cell.
  • the target polynucleotide sequence is an exogenous nucleic acid sequence.
  • the target polynucleotide sequence is an endogenous nucleic acid sequence.
  • the target polynucleotide sequence forms part of a cellular gene.
  • the target polynucleotide sequence is part of a gene.
  • the target polynucleotide sequence is part of a Sox gene.
  • the target polynucleotide sequence is part of a transcriptional regulatory sequence.
  • the target polynucleotide sequence is part of a promoter, enhancer or silencer. In certain embodiments, the target polynucleotide sequence is a hypermethylated nucleic acid sequence. In certain embodiments, the target polynucleotide sequence is a hypermethylated CpG sequence. In certain embodiments, the target polynucleotide sequence is part of an hMLH1 promoter.
  • the target sequence is an RNA.
  • the target sequence is a DNA.
  • the first segment is generally referred to as the “DNA-targeting sequence” when the target sequence is a DNA (such as a genomic DNA).
  • the description herein below applies generally as well except that the reference to “DNA-targeting sequence” is replaced with “RNA-targeting sequence,” in order to avoid redundancy. That is, the polynucleotide includes a nucleotide sequence complementary to the target polynucleotide sequence (DNA or RNA).
  • the three segments (1)-(3) are arranged, in that order, from 5′ to 3′. In certain embodiments, the three segments (1)-(4) are arranged, in that order, from 5′ to 3′.
  • the polynucleotide of the invention can be a single RNA molecule (single RNA polynucleotide), which may include a “single-guide RNA,” or “sgRNA.”
  • the polynucleotide of the invention includes two RNA molecules (e.g., joined together via hybridization at the binding sequence (e.g., nuclease-deficient wt Cas9 protein- or dCas9-binding sequence)).
  • the subject polynucleotide is inclusive, referring both to two-molecule polynucleotides and to single-molecule polynucleotides (e.g., sgRNAs).
  • the target polynucleotide sequence is at, near, or within a promoter sequence. In certain embodiments, the target polynucleotide sequence is within a CpG island. In certain embodiments, the target polynucleotide sequence is known to be associated with a disease or condition characterized by DNA hypo- or hyper-methylation. In certain embodiments, the target polynucleotide sequence is within a tumor suppressor gene or an oncogene, such as within a transcriptional regulatory sequence/element of the tumor suppressor gene or oncogene.
  • the target polynucleotide sequence is immediately 3′ to a PAM (protospacer adjacent motif) sequence of the target polynucleotide sequence.
  • the PAM sequence of the target polynucleotide sequence is 5′-CCN-3′, wherein N is any DNA nucleotide.
  • the PAM sequence of the target polynucleotide sequence matches the specific nuclease-deficient wt Cas9 protein or dCas9 protein or homologs or orthologs to be used.
  • the target polynucleotide sequence in the genomic DNA must be complementary to the guide RNA sequence and must be immediately followed by the correct protospacer adjacent motif or PAM sequence.
  • the PAM sequence is present in the target polynucleotide sequence but not in the guide RNA sequence. Any DNA sequence with the correct target polynucleotide sequence followed by the PAM sequence will be bound by nuclease-deficient wt Cas9 protein or dCas9 protein.
  • the PAM sequence is any of the PAM sequences disclosed in international application PCT/US2016/021491 and published as WO2016148994 A8, which is hereby incorporated by reference and for all purposes.
  • the polynucleotide (e.g., gRNA) is 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% to the target polynucleotide sequence.
  • the polynucleotide (e.g., gRNA) is 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% complementary to the sequence of a cellular gene.
  • the polynucleotide (e.g., gRNA) binds a cellular gene sequence.
  • the complex includes dCas9 bound to the polynucleotide through binding a binding sequence of the polynucleotide and thereby forming a ribonucleoprotein complex.
  • the binding sequence forms a hairpin structure.
  • the binding sequence is 30-100 nt, 35-50 nt, 37-47 nt, or 42 nt in length.
  • An exemplary binding sequence is the sequence of SEQ ID NO:6 GTTTTAGAGCTAGAAATAGCAAGTTAAAATAAGGCTA.
  • Another exemplary binding sequence is the sequence of SEQ ID NO:7 GTTTAAGAGCTATGCTGGAAACAGCATAGCAAGTTTAAATAAGGCTA.
  • the binding sequence includes the sequence of SEQ ID NO: 6. In certain embodiments, the binding sequence includes the sequence of SEQ ID NO: 7. In certain embodiments, the binding sequence is the sequence of SEQ ID NO: 6. In certain embodiments, the binding sequence is the sequence of SEQ ID NO: 7.
  • the binding sequence (protein-binding segment or protein-binding sequence) of the subject polynucleotide binds to a modified dCas9 protein (e.g., nuclease-deficient nickase or dCas9) which has reduced endonuclease activity, or lacks endonuclease activity.
  • a modified dCas9 protein e.g., nuclease-deficient nickase or dCas9
  • the binding sequence (protein-binding segment or protein-binding sequence) which may bind to modified Cas9 proteins (e.g., dCas9 protein) may simply be referred to as “Cas9-binding sequence” or “binding sequence” herein.
  • the binding sequence (Cas9-binding sequence) of the invention binds to a dCas9, it is not prevented from binding to a wt Cas9 or a Cas9 nickase.
  • the binding sequence (Cas9-binding sequence) of the invention binds to dCas9 as well as wt Cas9 and/or Cas9 nickase.
  • the binding sequence interacts with or binds to a Cas9 protein (e.g., nuclease-deficient wt Cas9 protein, or dCas9 protein), and together they bind to the target polynucleotide sequence recognized by the DNA-targeting sequence.
  • the binding sequence includes two complementary stretches of nucleotides that hybridize to one another to form a double stranded RNA duplex (a dsRNA duplex).
  • nucleotides may be covalently linked by intervening nucleotides known as linkers or linker nucleotides (e.g., in the case of a single-molecule polynucleotide), and hybridize to form the double stranded RNA duplex (dsRNA duplex, or “Cas9-binding hairpin”) of the binding sequence (Cas9-binding sequence), thus resulting in a stem-loop structure.
  • linkers or linker nucleotides e.g., in the case of a single-molecule polynucleotide
  • Cas9-binding hairpin double stranded RNA duplex
  • the two complementary stretches of nucleotides may not be covalently linked, but instead are held together by hybridization between complementary sequences (e.g., in the case of a two-molecule polynucleotide of the invention).
  • the binding sequence can have a length of from 10 nucleotides to 100 nucleotides, e.g., from 10 nucleotides (nt) to 20 nt, from 20 nt to 30 nt, from 30 nt to 40 nt, from 40 nt to 50 nt, from 50 nt to 60 nt, from 60 nt to 70 nt, from 70 nt to 80 nt, from 80 nt to 90 nt, or from 90 nt to 100 nt.
  • 10 nucleotides (nt) to 20 nt from 20 nt to 30 nt, from 30 nt to 40 nt, from 40 nt to 50 nt, from 50 nt to 60 nt, from 60 nt to 70 nt, from 70 nt to 80 nt, from 80 nt to 90 nt, or from 90 nt to 100 nt.
  • the Cas9-binding sequence can have a length of from 15 nucleotides (nt) to 80 nt, from 15 nt to 50 nt, from 15 nt to 40 nt, from 15 nt to 30 nt, from 37 nt to 47 nt (e.g., 42 nt), or from 15 nt to 25 nt.
  • the dsRNA duplex of the binding sequence can have a length from 6 base pairs (bp) to 50 bp.
  • the dsRNA duplex of the binding sequence can have a length from 6 bp to 40 bp, from 6 bp to 30 bp, from 6 bp to 25 bp, from 6 bp to 20 bp, from 6 bp to 15 bp, from 8 bp to 40 bp, from 8 bp to 30 bp, from 8 bp to 25 bp, from 8 bp to 20 bp or from 8 bp to 15 bp.
  • the dsRNA duplex of the binding sequence can have a length from 8 bp to 10 bp, from 10 bp to 15 bp, from 15 bp to 18 bp, from 18 bp to 20 bp, from 20 bp to 25 bp, from 25 bp to 30 bp, from 30 bp to 35 bp, from 35 bp to 40 bp, or from 40 bp to 50 bp.
  • the dsRNA duplex of the binding sequence (Cas9-binding sequence) has a length of 36 base pairs.
  • the percent complementarity between the nucleotide sequences that hybridize to form the dsRNA duplex of the binding sequence can be at least 60%.
  • the percent complementarity between the nucleotide sequences that hybridize to form the dsRNA duplex of the binding sequence can be at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, or at least 99%.
  • the percent complementarity between the nucleotide sequences that hybridize to form the dsRNA duplex of the binding sequence is 100%.
  • the polynucleotide further includes a linker sequence linking the DNA-targeting sequence to the binding sequence (Cas9-binding sequence).
  • the linker can have a length of from 3 nucleotides to 100 nucleotides.
  • the linker can have a length of 3 nucleotides (nt) to 90 nt, from 3 nucleotides (nt) to 80 nt, from 3 nucleotides (nt) to 70 nt, from 3 nucleotides (nt) to 60 nt, from 3 nucleotides (nt) to 50 nt, from 3 nucleotides (nt) to 40 nt, from 3 nucleotides (nt) to 30 nt, from 3 nucleotides (nt) to 20 nt or from 3 nucleotides (nt) to 10 nt.
  • the linker can have a length of from 3 nt to 5 nt, from 5 nt to 10 nt, from 10 nt to 15 nt, from 15 nt to 20 nt, from 20 nt to 25 nt, from 25 nt to 30 nt, from 30 nt to 35 nt, from 35 nt to 40 nt, from 40 nt to 50 nt, from 50 nt to 60 nt, from 60 nt to 70 nt, from 70 nt to 80 nt, from 80 nt to 90 nt, or from 90 nt to 100 nt.
  • the linker is 4 nt.
  • Non-limiting examples of nucleotide sequences that can be included in a suitable binding sequence are set forth in SEQ ID NOs: 563-682 of WO 2013/176772 (see, for examples, FIGS. 8 and 9 of WO 2013/176772), which is hereby incorporated by reference in its entirety and for all purposes.
  • a suitable binding sequence includes a nucleotide sequence that differs by 1, 2, 3, 4, or 5 nucleotides from any one of the above-listed sequences.
  • PBS Pumilio /fem-3 mRNA binding factor
  • a PUF binding site may form part of a guide RNA and provide for the binding of a PUF protein or PUF domain as provided herein (e.g., PUFa, PUFb, PUFc or functional fragments thereof) to said guide RNA.
  • the PUF binding site includes a nucleic acid sequence (i.e., a PBS sequence or PUF binding site sequence) which is characteristic of the PBS and may be bound directly by the PUF protein.
  • the polynucleotide (e.g., gRNA) provided herein further includes one or more PUF binding site (PBS) sequences.
  • the demethylation complex includes the demethylation enhancer domain linked to a different PUF domain than the demethylation domain. Therefore, the demethylation domain may be bound to the polynucleotide through a first PUF domain binding a first PBS sequence and the demethylation enhancer domain may be bound to the polynucleotide through a second PUF domain bound to a second PBS sequence.
  • the first and the second PBS sequence may be different or may be the same.
  • the one or more PBS sequences (e.g., first or second PBS sequence) contain 8 nucleotides in length.
  • the one or more PBS sequences are identical.
  • the polynucleotide includes 1 to 50 PBS sequences.
  • one or more PBS sequences (e.g., first or second PBS sequence) comprise the nucleotide sequence of SEQ ID NO: 1. Any one of the PBS sequences (e.g., first or second PBS sequence) disclosed in international application PCT/US2016/021491 and published as WO2016148994 A8, which is hereby incorporated by reference in its entirety and for all purposes, are contemplated for the compositions and methods provided herein.
  • each of the one or more PBS sequences has 8 nucleotides.
  • One exemplary PBS sequence may have a sequence of SEQ ID NO:8 (5′-UGUAUGUA-3′), which can be bound by the PUF domain PUF(3-2).
  • Another exemplary PBS may have a sequence of SEQ ID NO:9 (5′-UUGAUAUA-3′), which can be bound by the PUF domain PUF(6-2/7-2). Additional PBS sequences and the corresponding PUF domains are described in international application PCT/US2016/021491 and published as WO2016148994 A8, which is hereby incorporated by reference in its entirety and for all purposes.
  • the polynucleotide of the invention may have more than one copy of the PBS sequences.
  • the polynucleotide comprises 1, 2, 3, 4, 5, 10, 15, 20, 25, 30, 35, 40, 45, 46, 47, 48, 49, or 50 copies of PBS sequences, such as 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15 copies of PBS sequences.
  • the range of the PBS sequence copy number is L to H, wherein L is any one of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 20, 25, 30, 35, or 40, and wherein H is any one of 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 80, 90, or 100, so long as H is greater than L.
  • L is any one of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 20, 25, 30, 35, or 40
  • H is any one of 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 80, 90, or 100, so long as H is greater than L.
  • Each PBS sequence may be the same or different.
  • the polynucleotide includes 1, 2, 3, 4, 5, 10, 15, 20, 25, 30, 35, 40, 45, 46, 47, 48, 49, or 50 copies, or 1-50, 2-45, 3-40, 5-35, 5-10, 10-20 copies of identical or different PBS sequences.
  • the polynucleotide includes 5-15 copies of PBS sequences, or 5-14 copies, 5-13 copies, 5-12 copies, 5-11 copies, 5-10 copies, or 5-9 copies of PBS sequences.
  • the amount of the gRNA-PBS sequences and/or the amount of the protein conjugate (methylation or demethylation protein conjugate) transfected or expressed is adjusted to maximize PBS/PUF domain binding. For example, this can be achieved by increasing the expression of the PUF domain by a stronger promoter or using an inducible promoter, such as a Dox-inducible promoter.
  • the spacing between PBS sequences and/or spacer sequences are optimized to improve system efficiency.
  • spacing optimization can be subject to particular protein conjugates (methylation or demethylation protein conjugates), and can be different between protein conjugates (methylation or demethylation protein conjugate) that work as individual proteins and those protein conjugates (methylation or demethylation protein conjugate) that may need to be positioned close enough to function (e.g., protein complexes).
  • one or more spacer region(s) separate two adjacent PBS sequences.
  • the spacer regions may have a length of from 3 nucleotides to 100 nucleotides.
  • the spacer can have a length of from 3 nucleotides (nt) to 90 nt, from 3 nucleotides (nt) to 80 nt, from 3 nucleotides (nt) to 70 nt, from 3 nucleotides (nt) to 60 nt, from 3 nucleotides (nt) to 50 nt, from 3 nucleotides (nt) to 40 nt, from 3 nucleotides (nt) to 30 nt, from 3 nucleotides (nt) to 20 nt or from 3 nucleotides (nt) to 10 nt.
  • the spacer can have a length of from 3 nt to 5 nt, from 5 nt to 10 nt, from 10 nt to 15 nt, from 15 nt to 20 nt, from 20 nt to 25 nt, from 25 nt to 30 nt, from 30 nt to 35 nt, from 35 nt to 40 nt, from 40 nt to 50 nt, from 50 nt to 60 nt, from 60 nt to 70 nt, from 70 nt to 80 nt, from 80 nt to 90 nt, or from 90 nt to 100 nt.
  • the spacer is 4 nt.
  • the PBS sequence includes the sequence of SEQ ID NO: 1, SEQ ID NO:8, SEQ ID NO:9, SEQ ID NO:10, SEQ ID NO:11, SEQ ID NO:12, SEQ ID NO:13, SEQ ID NO:14, SEQ ID NO:15, SEQ ID NO:16, SEQ ID NO:17, or SEQ ID NO:27.
  • the PBS sequence is the sequence of SEQ ID NO: 1, SEQ ID NO:8, SEQ ID NO:9, SEQ ID NO:10, SEQ ID NO:11, SEQ ID NO:12, SEQ ID NO:13, SEQ ID NO:14, SEQ ID NO:15, SEQ ID NO:16, SEQ ID NO:17, or SEQ ID NO:27.
  • the first or the second PBS sequence contains 8 nucleotides in length. In certain embodiments, the first or the second PBS sequences includes the nucleotide sequence of SEQ ID NO:1.
  • PUF proteins (named after Drosophila Pumilio and C. elegans fern-3 binding factor) are known to be involved in mediating mRNA stability and translation. These proteins contain a unique RNA-binding domain known as the PUF domain.
  • the RNA-binding PUF domain such as that of the human Pumilio 1 protein (referred here also as PUM), contains 8 repeats (each repeat called a PUF motif or a PUF repeat) that bind consecutive bases in an anti-parallel fashion, with each repeat recognizing a single base—i.e., PUF repeats R1 to R8 recognize nucleotides N8 to Ni, respectively.
  • PUM is composed of eight tandem repeats, each repeat consisting of 34 amino acids that folds into tightly packed domains composed of alpha helices.
  • the complexes provided herein including embodiments thereof include demethylation protein conjugates (e.g., demethylation protein conjugate, demethylation enhancer conjugate) including (i) a PUF domain operably linked to a demethylation domain and a demethylation enhancer domain or (ii) a first PUF domain operably linked to a demethylation domain and a second PUF domain operably linked to a demethylation enhancer domain, respectively.
  • demethylation protein conjugates e.g., demethylation protein conjugate, demethylation enhancer conjugate
  • the protein conjugate is a demethylation conjugate
  • the demethylation domain is operably linked to the C-terminus of the PUF domain to form a protein conjugate.
  • the demethylation enhancer domain may be linked to the C-terminus of the PUF domain, to the N-terminus of the PUF domain, or the demethylation enhancer domain may bind the polynucleotide (e.g., gRNA) linked to a separate PUF domain (i.e., a PUF domain not linked to the demethylation domain).
  • the demethylation enhancer domain and the demethylation domain bind the polynucleotide separately, the demethylation domain forms part of a demethylation protein conjugate and is linked to a first PUF domain, and the demethylation enhancer domain forms part of a demethylation enhancer protein conjugate and is linked to a second PUF domain.
  • the demethylation protein conjugate binds the polynucleotide through binding of the first PUF domain to the first PBS sequence and the demethylation enhancer protein conjugate binds the polynucleotide through binding of the second PUF domain to the second PBS sequence.
  • the term “PUF domain” refers to a wildtype or naturally existing PUF domain, as well as a PUF homologue domain that is based on/derived from a natural or existing PUF domain, such as the prototype human Pumilio 1 PUF domain.
  • the PUF domain of the invention specifically binds to an RNA sequence (e.g., an 8-mer RNA sequence), wherein the overall binding specificity between the PUF domain and the RNA sequence is defined by sequence specific binding between each PUF motif/PUF repeat within the PUF domain and the corresponding single RNA nucleotide.
  • the term “functional variant” as used herein refers to a PUF domain having substantial or significant sequence identity or similarity to a parent PUF domain, which functional variant retains the biological activity of the PUF domain of which it is a variant—e.g., one that retains the ability to recognize target RNA to a similar extent, the same extent, or to a higher extent in terms of binding affinity, and/or with substantially the same or identical binding specificity, as the parent PUF domain.
  • the functional variant PUF domain can, for instance, be at least 30%, 50%, 75%, 80%, 90%, 98% or more identical in amino acid sequence to the parent PUF domain.
  • the functional variant can, for example, comprise the amino acid sequence of the parent PUF domain with at least one conservative amino acid substitution, for example, conservative amino acid substitutions in the scaffold of the PUF domain (i.e., amino acids that do not interact with the RNA).
  • the functional variants can comprise the amino acid sequence of the parent PUF domain with at least one non-conservative amino acid substitution. In this case, it is preferable for the non-conservative amino acid substitution to not interfere with or inhibit the biological activity of the functional variant.
  • the non-conservative amino acid substitution may enhance the biological activity of the functional variant, such that the biological activity of the functional variant is increased as compared to the parent PUF domain, or may alter the stability of the PUF domain to a desired level (e.g., due to substitution of amino acids in the scaffold).
  • the PUF domain can consist essentially of the specified amino acid sequence or sequences described herein, such that other components, e.g., other amino acids, do not materially change the biological activity of the functional variant.
  • the PUF domain is a Pumilio homology domain (PU-HUD).
  • the PU-HUD is a human Pumilio 1 domain.
  • the PUF domain has the sequence of any one of the PUF domains disclosed in international application PCT/US2016/021491, published as WO2016148994 A8, in international application PCT/US2011/040933, published as WO 2011/160052A2, and Spassov & Jurecic (“Cloning and comparative sequence analysis of PUM1 and PUM2 genes, human members of the Pumilio family of RNA-binding proteins,” Gene, 299:195-204, October 2002), which are hereby incorporated by reference in their entirety and for all purposes.
  • the PUF domain includes a PUFa domain, a PUFb domain, a PUFc domain, or a PUFw domain.
  • the PUFa domain has the amino acid sequence of SEQ ID NO:2.
  • the PUFb domain has the amino acid sequence of SEQ ID NO:3.
  • the PUFc domain has the amino acid sequence of SEQ ID NO:4.
  • the PUFw domain has the amino acid sequence of SEQ ID NO:5.
  • the first PUF domain is a PUFa domain.
  • the PUFa domain has the sequence of SEQ ID NO:2.
  • the second PUF domain is a PUFc domain.
  • the PUFc domain has the sequence of SEQ ID NO:4.
  • the first or the second PUF domain includes a PUFa domain, a PUFb domain, a PUFc domain, or a PUFw domain.
  • the first or the second PUFa domain has the amino acid sequence of SEQ ID NO:2.
  • the first or the second PUFb domain has the amino acid sequence of SEQ ID NO:3.
  • the first or the second PUFc domain has the amino acid sequence of SEQ ID NO:4.
  • the first or the second PUFw domain has the amino acid sequence of SEQ ID NO:5.
  • the subject polynucleotide includes one or more tandem sequences, each of which can be specifically recognized and bound by a specific PUF domain (infra). Since a PUF domain can be engineered to bind virtually any PBS sequence based on the nucleotide-specific interaction between the individual PUF motifs of PUF domain and the single RNA nucleotide they recognize, the PBS sequences can be any designed sequence that bind their corresponding PUF domain.
  • a PBS of the invention has a nucleotide length of 8-mer. In other embodiments, a PBS of the invention has 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16 or more RNA nucleotides. In certain embodiments, the PBS of the invention has the sequence of SEQ ID NO:10 (5′-UGUAUAUA-3′), and binds the wt human Pumilio 1 PUF domain.
  • the PBS sequence of the invention has the sequence of SEQ ID NO:8 (5′-UGUAUGUA-3′), and binds the PUF domain PUF(3-2).
  • the PBS sequence of the invention has the sequence of SEQ ID NO:9 (5′-UUGAUAUA-3′), and binds the PUF domain PUF(6-2/7-2).
  • the PBS sequence of the invention has the sequence of SEQ ID NO:11 (5′-UGGAUAUA-3′), and binds the PUF domain PUF(6-2).
  • the PBS sequence of the invention has the sequence of SEQ ID NO:12 (5′-UUUAUAUA-3′), and binds the PUF domain PUF(7-2).
  • the PBS sequence of the invention has the sequence of SEQ ID NO:13 (5′-UGUGUGUG-3′), and binds the PUF domain PUF 531 .
  • the PBS sequence of the invention has the sequence of SEQ ID NO:14 (5′-UGUAUAUG-3′), and binds the PUF domain PUF(1-1).
  • the PBS sequence of the invention has the sequence of SEQ ID NO:12 (5′-UUUAUAUA-3′) or sequence of SEQ ID NO:15 (5′-UAUAUAUA-3′), and binds the PUF domain PUF(7-1).
  • the PBS sequence of the invention has the sequence of SEQ ID NO:16 (5′-UGUAUUUA-3′), and binds the PUF domain PUF(3-1).
  • the PBS sequence of the invention has the sequence of SEQ ID NO:17 (5′-UUUAUUUA-3′), and binds the PUF domain PUF(7-2/3-1).
  • the PUF domain PUF(3-2) has the sequence of SEQ ID NO:18.
  • the PUF domain PUF(6-2/7-2) has the sequence of SEQ ID NO: 19.
  • the PUF domain PUF 531 has the sequence of SEQ ID NO:22.
  • the PUF domain includes the sequence of SEQ ID NO:18, SEQ ID NO:19, SEQ ID NO:22, SEQ ID NO:28, SEQ ID NO:29, SEQ ID NO:30 or SEQ ID NO:31.
  • the PUF domain is the sequence of SEQ ID NO:18, SEQ ID NO:19, SEQ ID NO:22, SEQ ID NO:28, SEQ ID NO:29, SEQ ID NO:30 or SEQ ID NO:31.
  • Applicant has created 65,536 8-mer PBS sequence and their corresponding PUF domain sequences (see below) that can bind the specific PBS sequence. Applicant has also created a python script to retrieve any of the 65,536 individual PUF domain sequences that binds a given 8-mer PBS sequence. For example, for the 8-mer UUGAUGUA (SEQ ID NO:27), one possible PUF domain sequence can be SEQ ID NO:28:
  • PUF(3-2) (SEQ ID NO:18) has two point mutations (C935S/Q939E) in the PUF repeat 3, and recognizes a cognate RNA with a mutation at position 6 of the NRE (A6G; SEQ ID NO:27 (5′-UGUAUGUA-3′)).
  • PUF (6-2/7-2) (SEQ ID NO:19) has double point mutations (N1043S/Q1047E and S1079N/E1083Q) in repeats 6 and 7, respectively, and recognizes a cognate RNA sequence with two mutations at positions 2 and 3 of the NRE (GU/UG; SEQ ID NO:9 (5′-UUGAUAUA-3′)).
  • a related PUF (6-2) has point mutations (N1043S/Q1047E) in repeats 6, and recognizes a cognate RNA sequence with a mutation at position 3 of the NRE (SEQ ID NO: 11 (5′-UGGAUAUA-3′)).
  • Another related PUF (7-2) has point mutations (S1079N/E1083Q) in repeats 7, and recognizes a cognate RNA sequence with a mutation at position 2 of the NRE (SEQ ID NO: 12 (5′-UUUAUAUA-3′)).
  • the PUF domain PUF 531 (SEQ ID NO:22) has mutations (Q867E/Q939E/C935S/Q1011E/C1007S) in wild type PUF repeats 1, 3 and 5, and recognizes the sequence of SEQ ID NO:13 (5′-UGUGUGUG-3′).
  • the PUF 531 can recognize its new target sequence with very high affinity, compared to the wild type PUF RNA.
  • Another modified PUF domain PUF(1-1) has one point mutation (Q867E) in the PUF repeat 1, and recognizes a cognate RNA with a mutation at position 8 of the NRE (A8G; SEQ ID NO:14 (5′-UGUAUAUG-3′)).
  • Yet another modified PUF domain PUF(7-1) has one point mutation (E1083Q) in the PUF repeat 7, and recognizes a cognate RNA with a mutation at position 2 of the NRE (G2U; SEQ ID NO:12 (5′-UUUAUAUA-3′); or G2A; SEQ ID NO:15 (5′-UAUAUAUA-3′)).
  • Still another modified PUF domain PUF(3-1) has one point mutation (C935N) in the PUF repeat 3, and recognizes a cognate RNA with a mutation at position 6 of the NRE (A6U; SEQ ID NO:16 (5′-UGUAUUUA-3′)).
  • a further modified PUF (7-2/3-1) has point mutations (C935N/S1079N/E1083Q) in repeats 7 and 3, and recognizes a cognate RNA sequence with mutations at positions 2 and 6 of the NRE (SEQ ID NO:17 (5′-UUUAUUUA-3′)).
  • the PUF domain has a sequence of SEQ ID NO:29.
  • the demethylation domain (e.g., TET1 domain), or methylation domain (e.g., Dnmt3a domain) or demethylation enhancer domain (e.g., NEIL2 domain, GADD45A domain) provided herein may be linked to a PUF domain as provided herein including embodiments thereof.
  • the demethylation domain e.g., TET1 domain
  • methylation domain e.g., Dnmt3a domain
  • demethylation enhancer domain e.g., NEIL2 domain, GADD45A domain
  • dCas9 nuclease-deficient RNA-guided DNA endonuclease
  • a chemical linker may link the demethylation domain or methylation domain to the nuclease-deficient RNA-guided DNA endonuclease.
  • the chemical linker is a peptide linker.
  • the chemical linker is a poly-glycine linker.
  • the demethylation domain or demethylation enhancer domain is linked to the C-terminus of the nuclease-deficient RNA-guided DNA endonuclease (e.g., dCas9). In certain embodiments, the demethylation domain or demethylation enhancer domain is linked to the N-terminus of the nuclease-deficient RNA-guided DNA endonuclease (e.g., dCas9).
  • the demethylation domain or demethylation enhancer domain provided herein is directly linked (fused) to the nuclease-deficient RNA-guided DNA endonuclease (e.g., dCas9)
  • the demethylation domain or demethylation enhancer domain and the nuclease-deficient RNA-guided DNA endonuclease (e.g., dCas9) form a dCas9-demethylation domain conjugate or a dCas9-demethylation enhancer domain conjugate.
  • the dCas9-demethylation domain (e.g., TET1 domain) conjugate has the sequence of SEQ ID NO:52.
  • the dCas9-demethylation domain conjugate has the sequence of SEQ ID NO:53. In certain embodiments, the dCas9-methylation (e.g., Dnmt3a) domain conjugate has the sequence of SEQ ID NO:59. In certain embodiments, the dCas9-methylation domain conjugate has the sequence of SEQ ID NO:60. In certain embodiments, the dCas9-methylation domain conjugate has the sequence of SEQ ID NO:61. In certain embodiments, the dCas9-methylation domain conjugate has the sequence of SEQ ID NO:62. In certain embodiments, the dCas9-methylation domain conjugate has the sequence of SEQ ID NO:63. In certain embodiments, the dCas9-methylation domain conjugate has the sequence of SEQ ID NO:64.
  • the complexes provided herein may include an additional bioactive domain operably linked to the PUF domain or the nuclease-deficient RNA-guided DNA endonuclease (e. g., dCas9 protein).
  • a heterologous polypeptide also referred to as a “fusion partner” can be fused to the PUF domain of the demethylation or demethylation enhancer protein conjugate provided herein including embodiments thereof, that binds to at least one of the PBS on the subject polynucleotide.
  • the same or different fusion partner can also optionally be fused to the nuclease-deficient RNA-guided DNA endonuclease (e.g., nuclease-deficient wt Cas9 protein or dCas9 protein).
  • nuclease-deficient RNA-guided DNA endonuclease e.g., nuclease-deficient wt Cas9 protein or dCas9 protein.
  • any of the fusion partners are intended to be fused to the PUF domain of the demethylation or demethylation enhancer protein conjugate provided herein including embodiments thereof, and optionally also fused to the nuclease-deficient RNA-guided DNA endonuclease (e.g., nuclease-deficient wt Cas9 protein or dCas9 protein).
  • the fusion partner fused to the PUF domain can be the same or different from the optional fusion partner fused to the nuclease-deficient RNA-guided DNA endonuclease (e.g., nuclease-deficient wt Cas9 protein or dCas9 protein) (infra).
  • the fusion partner is a bioactive moiety.
  • the fusion partner is a detectable moiety or a therapeutic moiety.
  • the fusion partner may exhibit an activity (e.g., enzymatic activity).
  • Suitable fusion partners include, but are not limited to, a polypeptide that provides for methyltransferase activity, demethylase activity, acetyltransferase activity, deacetylase activity, kinase activity, phosphatase activity, ubiquitin ligase activity, deubiquitinating activity, adenylation activity, deadenylation activity, SUMOylating activity, deSUMOylating activity, ribosylation activity, deribosylation activity, myristoylation activity, or demyristoylation activity, any of which can be directed at modifying the DNA directly (e.g., methylation of DNA) or at modifying a DNA-associated polypeptide (e.g., a histone or DNA binding protein).
  • a DNA-associated polypeptide e.g., a histone or DNA binding protein
  • Additional fusion partners may include the various fluorescent protein, polypeptides, variants, or functional domains thereof, such as GFP, Superfolder GFP, EGFP, BFP, EBFP, EBFP2, Azurite, mKalama1, CFP, ECFP, Cerulean, CyPet, mTurquoise2, YFP, Citrine, Venus, Ypet, BFPms1, roGFP, and bilirubin-inducible fluorescent proteins such as UnaG, dsRed, eqFP611, Dronpa, TagRFPs, KFP, EosFP, Dendra, IrisFP, etc.
  • the fusion partner is a demethylation domain. In certain embodiments, the fusion partner is a demethylation enahncer domain.
  • any of the subject PUF domain can be made using, for example, a Golden Gate Assembly kit (see Abil et al., Journal of Biological Engineering 8:7, 2014), which is available at Addgene (Kit #1000000051).
  • demethylation protein conjugates and demethylation enhancer conjugates useful for demethylating target loci in a cell.
  • the demethylation protein conjugates include a PUF domain described herein, a TET demethylation domain (e.g., a TET1 domain) and a demethylation enhancer domain (e.g., a NEIL2 domain or a GADD45A domain).
  • the complexes provided herein include a demethylation protein conjugate including a first PUF domain and a demethylation domain (e.g., a TET1 domain) and a demethylation enhancer conjugate including a second PUF domain and a demethylation enhancer domain (e.g., a NEIL2 domain or a GADD45A domain).
  • a demethylation protein conjugate including a first PUF domain and a demethylation domain (e.g., a TET1 domain) and a demethylation enhancer conjugate including a second PUF domain and a demethylation enhancer domain (e.g., a NEIL2 domain or a GADD45A domain).
  • the demethylation enhancer domain is operably linked to the N-terminus of the PUF domain. In certain embodiments, the demethylation enhancer domain is operably linked to the C-terminus of the PUF domain. In certain embodiments, the demethylation enhancer domain is operably linked to the N-terminus of the second PUF domain. In certain embodiments, the demethylation enhancer domain is operably linked to the C-terminus of the second PUF domain.
  • the demethylation enhancer domain is a Growth Arrest and DNA-Damage-inducible Alpha (GADD45A) domain.
  • the GADD45 domain has the amino acid sequence of SEQ ID NO:85.
  • the demethylation enhancer domain is a NEIL2 domain.
  • the NEIL2 domain has the amino acid sequence of SEQ ID NO:86.
  • the demethylation enhancer domain is not a NEIL1 domain. In certain embodiments, the demethylation enhancer domain is not a NEIL3 domain.
  • a “demethylation enhancer domain”, “demethylation enhancer protein” or “demethylation enhancer enzyme” as provided herein refers to a protein, protein domain or protein moiety capable of positively affecting (e.g. increasing) the activity or function of a demethylation enzyme or demethylation domain, relative to the activity or function of the demethylation enzyme or demethylation domain in the absence of the activator (e.g. demethylation enhancer domain described herein).
  • the demethylation enhancer domain may, at least in part, partially or totally increase stimulation, increase or enable activation, or activate the demethylation enzyme.
  • the amount of increase in activity may be 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100% or more in comparison to a control in the absence of the demethylation enhancer domain.
  • the activity is 1.5-fold, 2-fold, 3-fold, 4-fold, 5-fold, 10-fold, or more than the activity in the absence of the demethylation enhancer domain.
  • the DNA demethylation domain may include a Ten-Eleven translocation 1 (TET1) domain.
  • the DNA demethylation domain includes a Ten-Eleven translocation 2 (TET2) domain.
  • the DNA demethylation domain includes a Ten-Eleven translocation 3 (TET3) domain.
  • the TET1 domain includes the sequence of SEQ ID NO:51. In certain embodiments, the TET1 domain is the sequence of SEQ ID NO:51.
  • the TET protein is a TET methylcytosine dioxygenase.
  • TET methylcytosine dioxygenase catalyzes the initial and critical step leading to replacing 5mC with unmethylated cytosine.
  • the demethylation protein conjugate includes a TET1 functional domain fused to the C-terminus of the PUF domain.
  • the PUF domain is PUFa.
  • transcription of the target gene is increased by more than 10-fold, 15-fold, 20-fold, 25-fold, 30-fold, 50-fold, 75-fold, 100-fold, 125-fold, 135-fold, 150-fold, 200-fold or more.
  • the target gene is SOX.
  • the target gene comprises two or more target polynucleotide sequences. In certain embodiments, at least two of said same or different PUF domains are fused to a demethylase domain or a demethylase enhancer domain.
  • the demethylation protein conjugate includes the sequence of SEQ ID NO:54 or SEQ ID NO:55. In certain embodiments, the demethylation protein conjugate is the sequence of SEQ ID NO:54 or SEQ ID NO:55.
  • demethylation protein conjugate includes the sequence of SEQ ID NO: 104. In certain embodiments, demethylation protein conjugate is the sequence of SEQ ID NO: 104. In certain embodiments, demethylation protein conjugate includes the sequence of SEQ ID NO: 105. In certain embodiments, demethylation protein conjugate is the sequence of SEQ ID NO: 105.
  • demethylation enhancer conjugate includes the sequence of SEQ ID NO: 106. In certain embodiments, demethylation enhancer conjugate is the sequence of SEQ ID NO: 106. In certain embodiments, demethylation enhancer conjugate includes the sequence of SEQ ID NO: 107. In certain embodiments, demethylation enhancer conjugate is the sequence of SEQ ID NO:107.
  • demethylation enhancer conjugate includes the sequence of SEQ ID NO: 108. In certain embodiments, demethylation enhancer conjugate is the sequence of SEQ ID NO: 108. In certain embodiments, demethylation enhancer conjugate includes the sequence of SEQ ID NO: 109. In certain embodiments, demethylation enhancer conjugate is the sequence of SEQ ID NO:109.
  • Another aspect of the invention provides a complex comprising any one of the polynucleotide of the invention, and the modified Cas9 protein, e.g., nuclease-deficient wt Cas9 protein or dCas9 protein.
  • the complex comprises a nuclease-deficient wt Cas9 protein.
  • the complex may further comprise one or more PUF domain or fusion thereof bound to the one or more PBS(s).
  • each of the PUF domain is fused to an effector domain.
  • at least two of the PUF domains are fused to different effector domains.
  • the nuclease-deficient wt Cas9 protein e.g., nuclease-deficient wt Cas9 protein or dCas9 protein
  • the PUF domain, and/or the effector domain further comprises a nuclear localization signal (NLS).
  • NLS nuclear localization signal
  • the complex is bound to the target polynucleotide sequence through the DNA-targeting sequence of the polynucleotide.
  • the effector domain is a TET (Ten-Eleven Translocation) protein, or a fragment thereof that retains demethylase catalytic activity.
  • the TET protein may be a TET methylcytosine dioxygenase.
  • the PUF domain fusion protein comprises a TET1 functional domain fused to the C-terminus of the PUF domain (e.g., PUFa).
  • the PUF domain fusion protein comprises a Dnmt functional domain fused to the N-terminus of the PUF domain (e.g., PUFa).
  • a cell including a demethylation complex as provided herein including embodiments thereof is provided.
  • the cell is a mammalian cell.
  • the cell is a cancer cell.
  • the cell is a cancer cell, and/or the target gene is hMLH1 with a hypermethylated promoter region.
  • the target polynucleotide sequence may be within the hypermethylated promoter region of hMLH1, and methylation of the target polynucleotide sequence is associated with down-regulation of hMLH1 in cancer cells.
  • the cancer cell is from a stomach cancer, esophageal cancer, head and neck squamous cell carcinoma (HNSCC), non-small cell lung cancer (NSCLC), and colorectal cancer (such as HNPCC).
  • the stomach cancer may include foveolar type tumors, and stomach cancer in high-incidence Kashmir Valley.
  • Another aspect of the invention provides a host cell including any one of the subject vector, polynucleotide, and complex.
  • the host cell further includes a second vector encoding the nuclease-deficient wt Cas9 protein (e.g., nuclease-deficient wt Cas9 protein or dCas9 protein).
  • the second vector further encodes a demethylation (effector) domain fused to the nuclease-deficient wt Cas9 protein (e.g., nuclease-deficient wt Cas9 protein or dCas9 protein).
  • the expression of the Cas9 protein e.g., wt, nickase, or dCas9 protein
  • the host cell may further include a third vector encoding the one or more PUF domains, each fused to demethylation (effector) domain.
  • the expression of the one or more PUF domains can be independently under the control of a constitutive promoter or an inducible promoter.
  • the second vector may further encode a nuclear localization signal (NLS) fused to the nuclease-deficient wt Cas9 protein (e.g., nuclease-deficient wt Cas9 protein or dCas9 protein) or the methylation or demethylation (effector) domain
  • the third vector may further encode a nuclear localization signal (NLS) fused to the PUF domain or the methylation or demethylation (effector) domain.
  • sequences that can be encoded by different vectors may be on the same vector.
  • the second vector may be the same as the vector
  • the third vector may be the same as the vector or the second vector.
  • the host cell may be in a live animal, or may be a cultured cell.
  • demethylation protein conjugates including a demethylation domain and a demethylation enhancer domain (e.g., demethylation enzymes and demethylation enhancers or functional fragments thereof) or a combination of a demethylation protein conjugate and a demethylation enhancer conjugate, may be delivered to a cell sequentially or concomitantly. Delivery of a demethylation protein conjugate provided herein or a combination of a demethylation protein conjugate and a demethylation enhancer conjugate to a cell, allows for fine tuning the methylation status of a targeted gene locus.
  • a demethylation enhancer domain e.g., demethylation enzymes and demethylation enhancers or functional fragments thereof
  • a combination of a demethylation protein conjugate and a demethylation enhancer conjugate may be delivered to a cell sequentially or concomitantly. Delivery of a demethylation protein conjugate provided herein or a combination of a demethylation protein conjugate and a demethylation enhancer conjugate to
  • the invention further provides for the delivery of a plurality of demethylation protein conjugates, wherein the conjugates may be the same or different.
  • the conjugates may form part of a plurality of conjugates, each linked to a PUF domain, and/or they may be directly fused to the nuclease-deficient RNA-guided DNA endonuclease enzyme (e.g., dCas9).
  • the present invention allows for the delivery of enhanced demethylation activities to different target sites in a cell at the same time.
  • demethylation domains e.g., TET1 domain
  • enhancer proteins e.g., GADD45A or NEIL2
  • demethylation using the complexes provided herein is more efficient compared to, for example, demethylation in the absence of the enhancer domain or compared to directly linking demethylation activities to the nuclease-deficient RNA-guided DNA endonuclease enzyme (e.g., dCas9).
  • the method includes delivering a first polynucleotide encoding a nuclease-deficient RNA-guided DNA endonuclease enzyme as provided herein including embodiments thereof (e.g., dCas9).
  • the method may include delivering a second polynucleotide, which is the polynucleotide described herein including embodiments thereof and which encodes a DNA-targeting sequence, a binding sequence and one or more PUF binding site (PBS) sequences provided herein.
  • PBS PUF binding site
  • a method of demethylating a target nucleic acid sequence in a mammalian cell includes:
  • a demethylation complex in one aspect, includes:
  • a method of demethylating a target nucleic acid sequence in a mammalian cell includes:
  • the demethylation protein conjugate binds to the ribonucleoprotein complex via the PUF domain binding to the one or more PBS sequences to form a demethylation complex.
  • the first polynucleotide is contained within a first vector.
  • the second polynucleotide is contained within a second vector.
  • the third polynucleotide is contained within a third vector.
  • the first, second or third vector is the same.
  • the delivering is performed by transfection.
  • the demethylation protein conjugate binds to the ribonucleoprotein complex via the first PUF domain binding to the first PBS sequence. In certain embodiments, the demethylation enhancer conjugate binds to the ribonucleoprotein complex via the second PUF domain binding to the second PBS sequence. In certain embodiments, the demethylation enhancer domain is operably linked to the N-terminus of the second PUF domain. In certain embodiments, the demethylation enhancer domain is operably linked to the C-terminus of the second PUF domain. In certain embodiments, the first polynucleotide is contained within a first vector. In certain embodiments, the second polynucleotide is contained within a second vector.
  • the third polynucleotide is contained within a third vector.
  • the fourth polynucleotide is contained within a fourth vector.
  • either the first, second, third or fourth vector is the same.
  • the delivering is performed by transfection.
  • the method of the invention utilizes a plurality or a library of the vectors, each encoding a polynucleotide of the invention, wherein two of the vectors differ in the encoded polynucleotides in their respective DNA-targeting sequences, Cas9-binding sequences, and/or the copy number, identity (sequence, binding specificity, etc.), or relative order of the PBS.
  • non-vector coding sequences are used instead of using vectors.
  • the method further comprises introducing into the cell a plurality of any one of the subject vectors, wherein two of the vectors differ in the encoded polynucleotides in their respective DNA-targeting sequences, Cas9-binding sequences, and/or the copy number, identity, or relative order of the PBS.
  • non-vector coding sequences are used instead of using vectors.
  • the methods of enhanced demethylating a target nucleic acid in a cell may be used, inter alia, for the treatment of diseases related to or caused by abnormal DNA methylation (e.g., cancer).
  • diseases related to or caused by abnormal DNA methylation e.g., cancer
  • a role for both epigenetic (DNA methylation) and genetic (mutations) actions of cytidine deaminases in cancer has been proposed, and a possible role in demethylation which is widespread.
  • the present invention has practical application in ameliorating/treating the cancer disease process by altering the demethylation or demethylation status within the cancer cell.
  • methylated genes can be targeted for demethylation in vivo, which may lead to their expression (methylation being a repressive modification most of the time).
  • Targeting of cytidine deaminase activity to genes of interest in cancer can include, for example, fusion of the cytidine deaminase to a tumor suppressor DNA binding domain, (such as the zinc finger DNA core binding region of the p53 protein). It is believed that in many cancers, mutation of the DNA binding domain of p53 can contribute to transformation. In addition, the promoter regions of many tumor suppressor genes, including p53 targets, are methylated in cancer cells.
  • the molecules and pharmaceutical compositions of the present invention can be assessed for their anti-cancer/anti-tumorigenic effects by utilizing in vitro and ex vivo assays.
  • a nucleic acid vector that expresses a molecule of the invention is transfected into a cancer cell.
  • Appropriate controls are established comprising the cancer cell line transfected with vector backbone only, or vector plus a molecule of the invention in which the cytidine deaminase domain is rendered non-functional described in more detail below.
  • Induced apoptosis in the cancer cell line transfected with the molecules of the invention but not in the control cells would be indicative of an anti-cancer effect for the molecule of the invention.
  • a method of treating cancer in a subject in need thereof includes, administering to a subject a therapeutically effective amount of a demethylation complex or methylation complex as provided herein including embodiments thereof, thereby treating cancer in the subject.
  • the method includes administering to a subject a therapeutically effective amount of a demethylation complex as provided herein.
  • composition in another aspect, includes therapeutically effective amount of a demethylation complex as provided herein including embodiments thereof and a pharmaceutically acceptable excipient.
  • Additional applications for the methods and compositions provided herein include modulating gene expression during development.
  • the presence of a site specific DNA binding domain allows for targeted demethylation of specific subsets of genes activated at particular times in development or during the cell cycle.
  • the DNA binding domains of the (e.g., Oct4 or SOX-2) proteins when fused to a PUF domain could provide for a demethylation activity that is directed towards genes that are involved in cell fate decisions relating to promotion of a pluripotent or stem cell-like phenotype.
  • the demethylation domain may be linked via a linker to PUF binding domain.
  • DNA binding domains that could optionally be utilized include those from T-box transcription factors or steroid hormone receptor DNA binding domains such as the RAR and RXR DNA binding domains. Nevertheless, the present demethylation protein conjugate may be sufficient to demethylate the promoters of a pluripotent gene and alter the methylation status of a cell during differentiation.
  • Another aspect of the invention provides a method of modulating transcription and/or methylation state of a target gene in a cancer cell according to any method of the invention, wherein the cancer cell is associated with or characterized by abonormal DNA methylation.
  • a related aspect of the invention provides a method of modulating transcription and/or methylation state of a target gene in a cancer cell in a patient according to any method of the invention, wherein the cancer cell is associated with or characterized by abonormal DNA methylation.
  • Another related aspect of the invention provides a method for treating a patient in need of treatment a disease or condition associated with abnormal DNA methylation, such as CpG methylation, of a target gene, the method comprising allowing the formation of the complex of the invention near or at the target gene to modulate transcription and/or methylation state of the target gene in the patient.
  • a disease or condition associated with abnormal DNA methylation such as CpG methylation
  • Another related aspect of the invention provides a method for treating a patient in need of treatment a disease or condition associated with abnormal DNA methylation (such as CpG methylation) of a target gene, the method comprising modulating transcription and/or methylation state of the target gene in the patient according to any of the subject methods.
  • a disease or condition associated with abnormal DNA methylation such as CpG methylation
  • Another related aspect of the invention provides a method for treating a patient in need of treatment a disease or condition associated with abnormal DNA methylation (such as CpG methylation) of a target gene, the method comprising allowing the formation of the complex of the invention near or at the target gene to modulate transcription and/or methylation state of the target gene in the patient.
  • a disease or condition associated with abnormal DNA methylation such as CpG methylation
  • the invention provides a method of treating cancer in a patient in need of treatment, wherein said cancer is associated with or characterized by abnormal DNA methylation of hMLH1, the method comprising modulating transcription and/or methylation state of hMLH1 in the patient according to any one of the methods of the invention.
  • the PUF domain fusion protein may comprise a TET1 functional domain fused to the C-terminus of the PUF domain such as PUFa.
  • the methylation level of the hypermethylated promoter region of hMLH1 is decreased.
  • transcription/translation of hMLH1 is increased.
  • the target gene is hMLH1.
  • the disease is a cancer. In certain embodiments, the disease is an imprinting disorder. In certain embodiments, the disease is a neurological disease.
  • the cancer is associated with or characterized by hyper- or hypomethylation of a tumor suppressor gene or an oncogene, respectively.
  • the cancer is a stomach cancer (including foveolar type tumors, and stomach cancer in high-incidence Kashmir Valley), esophageal cancer, head and neck squamous cell carcinoma (HNSCC), non-small cell lung cancer (NSCLC), and colorectal cancer (such as HNPCC).
  • stomach cancer including foveolar type tumors, and stomach cancer in high-incidence Kashmir Valley
  • esophageal cancer head and neck squamous cell carcinoma (HNSCC), non-small cell lung cancer (NSCLC), and colorectal cancer (such as HNPCC).
  • HNSCC head and neck squamous cell carcinoma
  • NSCLC non-small cell lung cancer
  • colorectal cancer such as HNPCC
  • Yet another aspect of the invention provides a method of assembling the complex of the invention at the target polynucleotide sequence, the method comprising contacting or bringing to the vicinity of the target polynucleotide sequence: (1) any one of the subject polynucleotide, or any one of the subject vector, or the plurality of vectors; (2) the nuclease-deficient wt Cas9 protein (e.g., nuclease-deficient wt Cas9 protein or dCas9 protein), or any one of the subject second vector encoding the nuclease-deficient wt Cas9 protein (e.g., nuclease-deficient wt Cas9 protein or dCas9 protein); and, (3) one or more of the PUF domains, each fused to an effector domain, or any one of the third vector encoding the PUF domain fusions.
  • the fusion is with a DNA methyltransferase or a demethylas
  • the complex is assembled inside a cell
  • the target polynucleotide sequence is a part of the genomic DNA of the cell
  • the subject vector, second vector, and third vector are introduced into the cell.
  • a related aspect of the invention provides a method of modulating transcription of a plurality of target genes in a cell, the method comprising: introducing into the cell the subject plurality of the vectors, a coding sequence for a dCas9 protein, and a coding sequence for one or more PUF domain fusions, wherein each of the target genes comprises a target polynucleotide sequence that permits (1) the assembly, at the target polynucleotide sequence, of a tripartite complex of a polynucleotide encoded by one of the plurality of the vector, the dCas9 protein, and a PUF domain fusion; and (2) transcription modulation of the target gene comprising the target polynucleotide sequence.
  • the invention also provides a method of epigenetic modulation (e.g., modulating the epigenetic states of chromatin not directly related to transcriptional activity), at a plurality of target genes in a cell, the method comprising: introducing into the cell the subject plurality of the vectors, a coding sequence for a nuclease-deficient wt Cas9 protein, and a coding sequence for one or more PUF domain fusions, wherein each of the target genes comprises a target polynucleotide sequence that permits (1) the assembly, at the target polynucleotide sequence, of a tripartite complex of a polynucleotide encoded by one of the plurality of the vector, the wt Cas9 protein or the Cas9 nickase, and a PUF domain fusion; and (2) epigenetic modulation of the target gene comprising the target polynucleotide sequence.
  • epigenetic modulation e.g., modulating the epigenetic states of chromatin
  • the method can be useful, for example, to change epigenetic state (e.g., opening up the chromatin) at the same time to gain access/stability of nuclease-deficient wt Cas9 protein (e.g., dCas9) binding to closed chromatin sites (e.g., to increase cut and genome editing at those sites).
  • epigenetic state e.g., opening up the chromatin
  • nuclease-deficient wt Cas9 protein e.g., dCas9 protein binding to closed chromatin sites (e.g., to increase cut and genome editing at those sites).
  • the transcription of at least one target gene is enhanced/stimulated, while the transcription of at least another target gene is inhibited.
  • the method comprises:
  • the coding sequence for a PUF domain fusion protein can be introduced into the cell together (e.g., by including all coding sequences on the same vector, by co-transfecting different vectors encoding different coding sequences, etc.), or separately, in any order or sequence as desired.
  • the coding sequence for a PUF domain fusion protein, the coding sequence for a nuclease-deficient RNA-guided DNA endonuclease (dCas9 protein), and the polynucleotide (or a vector encoding the polynucleotide) are co-introduced into the cell.
  • the target polynucleotide sequence can be any DNA sequence.
  • the target polynucleotide sequence comprises, or is adjacent to, one or more transcription regulatory element(s).
  • the transcription regulatory element(s) comprises one or more of: a core promoter, a proximal promoter element, an enhancer, a silencer, an insulator, and a locus control region.
  • kits in another aspect, includes:
  • kits in another aspect, includes:
  • a subject kit may include: a) a polynucleotide of the present invention, or a nucleic acid (e.g., vector) including a nucleotide sequence encoding the same; optionally, b) a subject nuclease-deficient wt Cas9 protein (e.g., nuclease-deficient wt Cas9 protein or dCas9 protein), or a vector encoding the same (including an expressible mRNA encoding the same); and optionally, c) one or more subject demethylation or methylation protein conjugate (PUF domain fusion) each including a PUF domain fused to a demethylation or methylation domain (effector domain) that may be the same or different among the different demethylation or methylation protein conjugates (PUF domain fusions), or a vector encoding the same (including an expressible mRNA encoding the same).
  • one or more of a)-c) may be encoded by the same vector.
  • the kit also comprises one or more buffers or reagents that facilitate the introduction of any one of a)-c) into a host cell, such as reagents for transformation, transfection, or infection.
  • a subject kit can further include one or more additional reagents, where such additional reagents can be selected from: a buffer; a wash buffer; a control reagent; a control expression vector or RNA polynucleotide; a reagent for in vitro production of the nuclease-deficient wt Cas9 protein or dCas9 or PUF domain fusion from DNA; and the like.
  • additional reagents can be selected from: a buffer; a wash buffer; a control reagent; a control expression vector or RNA polynucleotide; a reagent for in vitro production of the nuclease-deficient wt Cas9 protein or dCas9 or PUF domain fusion from DNA; and the like.
  • Components of a subject kit can be in separate containers; or can be combined in a single container.
  • a subject kit can further include instructions for using the components of the kit to practice the subject methods.
  • the instructions for practicing the subject methods are generally recorded on a suitable recording medium.
  • the instructions may be printed on a substrate, such as paper or plastic, etc.
  • the instructions may be present in the kits as a package insert, in the labeling of the container of the kit or components thereof (i.e., associated with the packaging or subpackaging) etc.
  • the instructions are present as an electronic storage data file present on a suitable computer readable storage medium, e.g. CD-ROM, diskette, flash drive, etc.
  • the actual instructions are not present in the kit, but means for obtaining the instructions from a remote source, e.g. via the internet, are provided.
  • An example of this embodiment is a kit that includes a web address where the instructions can be viewed and/or from which the instructions can be downloaded. As with the instructions, this means for obtaining the instructions is recorded on a suitable substrate.
  • Nucleic acid refers to deoxyribonucleotides or ribonucleotides and polymers thereof in either single-, double- or multiple-stranded form, or complements thereof.
  • polynucleotide refers to a linear sequence of nucleotides.
  • nucleotide typically refers to a single unit of a polynucleotide, i.e., a monomer. Nucleotides can be ribonucleotides, deoxyribonucleotides, or modified versions thereof.
  • nucleic acids can be linear or branched.
  • nucleic acids can be a linear chain of nucleotides or the nucleic acids can be branched, e.g., such that the nucleic acids comprise one or more arms or branches of nucleotides.
  • the branched nucleic acids are repetitively branched to form higher ordered structures such as dendrimers and the like.
  • Nucleic acids, including nucleic acids with a phosphothioate backbone can include one or more reactive moieties.
  • the term reactive moiety includes any group capable of reacting with another molecule, e.g., a nucleic acid or polypeptide through covalent, non-covalent or other interactions.
  • the nucleic acid can include an amino acid reactive moiety that reacts with an amio acid on a protein or polypeptide through a covalent, non-covalent or other interaction.
  • nucleic acids containing known nucleotide analogs or modified backbone residues or linkages which are synthetic, naturally occurring, and non-naturally occurring, which have similar binding properties as the reference nucleic acid, and which are metabolized in a manner similar to the reference nucleotides.
  • Examples of such analogs include, without limitation, phosphodiester derivatives including, e.g., phosphoramidate, phosphorodiamidate, phosphorothioate (also known as phosphothioate), phosphorodithioate, phosphonocarboxylic acids, phosphonocarboxylates, phosphonoacetic acid, phosphonoformic acid, methyl phosphonate, boron phosphonate, or O-methylphosphoroamidite linkages (see Eckstein, Oligonucleotides and Analogues: A Practical Approach, Oxford University Press); and peptide nucleic acid backbones and linkages.
  • phosphodiester derivatives including, e.g., phosphoramidate, phosphorodiamidate, phosphorothioate (also known as phosphothioate), phosphorodithioate, phosphonocarboxylic acids, phosphonocarboxylates, phosphonoacetic acid, phosphonoformic acid, methyl phospho
  • nucleic acids include those with positive backbones; non-ionic backbones, modified sugars, and non-ribose backbones (e.g. phosphorodiamidate morpholino oligos or locked nucleic acids (LNA)), including those described in U.S. Pat. Nos. 5,235,033 and 5,034,506, and Chapters 6 and 7, ASC Symposium Series 580 , Carbohydrate Modifications in Antisense Research , Sanghui & Cook, eds. Nucleic acids containing one or more carbocyclic sugars are also included within one definition of nucleic acids.
  • LNA locked nucleic acids
  • Modifications of the ribose-phosphate backbone may be done for a variety of reasons, e.g., to increase the stability and half-life of such molecules in physiological environments or as probes on a biochip.
  • Mixtures of naturally occurring nucleic acids and analogs can be made; alternatively, mixtures of different nucleic acid analogs, and mixtures of naturally occurring nucleic acids and analogs may be made.
  • the internucleotide linkages in DNA are phosphodiester, phosphodiester derivatives, or a combination of both.
  • the range of values provided includes the specified value. As recognized by a person of ordinary skill in the art such specified value would reasonably include a standard deviation using measurements generally acceptable in the art. In certain embodiments, the standard deviation includes a range extending to +/ ⁇ 10% of the specified value.
  • polypeptide refers to a polymer of amino acid residues, wherein the polymer may be conjugated to a moiety that does not consist of amino acids.
  • the terms apply to amino acid polymers in which one or more amino acid residue is an artificial chemical mimetic of a corresponding naturally occurring amino acid, as well as to naturally occurring amino acid polymers and non-naturally occurring amino acid polymers.
  • the terms apply to macrocyclic peptides, peptides that have been modified with non-peptide functionality, peptidomimetics, polyamides, and macrolactams.
  • a “fusion protein” refers to a chimeric protein encoding two or more separate protein sequences that are recombinantly expressed as a single moiety.
  • peptidyl and “peptidyl moiety” means a monovalent peptide.
  • amino acid refers to naturally occurring and synthetic amino acids, as well as amino acid analogs and amino acid mimetics that function in a manner similar to the naturally occurring amino acids.
  • Naturally occurring amino acids are those encoded by the genetic code, as well as those amino acids that are later modified, e.g., hydroxyproline, ⁇ -carboxyglutamate, and O-phosphoserine.
  • Amino acid analogs refers to compounds that have the same basic chemical structure as a naturally occurring amino acid, i.e., an a carbon that is bound to a hydrogen, a carboxyl group, an amino group, and an R group, e.g., homoserine, norleucine, methionine sulfoxide, methionine methyl sulfonium. Such analogs have modified R groups (e.g., norleucine) or modified peptide backbones, but retain the same basic chemical structure as a naturally occurring amino acid.
  • Amino acid mimetics refers to chemical compounds that have a structure that is different from the general chemical structure of an amino acid, but that functions in a manner similar to a naturally occurring amino acid.
  • the terms “non-naturally occurring amino acid” and “unnatural amino acid” refer to amino acid analogs, synthetic amino acids, and amino acid mimetics which are not found in nature.
  • Amino acids may be referred to herein by either their commonly known three letter symbols or by the one-letter symbols recommended by the IUPAC-IUB Biochemical Nomenclature Commission. Nucleotides, likewise, may be referred to by their commonly accepted single-letter codes.
  • amino acid or nucleotide base “position” is denoted by a number that sequentially identifies each amino acid (or nucleotide base) in the reference sequence based on its position relative to the N-terminus (or 5′-end). Due to deletions, insertions, truncations, fusions, and the like that must be taken into account when determining an optimal alignment, in general the amino acid residue number in a test sequence determined by simply counting from the N-terminus will not necessarily be the same as the number of its corresponding position in the reference sequence. For example, in a case where a variant has a deletion relative to an aligned reference sequence, there will be no amino acid in the variant that corresponds to a position in the reference sequence at the site of deletion.
  • numbered with reference to or “corresponding to,” when used in the context of the numbering of a given amino acid or polynucleotide sequence refers to the numbering of the residues of a specified reference sequence when the given amino acid or polynucleotide sequence is compared to the reference sequence.
  • “Conservatively modified variants” applies to both amino acid and nucleic acid sequences. With respect to particular nucleic acid sequences, conservatively modified variants refers to those nucleic acids which encode identical or essentially identical amino acid sequences, or where the nucleic acid does not encode an amino acid sequence, to essentially identical sequences. Because of the degeneracy of the genetic code, a large number of functionally identical nucleic acids encode any given protein. For instance, the codons GCA, GCC, GCG and GCU all encode the amino acid alanine. Thus, at every position where an alanine is specified by a codon, the codon can be altered to any of the corresponding codons described without altering the encoded polypeptide.
  • nucleic acid variations are “silent variations,” which are one species of conservatively modified variations. Every nucleic acid sequence herein which encodes a polypeptide also describes every possible silent variation of the nucleic acid.
  • each codon in a nucleic acid except AUG, which is ordinarily the only codon for methionine, and TGG, which is ordinarily the only codon for tryptophan
  • TGG which is ordinarily the only codon for tryptophan
  • amino acid sequences one of skill will recognize that individual substitutions, deletions or additions to a nucleic acid, peptide, polypeptide, or protein sequence which alters, adds or deletes a single amino acid or a small percentage of amino acids in the encoded sequence is a “conservatively modified variant” where the alteration results in the substitution of an amino acid with a chemically similar amino acid. Conservative substitution tables providing functionally similar amino acids are well known in the art. Such conservatively modified variants are in addition to and do not exclude polymorphic variants, interspecies homologs, and alleles of the invention.
  • the following eight groups each contain amino acids that are conservative substitutions for one another: 1) Alanine (A), Glycine (G); 2) Aspartic acid (D), Glutamic acid (E); 3) Asparagine (N), Glutamine (Q); 4) Arginine (R), Lysine (K); 5) Isoleucine (I), Leucine (L), Methionine (M), Valine (V); 6) Phenylalanine (F), Tyrosine (Y), Tryptophan (W); 7) Serine (S), Threonine (T); and 8) Cysteine (C), Methionine (M).
  • Percentage of sequence identity is determined by comparing two optimally aligned sequences over a comparison window, wherein the portion of the polynucleotide or polypeptide sequence in the comparison window may comprise additions or deletions (i.e., gaps) as compared to the reference sequence (which does not comprise additions or deletions) for optimal alignment of the two sequences. The percentage is calculated by determining the number of positions at which the identical nucleic acid base or amino acid residue occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the window of comparison and multiplying the result by 100 to yield the percentage of sequence identity.
  • nucleic acids or polypeptide sequences refer to two or more sequences or subsequences that are the same or have a specified percentage of amino acid residues or nucleotides that are the same (i.e., 60% identity, optionally 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 99% identity over a specified region, e.g., of the entire polypeptide sequences of the invention or individual domains of the polypeptides of the invention), when compared and aligned for maximum correspondence over a comparison window, or designated region as measured using one of the following sequence comparison algorithms or by manual alignment and visual inspection.
  • sequences are then said to be “substantially identical.”
  • This definition also refers to the complement of a test sequence.
  • the identity exists over a region that is at least 50 nucleotides in length, or more preferably over a region that is 100 to 500 or 1000 or more nucleotides in length.
  • sequence comparison typically one sequence acts as a reference sequence, to which test sequences are compared.
  • test and reference sequences are entered into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated. Default program parameters can be used, or alternative parameters can be designated.
  • sequence comparison algorithm then calculates the percent sequence identities for the test sequences relative to the reference sequence, based on the program parameters.
  • a “comparison window”, as used herein, includes reference to a segment of any one of the number of contiguous positions selected from the group consisting of, e.g., a full length sequence or from 20 to 600, 50 to 200, or 100 to 150 amino acids or nucleotides in which a sequence may be compared to a reference sequence of the same number of contiguous positions after the two sequences are optimally aligned.
  • Methods of alignment of sequences for comparison are well known in the art.
  • Optimal alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith and Waterman (1970) Adv. Appl. Math. 2:482c, by the homology alignment algorithm of Needleman and Wunsch (1970) J. Mol. Biol.
  • HSPs high scoring sequence pairs
  • T is referred to as the neighborhood word score threshold (Altschul et al., supra). These initial neighborhood word hits act as seeds for initiating searches to find longer HSPs containing them. The word hits are extended in both directions along each sequence for as far as the cumulative alignment score can be increased. Cumulative scores are calculated using, for nucleotide sequences, the parameters M (reward score for a pair of matching residues; always >0) and N (penalty score for mismatching residues; always ⁇ 0). For amino acid sequences, a scoring matrix is used to calculate the cumulative score.
  • Extension of the word hits in each direction are halted when: the cumulative alignment score falls off by the quantity X from its maximum achieved value; the cumulative score goes to zero or below, due to the accumulation of one or more negative-scoring residue alignments; or the end of either sequence is reached.
  • the BLAST algorithm parameters W, T, and X determine the sensitivity and speed of the alignment.
  • the BLAST algorithm also performs a statistical analysis of the similarity between two sequences (see, e.g., Karlin and Altschul (1993) Proc. Natl. Acad. Sci. USA 90:5873-5787).
  • One measure of similarity provided by the BLAST algorithm is the smallest sum probability (P(N)), which provides an indication of the probability by which a match between two nucleotide or amino acid sequences would occur by chance.
  • P(N) the smallest sum probability
  • a nucleic acid is considered similar to a reference sequence if the smallest sum probability in a comparison of the test nucleic acid to the reference nucleic acid is less than 0.2, more preferably less than 0.01, and most preferably less than 0.001.
  • nucleic acid sequences or polypeptides are substantially identical is that the polypeptide encoded by the first nucleic acid is immunologically cross-reactive with the antibodies raised against the polypeptide encoded by the second nucleic acid, as described below.
  • a polypeptide is typically substantially identical to a second polypeptide, for example, where the two peptides differ only by conservative substitutions.
  • Another indication that two nucleic acid sequences are substantially identical is that the two molecules or their complements hybridize to each other under stringent conditions, as described below.
  • Yet another indication that two nucleic acid sequences are substantially identical is that the same primers can be used to amplify the sequence.
  • a “label” or a “detectable moiety” is a composition detectable by spectroscopic, photochemical, biochemical, immunochemical, chemical, or other physical means.
  • useful labels include 32 P, fluorescent dyes, electron-dense reagents, enzymes (e.g., as commonly used in an ELISA), biotin, digoxigenin, or haptens and proteins or other entities which can be made detectable, e.g., by incorporating a radiolabel into a peptide or antibody specifically reactive with a target peptide. Any appropriate method known in the art for conjugating an antibody to the label may be employed, e.g., using methods described in Hermanson, Bioconjugate Techniques 1996, Academic Press, Inc., San Diego.
  • a “bioactive moiety” as provided herein refers to a moiety that upon administration to a cell, tissue or organism has a detectable effect on the biological function of said cell, tissue or organism.
  • the detectable effect is a biological effect.
  • the detectable effect is a therapeutic effect.
  • the detectable effect is a diagnostic effect.
  • a “labeled protein or polypeptide” is one that is bound, either covalently, through a linker or a chemical bond, or noncovalently, through ionic, van der Waals, electrostatic, or hydrogen bonds to a label such that the presence of the labeled protein or polypeptide may be detected by detecting the presence of the label bound to the labeled protein or polypeptide.
  • methods using high affinity interactions may achieve the same results where one of a pair of binding partners binds to the other, e.g., biotin, streptavidin.
  • Bio sample refers to materials obtained from or derived from a subject or patient.
  • a biological sample includes sections of tissues such as biopsy and autopsy samples, and frozen sections taken for histological purposes.
  • samples include bodily fluids such as blood and blood fractions or products (e.g., serum, plasma, platelets, red blood cells, and the like), sputum, tissue, cultured cells (e.g., primary cultures, explants, and transformed cells) stool, urine, synovial fluid, joint tissue, synovial tissue, synoviocytes, fibroblast-like synoviocytes, macrophage-like synoviocytes, immune cells, hematopoietic cells, fibroblasts, macrophages, T cells, etc.
  • blood and blood fractions or products e.g., serum, plasma, platelets, red blood cells, and the like
  • sputum tissue
  • cultured cells e.g., primary cultures, explants, and transformed cells
  • a biological sample is typically obtained from a eukaryotic organism, such as a mammal such as a primate e.g., chimpanzee or human; cow; dog; cat; a rodent, e.g., guinea pig, rat, mouse; rabbit; or a bird; reptile; or fish.
  • a mammal such as a primate e.g., chimpanzee or human; cow; dog; cat; a rodent, e.g., guinea pig, rat, mouse; rabbit; or a bird; reptile; or fish.
  • a cell can be identified by well-known methods in the art including, for example, presence of an intact membrane, staining by a particular dye, ability to produce progeny or, in the case of a gamete, ability to combine with a second gamete to produce a viable offspring.
  • Cells may include prokaryotic and eukaryotic cells.
  • Prokaryotic cells include but are not limited to bacteria.
  • Eukaryotic cells include but are not limited to yeast cells and cells derived from plants and animals, for example mammalian, insect (e.g., spodoptera ) and human cells.
  • the word “expression” or “expressed” as used herein in reference to a gene means the transcriptional and/or translational product of that gene.
  • the level of expression of a DNA molecule in a cell may be determined on the basis of either the amount of corresponding mRNA that is present within the cell or the amount of protein encoded by that DNA produced by the cell (Sambrook et al., 1989, Molecular Cloning: A Laboratory Manual, 18.1-18.88).
  • transfected gene expression of a transfected gene can occur transiently or stably in a cell.
  • transient expression the transfected gene is not transferred to the daughter cell during cell division. Since its expression is restricted to the transfected cell, expression of the gene is lost over time.
  • stable expression of a transfected gene can occur when the gene is co-transfected with another gene that confers a selection advantage to the transfected cell.
  • selection advantage may be a resistance towards a certain toxin that is presented to the cell.
  • exogenous refers to a molecule or substance (e.g., nucleic acid or protein) that originates from outside a given cell or organism.
  • endogenous refers to a molecule or substance that is native to, or originates within, a given cell or organism.
  • transfection can be used interchangeably and are defined as a process of introducing a nucleic acid molecule and/or a protein to a cell.
  • Nucleic acids may be introduced to a cell using non-viral or viral-based methods.
  • the nucleic acid molecule can be a sequence encoding complete proteins or functional portions thereof.
  • a nucleic acid vector comprising the elements necessary for protein expression (e.g., a promoter, transcription start site, etc.).
  • Non-viral methods of transfection include any appropriate method that does not use viral DNA or viral particles as a delivery system to introduce the nucleic acid molecule into the cell.
  • Exemplary non-viral transfection methods include calcium phosphate transfection, liposomal transfection, nucleofection, sonoporation, transfection through heat shock, magnetifection and electroporation.
  • any useful viral vector can be used in the methods described herein.
  • examples of viral vectors include, but are not limited to retroviral, adenoviral, lentiviral and adeno-associated viral vectors.
  • the nucleic acid molecules are introduced into a cell using a retroviral vector following standard procedures well known in the art.
  • the terms “transfection” or “transduction” also refer to introducing proteins into a cell from the external environment.
  • transduction or transfection of a protein relies on attachment of a peptide or protein capable of crossing the cell membrane to the protein of interest. See, e.g., Ford et al. (2001) Gene Therapy 8:1-4 and Prochiantz (2007) Nat. Methods 4:119-20.
  • a nucleic acid is “operably linked” when it is placed into a functional relationship with another nucleic acid sequence.
  • DNA for a presequence or secretory leader is operably linked to DNA for a polypeptide if it is expressed as a preprotein that participates in the secretion of the polypeptide;
  • a promoter or enhancer is operably linked to a coding sequence if it affects the transcription of the sequence; or
  • a ribosome binding site is operably linked to a coding sequence if it is positioned so as to facilitate translation.
  • “operably linked” means that the DNA sequences being linked are near each other, and, in the case of a secretory leader, contiguous and in reading phase. However, enhancers do not have to be contiguous. Linking is accomplished by ligation at convenient restriction sites. If such sites do not exist, the synthetic oligonucleotide adaptors or linkers are used in accordance with conventional practice.
  • gene means the segment of DNA involved in producing a protein; it includes regions preceding and following the coding region (leader and trailer) as well as intervening sequences (introns) between individual coding segments (exons).
  • the leader, the trailer as well as the introns include regulatory elements that are necessary during the transcription and the translation of a gene.
  • a “protein gene product” is a protein expressed from a particular gene.
  • the named protein includes any of the protein's naturally occurring forms, or variants or homologs that maintain the protein transcription factor activity (e.g., within at least 50%, 80%, 90%, 95%, 96%, 97%, 98%, 99% or 100% activity compared to the native protein).
  • variants or homologs have at least 90%, 95%, 96%, 97%, 98%, 99% or 100% amino acid sequence identity across the whole sequence or a portion of the sequence (e.g. a 50, 100, 150 or 200 continuous amino acid portion) compared to a naturally occurring form.
  • the protein is the protein as identified by its NCBI sequence reference.
  • the protein is the protein as identified by its NCBI sequence reference or functional fragment or homolog thereof.
  • a “methylcytosine dioxygenase TET1” or “TET1” protein as referred to herein includes any of the recombinant or naturally-occurring forms of the TET1 dioxygenase or variants or homologs thereof that maintain TET1 dioxygenase enzyme activity (e.g. within at least 50%, 80%, 90%, 95%, 96%, 97%, 98%, 99% or 100% activity compared to TET1).
  • the variants or homologs have at least 90%, 95%, 96%, 97%, 98%, 99% or 100% amino acid sequence identity across the whole sequence or a portion of the sequence (e.g.
  • the TET1 protein is substantially identical to the protein identified by the UniProt reference number Q8NFU7 or a variant or homolog having substantial identity thereto.
  • a “methylcytosine dioxygenase TET2” or “TET2” protein as referred to herein includes any of the recombinant or naturally-occurring forms of the TET2 dioxygenase or variants or homologs thereof that maintain TET2 dioxygenase enzyme activity (e.g. within at least 50%, 80%, 90%, 95%, 96%, 97%, 98%, 99% or 100% activity compared to TET2).
  • the variants or homologs have at least 90%, 95%, 96%, 97%, 98%, 99% or 100% amino acid sequence identity across the whole sequence or a portion of the sequence (e.g.
  • the TET2 protein is substantially identical to the protein identified by the UniProt reference number Q6N021 or a variant or homolog having substantial identity thereto.
  • a “methylcytosine dioxygenase TET3” or “TET3” protein as referred to herein includes any of the recombinant or naturally-occurring forms of the TET3 dioxygenase or variants or homologs thereof that maintain TET3 dioxygenase enzyme activity (e.g. within at least 50%, 80%, 90%, 95%, 96%, 97%, 98%, 99% or 100% activity compared to TET3).
  • the variants or homologs have at least 90%, 95%, 96%, 97%, 98%, 99% or 100% amino acid sequence identity across the whole sequence or a portion of the sequence (e.g.
  • the TET3 protein is substantially identical to the protein identified by the UniProt reference number 043151 or a variant or homolog having substantial identity thereto.
  • TET1 The TET family of enzymes (e.g., TET1, TET2, TET3) catalyze the conversion of 5mC to 5hmC as well as its further oxidation into 5-formylcytosine (5fC) and 5 carboxylcytosine (5caC) (Ito et al., 2010).
  • TET dioxygenases oxidize the methyl group at C5 to yield 5-hydroxymethyl-(hmC) (Kriaucionis and Heintz, 2009), 5-formyl-(fC) (Maiti and Drohat, 2011) and 5-carboxylcytosine (caC) (He et al., 2011).
  • a “Growth Arrest and DNA-Damage-inducible Alpha” or “GADD45A” protein as referred to herein includes any of the recombinant or naturally-occurring forms of the GADD45A protein or variants or homologs thereof that maintain GADD45A protein activity/function (e.g. within at least 50%, 80%, 90%, 95%, 96%, 97%, 98%, 99% or 100% activity compared to GADD45A).
  • the variants or homologs have at least 90%, 95%, 96%, 97%, 98%, 99% or 100% amino acid sequence identity across the whole sequence or a portion of the sequence (e.g.
  • the GADD45A protein is substantially identical to the protein identified by the UniProt reference number P24522 or a variant or homolog having substantial identity thereto.
  • GADD45A forms part of the regulatory protein family in NER- and BER-based DNA demethylation (e.g., Growth Arrest and DNA Damage Protein 45a,-b,-g). GADD45 proteins are devoid of any obvious enzymatic activity and act as adapters between demethylation target genes and the DNA repair machinery. Without being bound to any particular theory, it is generally believed that GADD45a and TET1 directly bind each other.
  • NEIL2 glycosylase or “NEIL2” protein as referred to herein includes any of the recombinant or naturally-occurring forms of the NEIL2 glycosylase or variants or homologs thereof that maintain NEIL2 glycosylase enzyme activity (e.g. within at least 50%, 80%, 90%, 95%, 96%, 97%, 98%, 99% or 100% activity compared to NEIL2).
  • the variants or homologs have at least 90%, 95%, 96%, 97%, 98%, 99% or 100% amino acid sequence identity across the whole sequence or a portion of the sequence (e.g.
  • the NEIL2 glycosylase is substantially identical to the protein identified by the UniProt reference number Q969S2 or a variant or homolog having substantial identity thereto.
  • NEIL glycosylases are capable of excising formylated and carboxylated cytosine in chromatins. NEIL glycosylases can also initiate BER after TET-mediated cytosine oxidation. NEIL glycosylases may therefore constitute an alternative pathway for active demethylation and reactivation of epigenetically silenced genes.
  • a “DNMT3a”, “DNA (cytosine-5)-methyltransferase 3A” or “DNA methyltransferase 3a” protein as referred to herein includes any of the recombinant or naturally-occurring forms of the DNMT3a enzyme or variants or homologs thereof that maintain DNMT3a enzyme activity (e.g. within at least 50%, 80%, 90%, 95%, 96%, 97%, 98%, 99% or 100% activity compared to DNMT3a).
  • the variants or homologs have at least 90%, 95%, 96%, 97%, 98%, 99% or 100% amino acid sequence identity across the whole sequence or a portion of the sequence (e.g.
  • the DNMT3a protein is substantially identical to the protein identified by the UniProt reference number Q9Y6K1 or a variant or homolog having substantial identity thereto.
  • a “DNMT3L”, “DNA (cytosine-5)-methyltransferase 3L” or “DNA methyltransferase 3L” protein as referred to herein includes any of the recombinant or naturally-occurring forms of the DNMT3L enzyme or variants or homologs thereof that maintain DNMT3L enzyme activity (e.g. within at least 50%, 80%, 90%, 95%, 96%, 97%, 98%, 99% or 100% activity compared to DNMT3L).
  • the variants or homologs have at least 90%, 95%, 96%, 97%, 98%, 99% or 100% amino acid sequence identity across the whole sequence or a portion of the sequence (e.g.
  • the DNMT3L protein is substantially identical to the protein identified by the UniProt reference number Q9UJW3 or a variant or homolog having substantial identity thereto.
  • MLH1 (MutL homolog 1) is a human homolog of the E. coli DNA mismatch repair gene, mutL, which mediates protein-protein interactions during mismatch recognition, strand discrimination, and strand removal.
  • the human gene, hMLH1 is located on Chromosome 3. Defects in hMLH1 are commonly associated with the microsatellite instability (MSI) observed in hereditary nonpolyposis colorectal cancer (HNPCC).
  • hMLH1 deficient expression of the hMLH1 has been observed in many cancers, including stomach cancer (including foveolar type tumors, and stomach cancer in high-incidence Kashmir Valley), esophageal cancer, head and neck squamous cell carcinoma (HNSCC), non-small cell lung cancer (NSCLC), and colorectal cancer (such as HNPCC).
  • stomach cancer including foveolar type tumors, and stomach cancer in high-incidence Kashmir Valley
  • esophageal cancer head and neck squamous cell carcinoma (HNSCC), non-small cell lung cancer (NSCLC), and colorectal cancer (such as HNPCC).
  • HNSCC head and neck squamous cell carcinoma
  • NSCLC non-small cell lung cancer
  • colorectal cancer colorectal cancer
  • Cas9 protein as referred to herein includes a nuclease-deficient wt Cas9 protein in which one of the two catalytic sites for endonuclease activity (RuvC and HNH) is defective or lacks activity, and a dCas9 protein in which both catalytic sites for endonuclease activity are defective or lack activity.
  • the Cas9 protein is a nuclease-deficient wt Cas9 protein.
  • the Cas9 protein lacks nuclease activity or is nuclease-deficient.
  • the Cas9 protein is a nickase (e.g., for example, the nickase can be a Cas9 Nickase with a mutation at a position corresponding to D10A of S. pyogenes Cas9; or the nickase can be a Cas9 Nickase with a mutation at a position corresponding to H840A of S. pyogenes Cas9).
  • the Cas9 protein is a dCas9 (e.g., a dCas9 with mutations at positions corresponding to D10A and H840A of S. pyogenes Cas9).
  • a “modified Cas9 protein” refers to a Cas9 that is not a wt Cas9 protein.
  • the modified Cas9 protein is a dCas9.
  • the modified Cas9 protein is a nickase.
  • the modified Cas9 protein (nickase or dCas9) may have reduced nuclease activity, or lacks nuclease activity at one or both endonuclease catalytic sites.
  • the dCas9 protein lacks endonuclease activity due to point mutations at both endonuclease catalytic sites (RuvC and HNH) of wild type Cas9.
  • the point mutations may be D10A and H840A, respectively, in the S. pyogenes Cas9, or in the corresponding residues in species other than S. pyogenes .
  • the modified Cas9 protein lacks endonuclease catalytic activity at one but not both sites of wt Cas9, and is able to create a nick on a dsDNA target (Cas9 nickase).
  • the Cas9 nickase protein lacks endonuclease activity due to point mutations at one endonuclease catalytic sites (RuvC and HNH) of wild type Cas9.
  • the point mutations can be D10A or H840A.
  • the dCas9 protein is nuclease-deficient but retains DNA-binding ability when complexed with the polynucleotide.
  • the dCas9 protein lacks endonuclease activity due to point mutations at both endonuclease catalytic sites (RuvC and HNH) of wild type Cas9.
  • the point mutations can be D10A and H840A.
  • the modified Cas9 protein has reduced or lacks endonuclease (e.g., endodeoxyribonuclease) activity.
  • a modified Cas9 suitable for use in a method of the present invention may be a Cas9 nickase, or exhibits less than 20%, less than 15%, less than 10%, less than 5%, less than 1%, or less than 0.1%, of the endonuclease (e.g., endodeoxyribonuclease) activity of a wild-type Cas9 polypeptide, e.g., a wild-type Cas9 polypeptide comprising an amino acid sequence as depicted in FIG.
  • the dCas9 has substantially no detectable endonuclease (e.g., endodeoxyribonuclease) activity.
  • a dCas9 has reduced catalytic activity
  • a Cas9 protein has a D10, G12, G17, E762, H840, N854, N863, H982, H983, A984, D986, and/or a A987 mutation, e.g., D10A, G12A, G17A, E762A, H840A, N854A, N863A, H982A, H983A, A984A, and/or D986A
  • the polypeptide can still bind to target DNA in a site-specific manner, because it is still guided to a target polynucleotide sequence by a DNA-targeting sequence of the subject polynucleotide, as long as it retains the ability to interact with the Cas9-binding sequence of the subject polynucleotide.
  • the nuclease-deficient wt Cas9 protein (e.g., nuclease-deficient wt Cas9 protein or dCas9 protein) is optionally a fusion polypeptide including: i) a Cas9 protein (e.g., nuclease-deficient wt Cas9 protein or dCas9 protein) a covalently linked heterologous polypeptide (also referred to as a “fusion partner”), which can be the same or different from the fusion partner fused to the PUF domains (infra).
  • a Cas9 protein e.g., nuclease-deficient wt Cas9 protein or dCas9 protein
  • a covalently linked heterologous polypeptide also referred to as a “fusion partner”
  • “Patient” or “subject in need thereof” refers to a living organism suffering from or prone to a disease or condition that can be treated by administration of a composition or pharmaceutical composition as provided herein.
  • Non-limiting examples include humans, other mammals, bovines, rats, mice, dogs, monkeys, goat, sheep, cows, deer, and other non-mammalian animals.
  • a patient is human.
  • the terms “disease” or “condition” refer to a state of being or health status of a patient or subject capable of being treated with a compound, pharmaceutical composition, or method provided herein.
  • the disease is cancer (e.g. lung cancer, ovarian cancer, osteosarcoma, bladder cancer, cervical cancer, liver cancer, kidney cancer, skin cancer (e.g., Merkel cell carcinoma), testicular cancer, leukemia, lymphoma (Mantel cell lymphoma), head and neck cancer, colorectal cancer, prostate cancer, pancreatic cancer, melanoma, breast cancer, neuroblastoma).
  • cancer e.g. lung cancer, ovarian cancer, osteosarcoma, bladder cancer, cervical cancer, liver cancer, kidney cancer, skin cancer (e.g., Merkel cell carcinoma), testicular cancer, leukemia, lymphoma (Mantel cell lymphoma), head and neck cancer, colorectal cancer, prostate cancer, pancreatic cancer, melanoma, breast cancer, neuroblastoma).
  • cancer refers to all types of cancer, neoplasm or malignant tumors found in mammals, including leukemias, lymphomas, melanomas, neuroendocrine tumors, carcinomas and sarcomas.
  • Exemplary cancers that may be treated with a compound, pharmaceutical composition, or method provided herein include lymphoma (e.g., Mantel cell lymphoma, follicular lymphoma, diffuse large B-cell lymphoma, marginal zona lymphoma, Burkitt's lymphoma), sarcoma, bladder cancer, bone cancer, brain tumor, cervical cancer, colon cancer, esophageal cancer, gastric cancer, head and neck cancer, kidney cancer, myeloma, thyroid cancer, leukemia, prostate cancer, breast cancer (e.g., lymphoma (e.g., Mantel cell lymphoma, follicular lymphoma, diffuse large B-cell lymphoma, marginal zona lymphoma, Burkitt's lymphoma), sarcoma, bladder cancer, bone cancer, brain tumor, cervical cancer, colon cancer, esophageal cancer, gastric cancer, head and neck cancer, kidney cancer, myeloma, thyroid cancer, leukemia, prostate cancer
  • ER positive triple negative
  • ER negative chemotherapy resistant
  • herceptin resistant HER2 positive
  • doxorubicin resistant tamoxifen resistant
  • ductal carcinoma lobular carcinoma, primary, metastatic
  • ovarian cancer pancreatic cancer
  • liver cancer e.g., hepatocellular carcinoma
  • lung cancer e.g.
  • non-small cell lung carcinoma squamous cell lung carcinoma, adenocarcinoma, large cell lung carcinoma, small cell lung carcinoma, carcinoid, sarcoma), glioblastoma multiforme, glioma, melanoma, prostate cancer, castration-resistant prostate cancer, breast cancer, triple negative breast cancer, glioblastoma, ovarian cancer, lung cancer, squamous cell carcinoma (e.g., head, neck, or esophagus), colorectal cancer, leukemia (e.g., lymphoblastic leukemia, chronic lymphocytic leukemia, hairy cell leukemia), acute myeloid leukemia, lymphoma, B cell lymphoma, or multiple myeloma.
  • leukemia e.g., lymphoblastic leukemia, chronic lymphocytic leukemia, hairy cell leukemia
  • acute myeloid leukemia lymphoma, B cell lymphoma, or multiple
  • Additional examples include, cancer of the thyroid, endocrine system, brain, breast, cervix, colon, head & neck, esophagus, liver, kidney, lung, non-small cell lung, melanoma, mesothelioma, ovary, sarcoma, stomach, uterus or Medulloblastoma, Hodgkin's Disease, Non-Hodgkin's Lymphoma, multiple myeloma, neuroblastoma, glioma, glioblastoma multiforme, ovarian cancer, rhabdomyosarcoma, primary thrombocytosis, primary macroglobulinemia, primary brain tumors, cancer, malignant pancreatic insulanoma, malignant carcinoid, urinary bladder cancer, premalignant skin lesions, testicular cancer, lymphomas, thyroid cancer, neuroblastoma, esophageal cancer, genitourinary tract cancer, malignant hypercalcemia, endometrial
  • a disease e.g., cancer (e.g. leukemia, lymphoma, B cell lymphoma, or multiple myeloma)
  • cancer e.g. leukemia, lymphoma, B cell lymphoma, or multiple myeloma
  • the disease e.g. cancer, (e.g. leukemia, lymphoma, B cell lymphoma, or multiple myeloma)
  • a symptom of the disease is caused by (in whole or in part) the substance or substance activity or function.
  • treatment or “treating,” or “palliating” or “ameliorating” are used interchangeably herein. These terms refer to an approach for obtaining beneficial or desired results including but not limited to therapeutic benefit and/or a prophylactic benefit.
  • therapeutic benefit is meant eradication or amelioration of the underlying disorder being treated.
  • a therapeutic benefit is achieved with the eradication or amelioration of one or more of the physiological symptoms associated with the underlying disorder such that an improvement is observed in the patient, notwithstanding that the patient may still be afflicted with the underlying disorder.
  • the compositions may be administered to a patient at risk of developing a particular disease, or to a patient reporting one or more of the physiological symptoms of a disease, even though a diagnosis of this disease may not have been made.
  • Treatment includes preventing the disease, that is, causing the clinical symptoms of the disease not to develop by administration of a protective composition prior to the induction of the disease; suppressing the disease, that is, causing the clinical symptoms of the disease not to develop by administration of a protective composition after the inductive event but prior to the clinical appearance or reappearance of the disease; inhibiting the disease, that is, arresting the development of clinical symptoms by administration of a protective composition after their initial appearance; preventing re-occurring of the disease and/or relieving the disease, that is, causing the regression of clinical symptoms by administration of a protective composition after their initial appearance.
  • certain methods herein treat cancer (e.g. lung cancer, ovarian cancer, osteosarcoma, bladder cancer, cervical cancer, liver cancer, kidney cancer, skin cancer (e.g., Merkel cell carcinoma), testicular cancer, leukemia, lymphoma, head and neck cancer, colorectal cancer, prostate cancer, pancreatic cancer, melanoma, breast cancer, neuroblastoma).
  • cancer e.g. lung cancer, ovarian cancer, osteosarcoma, bladder cancer, cervical cancer, liver cancer, kidney cancer, skin cancer (e.g., Merkel cell carcinoma), testicular cancer, leukemia, lymphoma, head and neck cancer, colorectal cancer, prostate cancer, pancreatic cancer, melanoma, breast cancer, neuroblastoma.
  • cancer e.g. lung cancer, ovarian cancer, osteosarcoma, bladder cancer, cervical cancer, liver cancer, kidney cancer, skin cancer (e.g., Merkel cell carcinoma), testicular cancer, leukemia, lymphoma, head and neck
  • lung cancer ovarian cancer, osteosarcoma, bladder cancer, cervical cancer, liver cancer, kidney cancer, skin cancer (e.g., Merkel cell carcinoma), testicular cancer, leukemia, lymphoma, head and neck cancer, colorectal cancer, prostate cancer, pancreatic cancer, melanoma, breast cancer, neuroblastoma) would be known or may be determined by a person of ordinary skill in the art.
  • skin cancer e.g., Merkel cell carcinoma
  • testicular cancer e.g., leukemia, lymphoma, head and neck cancer, colorectal cancer, prostate cancer, pancreatic cancer, melanoma, breast cancer, neuroblastoma
  • treatment refers to a method of reducing the effects of one or more symptoms of a disease or condition characterized by expression of the protease or symptom of the disease or condition characterized by expression of the protease.
  • treatment can refer to a 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, or 100% reduction in the severity of an established disease, condition, or symptom of the disease or condition.
  • a method for treating a disease is considered to be a treatment if there is a 10% reduction in one or more symptoms of the disease in a subject as compared to a control.
  • the reduction can be a 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100%, or any percent reduction in between 10% and 100% as compared to native or control levels. It is understood that treatment does not necessarily refer to a cure or complete ablation of the disease, condition, or symptoms of the disease or condition. Further, as used herein, references to decreasing, reducing, or inhibiting include a change of 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or greater as compared to a control level and such terms can include but do not necessarily include complete elimination.
  • an “effective amount” is an amount sufficient to accomplish a stated purpose (e.g. achieve the effect for which it is administered, treat a disease, reduce enzyme activity, reduce one or more symptoms of a disease or condition).
  • An example of an “effective amount” is an amount sufficient to contribute to the treatment, prevention, or reduction of a symptom or symptoms of a disease, which could also be referred to as a “therapeutically effective amount.”
  • a “reduction” of a symptom or symptoms means decreasing of the severity or frequency of the symptom(s), or elimination of the symptom(s).
  • a “prophylactically effective amount” of a drug is an amount of a drug that, when administered to a subject, will have the intended prophylactic effect, e.g., preventing or delaying the onset (or reoccurrence) of an injury, disease, pathology or condition, or reducing the likelihood of the onset (or reoccurrence) of an injury, disease, pathology, or condition, or their symptoms.
  • the full prophylactic effect does not necessarily occur by administration of one dose, and may occur only after administration of a series of doses.
  • a prophylactically effective amount may be administered in one or more administrations.
  • An “activity decreasing amount,” as used herein, refers to an amount of antagonist required to decrease the activity of an enzyme or protein relative to the absence of the antagonist.
  • a “function disrupting amount,” as used herein, refers to the amount of antagonist required to disrupt the function of an enzyme or protein relative to the absence of the antagonist.
  • Guidance can be found in the literature for appropriate dosages for given classes of pharmaceutical products. For example, for the given parameter, an effective amount will show an increase or decrease of at least 5%, 10%, 15%, 20%, 25%, 40%, 50%, 60%, 75%, 80%, 90%, or at least 100%. Efficacy can also be expressed as “-fold” increase or decrease. For example, a therapeutically effective amount can have at least a 1.2-fold, 1.5-fold, 2-fold, 5-fold, or more effect over a control.
  • administering means oral administration, administration as a suppository, topical contact, intravenous, intraperitoneal, intramuscular, intralesional, intrathecal, intranasal or subcutaneous administration, or the implantation of a slow-release device, e.g., a mini-osmotic pump, to a subject.
  • Administration is by any route, including parenteral and transmucosal (e.g., buccal, sublingual, palatal, gingival, nasal, vaginal, rectal, or transdermal).
  • Parenteral administration includes, e.g., intravenous, intramuscular, intra-arteriole, intradermal, subcutaneous, intraperitoneal, intraventricular, and intracranial.
  • compositions described herein are administered at the same time, just prior to, or just after the administration of one or more additional therapies, for example cancer therapies such as chemotherapy, hormonal therapy, radiotherapy, or immunotherapy.
  • additional therapies such as chemotherapy, hormonal therapy, radiotherapy, or immunotherapy.
  • the compounds of the invention can be administered alone or can be co-administered to the patient.
  • Co-administration is meant to include simultaneous or sequential administration of the compounds individually or in combination (more than one compound).
  • the preparations can also be combined, when desired, with other active substances (e.g. to reduce metabolic degradation).
  • compositions of the present invention can be delivered by transdermally, by a topical route, formulated as applicator sticks, solutions, suspensions, emulsions, gels, creams, ointments, pastes, jellies, paints, powders, and aerosols.
  • Formulations suitable for oral administration can consist of (a) liquid solutions, such as an effective amount of the complexes provided herein suspended in diluents, such as water, saline or PEG 400; (b) capsules, sachets or tablets, each containing a predetermined amount of the active ingredient, as liquids, solids, granules or gelatin; (c) suspensions in an appropriate liquid; and (d) suitable emulsions.
  • Tablet forms can include one or more of lactose, sucrose, mannitol, sorbitol, calcium phosphates, corn starch, potato starch, microcrystalline cellulose, gelatin, colloidal silicon dioxide, talc, magnesium stearate, stearic acid, and other excipients, colorants, fillers, binders, diluents, buffering agents, moistening agents, preservatives, flavoring agents, dyes, disintegrating agents, and pharmaceutically compatible carriers.
  • Lozenge forms can comprise the active ingredient in a flavor, e.g., sucrose, as well as pastilles comprising the active ingredient in an inert base, such as gelatin and glycerin or sucrose and acacia emulsions, gels, and the like containing, in addition to the active ingredient, carriers known in the art.
  • a flavor e.g., sucrose
  • an inert base such as gelatin and glycerin or sucrose and acacia emulsions, gels, and the like containing, in addition to the active ingredient, carriers known in the art.
  • compositions can also include large, slowly metabolized macromolecules such as proteins, polysaccharides such as chitosan, polylactic acids, polyglycolic acids and copolymers (such as latex functionalized SepharoseTM, agarose, cellulose, and the like), polymeric amino acids, amino acid copolymers, and lipid aggregates (such as oil droplets or liposomes). Additionally, these carriers can function as immunostimulating agents (i.e., adjuvants).
  • Suitable formulations for rectal administration include, for example, suppositories, which consist of the packaged nucleic acid with a suppository base.
  • Suitable suppository bases include natural or synthetic triglycerides or paraffin hydrocarbons.
  • gelatin rectal capsules which consist of a combination of the compound of choice with a base, including, for example, liquid triglycerides, polyethylene glycols, and paraffin hydrocarbons.
  • Formulations suitable for parenteral administration include aqueous and non-aqueous, isotonic sterile injection solutions, which can contain antioxidants, buffers, bacteriostats, and solutes that render the formulation isotonic with the blood of the intended recipient, and aqueous and non-aqueous sterile suspensions that can include suspending agents, solubilizers, thickening agents, stabilizers, and preservatives.
  • compositions can be administered, for example, by intravenous infusion, orally, topically, intraperitoneally, intravesically or intrathecally.
  • Parenteral administration, oral administration, and intravenous administration are the preferred methods of administration.
  • the formulations of compounds can be presented in unit-dose or multi-dose sealed containers, such as ampules and vials.
  • Injection solutions and suspensions can be prepared from sterile powders, granules, and tablets of the kind previously described.
  • Cells transduced by nucleic acids for ex vivo therapy can also be administered intravenously or parenterally as described above.
  • the pharmaceutical preparation is preferably in unit dosage form.
  • the preparation is subdivided into unit doses containing appropriate quantities of the active component.
  • the unit dosage form can be a packaged preparation, the package containing discrete quantities of preparation, such as packeted tablets, capsules, and powders in vials or ampoules.
  • the unit dosage form can be a capsule, tablet, cachet, or lozenge itself, or it can be the appropriate number of any of these in packaged form.
  • the composition can, if desired, also contain other compatible therapeutic agents.
  • the combined administration contemplates co-administration, using separate formulations or a single pharmaceutical formulation, and consecutive administration in either order, wherein preferably there is a time period while both (or all) active agents simultaneously exert their biological activities.
  • Effective doses of the compositions provided herein vary depending upon many different factors, including means of administration, target site, physiological state of the patient, whether the patient is human or an animal, other medications administered, and whether treatment is prophylactic or therapeutic. However, a person of ordinary skill in the art would immediately recognize appropriate and/or equivalent doses looking at dosages of approved compositions for treating and preventing cancer for guidance.
  • “Pharmaceutically acceptable excipient” and “pharmaceutically acceptable carrier” refer to a substance that aids the administration of an active agent to and absorption by a subject and can be included in the compositions of the present invention without causing a significant adverse toxicological effect on the patient.
  • Non-limiting examples of pharmaceutically acceptable excipients include water, NaCl, normal saline solutions, lactated Ringer's, normal sucrose, normal glucose, binders, fillers, disintegrants, lubricants, coatings, sweeteners, flavors, salt solutions (such as Ringer's solution), alcohols, oils, gelatins, carbohydrates such as lactose, amylose or starch, fatty acid esters, hydroxymethycellulose, polyvinyl pyrrolidine, and colors, and the like.
  • Such preparations can be sterilized and, if desired, mixed with auxiliary agents such as lubricants, preservatives, stabilizers, wetting agents, emulsifiers, salts for influencing osmotic pressure, buffers, coloring, and/or aromatic substances, and the like, that do not deleteriously react with the compounds of the invention.
  • auxiliary agents such as lubricants, preservatives, stabilizers, wetting agents, emulsifiers, salts for influencing osmotic pressure, buffers, coloring, and/or aromatic substances, and the like.
  • pharmaceutically acceptable salt refers to salts derived from a variety of organic and inorganic counter ions well known in the art and include, by way of example only, sodium, potassium, calcium, magnesium, ammonium, tetraalkylammonium, and the like; and when the molecule contains a basic functionality, salts of organic or inorganic acids, such as hydrochloride, hydrobromide, tartrate, mesylate, acetate, maleate, oxalate and the like.
  • preparation is intended to include the formulation of the active compound with encapsulating material as a carrier providing a capsule in which the active component with or without other carriers, is surrounded by a carrier, which is thus in association with it.
  • carrier providing a capsule in which the active component with or without other carriers, is surrounded by a carrier, which is thus in association with it.
  • cachets and lozenges are included. Tablets, powders, capsules, pills, cachets, and lozenges can be used as solid dosage forms suitable for oral administration.
  • the pharmaceutical preparation is optionally in unit dosage form.
  • the preparation is subdivided into unit doses containing appropriate quantities of the active component.
  • the unit dosage form can be a packaged preparation, the package containing discrete quantities of preparation, such as packeted tablets, capsules, and powders in vials or ampoules.
  • the unit dosage form can be a capsule, tablet, cachet, or lozenge itself, or it can be the appropriate number of any of these in packaged form.
  • the unit dosage form can be of a frozen dispersion.
  • compositions of the present invention may additionally include components to provide sustained release and/or comfort.
  • Such components include high molecular weight, anionic mucomimetic polymers, gelling polysaccharides and finely-divided drug carrier substrates. These components are discussed in greater detail in U.S. Pat. Nos. 4,911,920; 5,403,841; 5,212,162; and 4,861,760. The entire contents of these patents are incorporated herein by reference in their entirety for all purposes.
  • the compositions of the present invention can also be delivered as microspheres for slow release in the body.
  • microspheres can be administered via intradermal injection of drug-containing microspheres, which slowly release subcutaneously (see Rao, J. Biomater Sci. Polym . Ed.
  • the formulations of the compositions of the present invention can be delivered by the use of liposomes which fuse with the cellular membrane or are endocytosed, i.e., by employing receptor ligands attached to the liposome, that bind to surface membrane protein receptors of the cell resulting in endocytosis.
  • compositions of the present invention can focus the delivery of the compositions of the present invention into the target cells in vivo.
  • the compositions of the present invention can also be delivered as nanoparticles.
  • the polynucleotides may include a stability control sequence (e.g., transcriptional terminator segment) which influences the stability of the respective polynucleotide it forms part of (e.g., an RNA (e.g., a subject polynucleotide).
  • a stability control sequence e.g., transcriptional terminator segment
  • transcriptional terminator segment i.e., a transcription termination sequence
  • a transcriptional terminator segment of a subject polynucleotide can have a total length of from 10 nucleotides to 100 nucleotides, e.g., from 10 nucleotides (nt) to 20 nt, from 20 nt to 30 nt, from 30 nt to 40 nt, from 40 nt to 50 nt, from 50 nt to 60 nt, from 60 nt to 70 nt, from 70 nt to 80 nt, from 80 nt to 90 nt, or from 90 nt to 100 nt.
  • 10 nucleotides (nt) to 20 nt from 20 nt to 30 nt, from 30 nt to 40 nt, from 40 nt to 50 nt, from 50 nt to 60 nt, from 60 nt to 70 nt, from 70 nt to 80 nt, from 80 nt to 90 nt, or from 90 nt to 100
  • the transcriptional terminator segment can have a length of from 15 nucleotides (nt) to 80 nt, from 15 nt to 50 nt, from 15 nt to 40 nt, from 15 nt to 30 nt or from 15 nt to 25 nt.
  • the transcription termination sequence is one that is functional in a eukaryotic cell. In some cases, the transcription termination sequence is one that is functional in a prokaryotic cell.
  • a stability control sequence e.g., transcriptional termination segment, or in any segment of the DNA-targeting RNA to provide for increased stability
  • nucleotide sequences that can be included in a stability control sequence include sequences set forth in SEQ ID NO: 683-696 of WO 2013/176772 (incorporated herein by reference in its entirety and for all purposes), see, for example, SEQ ID NO: 795 of WO 2013/176772, a Rho-independent transcription termination site.
  • the demethylation of methylation protein conjugates provided herein are targeted by the DNA-targeting sequence of the subject polynucleotide to a specific location (i.e., target polynucleotide sequence) in the target DNA, and exert locus-specific modification of the target DNA (e.g., modifying the local chromatin status).
  • the changes are transient (e.g., transcription repression or activation).
  • the changes are inheritable (e.g., when epigenetic modifications are made to the target DNA or to proteins associated with the target DNA, e.g., nucleosomal histones).
  • the biological effects of a method using the complexes provided herein including embodiments thereof can be detected by any convenient method (e.g., gene expression assays; chromatin-based assays, e.g., Chromatin immunoPrecipitation (ChiP), Chromatin in vivo Assay (CiA), etc.; and the like).
  • any convenient method e.g., gene expression assays; chromatin-based assays, e.g., Chromatin immunoPrecipitation (ChiP), Chromatin in vivo Assay (CiA), etc.; and the like).
  • a transcription modulation method of the present invention provides for selective modulation (e.g., reduction or increase) of a target nucleic acid in a host cell.
  • selective modulation e.g., reduction or increase
  • “selective” reduction of transcription of a target nucleic acid reduces transcription of the target nucleic acid by at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or greater than 90%, compared to the level of transcription of the target nucleic acid in the absence of a DNA-targeting sequence/modified Cas9 polypeptide/PUF domain-fusion complex.
  • Selective reduction of transcription of a target nucleic acid reduces transcription of the target nucleic acid, but does not substantially reduce transcription of a non-target nucleic acid, e.g., transcription of a non-target nucleic acid is reduced, if at all, by less than 10% compared to the level of transcription of the non-target nucleic acid in the absence of the DNA-targeting sequence/modified Cas9 polypeptide/PUF domain-fusion complex.
  • “selective” increased transcription of a target DNA can increase transcription of the target DNA by at least 1.1 fold (e.g., at least 1.2 fold, at least 1.3 fold, at least 1.4 fold, at least 1.5 fold, at least 1.6 fold, at least 1.7 fold, at least 1.8 fold, at least 1.9 fold, at least 2 fold, at least 2.5 fold, at least 3 fold, at least 3.5 fold, at least 4 fold, at least 4.5 fold, at least 5 fold, at least 6 fold, at least 7 fold, at least 8 fold, at least 9 fold, at least 10 fold, at least 12 fold, at least 15 fold, or at least 20-fold) compared to the level of transcription of the target DNA in the absence of the complexes provided herein including embodiments thereof (e.g., DNA-targeting sequence/modified Cas9 polypeptide/PUF domain-fusion complex).
  • Selective increase of transcription of a target DNA increases transcription of the target DNA, but does not substantially increase transcription of a non-target DNA, e.g., transcription of a non-target DNA is increased, if at all, by less than 5-fold (e.g., less than 4-fold, less than 3-fold, less than 2-fold, less than 1.8-fold, less than 1.6-fold, less than 1.4-fold, less than 1.2-fold, or less than 1.1-fold) compared to the level of transcription of the non-targeted DNA in the absence of the complexes provided herein including embodiments thereof (e.g., DNA-targeting sequence/modified Cas9 polypeptide/PUF domain-fusion complex).
  • multiple subject polynucleotides are used simultaneously in the same cell to simultaneously modulate transcription at different locations on the same target DNA or on different target DNAs.
  • two or more subject polynucleotides target the same gene or transcript or locus.
  • two or more subject polynucleotides target different unrelated loci.
  • two or more subject polynucleotides target different, but related loci.
  • the subject polynucleotides are small and robust, they can be simultaneously present on the same expression vector and can even be under the same transcriptional control if so desired.
  • two or more (e.g., 3 or more, 4 or more, 5 or more, 10 or more, 15 or more, 20 or more, 25 or more, 30 or more, 35 or more, 40 or more, 45 or more, or 50 or more) subject polynucleotides are simultaneously expressed in a target cell, from the same or different vectors.
  • the expressed subject polynucleotides can be differently recognized by orthogonal nuclease-deficient RNA-guided DNA endonucleases (dCas9 proteins) from different bacteria, such as S. pyogenes, S. thermophilus, L. innocua , and N. meningitidis.
  • dCas9 proteins orthogonal nuclease-deficient RNA-guided DNA endonucleases
  • RNA processing system mediated by the Csy4 endoribonuclease described in international application PCT/US2016/021491 and published as WO2016148994 A8, which is hereby incorporated by reference and for all purposes, may be used for the invention provided herein.
  • a method of the present invention to modulate transcription may be employed to induce transcriptional modulation in mitotic or post-mitotic cells in vivo and/or ex vivo and/or in vitro.
  • a mitotic and/or post-mitotic cell can be any of a variety of host cell, where suitable host cells include, but are not limited to, a bacterial cell; an archaeal cell; a single-celled eukaryotic organism; a plant cell; an algal cell, e.g., Botryococcus braunii, Chlamydomonas reinhardtii, Nannochloropsis gaditana, Chlorella pyrenoidosa, Sargassum patens, C.
  • a fungal cell e.g., an insect, a cnidarian, an echinoderm, a nematode, etc.
  • a eukaryotic parasite e.g., a malarial parasite, e.g., Plasmodium falciparum ; a helminth; etc.
  • a cell from a vertebrate animal e.g., fish, amphibian, reptile, bird, mammal
  • a mammalian cell e.g., a rodent cell, a human cell, a non-human primate cell, etc.
  • Suitable host cells include naturally-occurring cells; genetically modified cells (e.g., cells genetically modified in a laboratory, e.g., by the “hand of man”); and cells manipulated in vitro in any way. In some cases, a host cell is isolated or cultured.
  • a stem cell e.g. an embryonic stem (ES) cell, an induced pluripotent stem (iPS) cell, a germ cell; a somatic cell, e.g. a fibroblast, a hematopoietic cell, a neuron, a muscle cell, a bone cell, a hepatocyte, a pancreatic cell; an in vitro or in vivo embryonic cell of an embryo at any stage, e.g., a 1-cell, 2-cell, 4-cell, 8-cell, etc. stage zebrafish embryo; etc.).
  • ES embryonic stem
  • iPS induced pluripotent stem
  • a germ cell e.g. a somatic cell, e.g. a fibroblast, a hematopoietic cell, a neuron, a muscle cell, a bone cell, a hepatocyte, a pancreatic cell
  • an in vitro or in vivo embryonic cell of an embryo at any stage e
  • Cells may be from established cell lines or they may be primary cells, where “primary cells,” “primary cell lines,” and “primary cultures” are used interchangeably herein to refer to cells and cells cultures that have been derived from a subject and allowed to grow in vitro for a limited number of passages, i.e. splittings, of the culture.
  • primary cultures include cultures that may have been passaged 0 times, 1 time, 2 times, 4 times, 5 times, 10 times, or 15 times, but not enough times go through the crisis stage.
  • Primary cell lines can be are maintained for fewer than 10 passages in vitro.
  • Target cells are in many embodiments unicellular organisms, or are grown in culture.
  • the cells may be harvest from an individual by any convenient method.
  • leukocytes may be conveniently harvested by apheresis, leukocytapheresis, density gradient separation, etc., while cells from tissues such as skin, muscle, bone marrow, spleen, liver, pancreas, lung, intestine, stomach, etc. are most conveniently harvested by biopsy.
  • An appropriate solution may be used for dispersion or suspension of the harvested cells.
  • Such solution will generally be a balanced salt solution, e.g.
  • fetal calf serum or other naturally occurring factors, in conjunction with an acceptable buffer at low concentration, e.g., from 5-25 mM.
  • Convenient buffers include HEPES, phosphate buffers, lactate buffers, etc.
  • the cells may be used immediately, or they may be stored, frozen, for long periods of time, being thawed and capable of being reused.
  • the cells will usually be frozen in 10% dimethyl sulfoxide (DMSO), 50% serum, 40% buffered medium, or other solutions commonly used in the art to preserve cells at such freezing temperatures, and thawed in a manner as commonly known in the art for thawing frozen cultured cells.
  • DMSO dimethyl sulfoxide
  • a subject polynucleotide, a nucleic acid comprising a nucleotide sequence encoding same, or a nucleic acid comprising a nucleotide sequence encoding the subject nuclease-deficient RNA-guided DNA endonuclease (dCas9 protein) or demethylation or methylation protein conjugate (PUF domain fusion), can be introduced into a host cell by any of a variety of well-known methods.
  • nucleic acid e.g., vector or expression construct
  • Suitable methods include, include e.g., viral or bacteriophage infection, transfection, conjugation, protoplast fusion, lipofection, electroporation, calcium phosphate precipitation, polyethyleneimine (PEI)-mediated transfection, DEAE-dextran mediated transfection, liposome-mediated transfection, particle gun technology, calcium phosphate precipitation, direct micro injection, nanoparticle-mediated nucleic acid delivery (see, e.g., Panyam et al., Adv. Drug Deliv. Rev., pii: S 0169-409 ⁇ (12)00283-9.doi:10.1016/j.addr.2012.09.023), and the like.
  • PKI polyethyleneimine
  • a subject nucleic acid also comprises a nucleotide sequence encoding a nuclease-deficient RNA-guided DNA endonuclease (dCas9 protein) and/or a demethylation or methylation protein conjugate (PUF domain fusion).
  • dCas9 protein nuclease-deficient RNA-guided DNA endonuclease
  • PEF domain fusion a demethylation or methylation protein conjugate
  • a subject method involves introducing into a host cell (or a population of host cells) one or more nucleic acids (e.g., vectors) comprising nucleotide sequences encoding a subject polynucleotide and/or a nuclease-deficient RNA-guided DNA endonuclease (dCas9 protein) and/or a demethylation or methylation protein conjugate (PUF domain fusion).
  • a host cell comprising a target DNA is in vitro.
  • a host cell comprising a target DNA is in vivo.
  • Suitable nucleic acids comprising nucleotide sequences encoding a subject polynucleotide and/or a nuclease-deficient RNA-guided DNA endonuclease (dCas9 protein) and/or a subject demethylation or methylation protein conjugate (PUF domain fusion) include expression vectors, where the expression vectors may be recombinant expression vector.
  • dCas9 protein nuclease-deficient RNA-guided DNA endonuclease
  • PEF domain fusion a subject demethylation or methylation protein conjugate
  • the recombinant expression vector is a viral construct, e.g., a recombinant adeno-associated virus construct (see, e.g., U.S. Pat. No. 7,078,387), a recombinant adenoviral construct, a recombinant lentiviral construct, a recombinant retroviral construct, etc.
  • a viral construct e.g., a recombinant adeno-associated virus construct (see, e.g., U.S. Pat. No. 7,078,387), a recombinant adenoviral construct, a recombinant lentiviral construct, a recombinant retroviral construct, etc.
  • Suitable expression vectors include, but are not limited to, viral vectors (e.g. viral vectors based on vaccinia virus; poliovirus; adenovirus (see, e.g., Li et al., Invest Opthalmol. Vis. Sci., 35:2543-2549, 1994; Borras et al., Gene Ther., 6:515-524, 1999; Li and Davidson, Proc. Natl. Acad. Sci. USA, 92:7700-7704, 1995; Sakamoto et al., Hum.
  • viral vectors e.g. viral vectors based on vaccinia virus; poliovirus; adenovirus (see, e.g., Li et al., Invest Opthalmol. Vis. Sci., 35:2543-2549, 1994; Borras et al., Gene Ther., 6:515-524, 1999; Li and Davidson, Proc. Natl. Acad. Sci. USA,
  • a retroviral vector e.g., Murine Leukemia Virus, spleen necrosis virus, and vectors derived from retroviruses such as Rous Sarcoma Virus, Harvey Sarcoma Virus, avian leukosis virus, a lentivirus, HIV virus, myeloproliferative sarcoma virus, and mammary tumor virus; and the like.
  • Suitable expression vectors are known to those skilled in the art, and many are commercially available.
  • the following vectors are provided by way of example; for eukaryotic host cells: pXT1, pSGS (Stratagene), pSVK3, pBPV, pMSG, and pSVLSV40 (Pharmacia).
  • any other vector may be used so long as it is compatible with the host cell.
  • a method for modulating transcription according to the present invention finds use in a variety of applications, including research applications; diagnostic applications; industrial applications; and treatment applications.
  • Research applications may include, e.g., determining the effect of reducing or increasing transcription of a target nucleic acid on, e.g., development, metabolism, expression of a downstream gene, and the like.
  • High through-put genomic analysis can be carried out using a subject transcription modulation method, in which only the DNA-targeting sequence of the subject polynucleotide needs to be varied, while the binding sequence (Cas9-binding sequence) and the PBS sequence can (in some cases) be held constant.
  • a library e.g., a subject library
  • comprising a plurality of nucleic acids used in the genomic analysis would include: a promoter operably linked to a subject polynucleotide-encoding nucleotide sequence, where each nucleic acid would include a different DNA-targeting sequence, a common binding sequence (Cas9-binding sequence), and a common PBS sequence.
  • a chip could contain over 5 ⁇ 10 4 unique polynucleotide of the invention.
  • a subject transcription modulation method can also be used for drug discovery and target validation as described in international application PCT/US2016/021491 and published as WO2016148994 A8, which is hereby incorporated by reference and for all purposes.
  • Example 1 sgRNA Scaffold Remains Functional with Insertion of 47 Copies of Engineered Pumilio Binding Sites
  • the subject 3-component CRISPR/Cas complex/system can have at least 47 copies of the engineered 8-mer Pumilio homologue domain-binding sequences (PBSs) at the 3′ end of sgRNA, without substantially affecting the function of the dCas9/sgRNA complex.
  • PBSs Pumilio homologue domain-binding sequences
  • FIG. 1B Cells were transfected with dCas9-VP64 with the different sgRNA scaffolds, and were analyzed by fluorescent-activated cell sorting (FACS) two days after transfection ( FIG. 1B ). All the control non-targeting sgRNAs did not activate tdTomato expression. Meanwhile, all the Tet-targeting sgRNAs with different number of PBS could direct dCas9-VP64 to activate tdTomato expression, showing that insertion of at least 47 copies of 8-mer sites do not substantially impact the activity of sgRNA in directing dCas9-VP64 to its targets ( FIG. 1C ).
  • Example 2 The Subject 3-Component CRISPR/Cas Complexes/Systems are Orthogonal to Each Other Due to the Specificity of the Engineered Pumilio with the Cognate 8-Mer Binding Sites
  • PUF::VP64 can activate tdTomato expression only when the sgRNA with the cognate binding sites were provided.
  • PBSa and PBSw binding sites only differ by one nucleotide, their gene activation remains target-specific, demonstrating the high specificity of the subject 3-component CRISPR/Cas complex/system.
  • Example 3 The Subject 3-Component CRISPR/Cas Complex/System Allows Assembly of Protein Complex at Target Loci
  • p65-HSF1 has recently been shown to be a potent activator domain.
  • Co-transfection of both PUF(3-2)::VP64 and PUF(6-2/7-2)::p65-HSF1 induced a tdTomato fluorescence, with an intensity the sum of the fluorescent intensity resulting from transfecting the single activators alone. This indicates that sgRNA with binding sites for both PUF(3-2) and PUF(6-2/7-2) allows both fusion proteins of both types to assemble on the targeted genomic locus.
  • PUFa [PUF(3-2)] and PUFb [PUF(6-2/7-2)] with N-terminal NLS were amplified from constructs containing these coding sequences with primers containing SgrAI and PacI sites and were used to replace SgrAI-dCas9-FseI from pAC164:pmax-dCas9Master_VP64 to create pAC1355:pmax-NLSPUFa_VP64 and pAC1356:pmax-NLSPUFb_VP64.
  • a fusion PCR with 5′ fragment up to repeat 4 of NLSPUFb and 3′ fragment from repeat 5 to the end of NLSPUFa was used to create pAC1357:pmax-NLSPUFw_VP64.
  • a fusion PCR of 5′ fragment of NLSPUFa with 3′ fragment of NLSPUb was used to create pAC1358:pmax-NLSPUFc_VP64.
  • p65HSF1 activator ORF was amplified from MS2-P65-HSF1_GFP (Addgene: 61423) with FseI PacI sites to replace VP64 fragment in pAC164 to create pAC1410:pmax-dCas9_p65HSF1, and replace VP64 in pAC1355 and pAC1358 to create pAC1393: pmax-NLSPUFa_p65HSF1 and pAC1411:pmax-NLSPUFc_p65HSF1, respectively.
  • the FseI-p65HSF1-PacI fragment was released from pAC1393 and ligated with SgrAI-NLSPUMb fragment released from pAC1356 and pAC1360 digested with SgrAI-PacI as vector to create pAC1413: PB3-neo(-)-pmax-NLSPUFb_p65HSF1.
  • the BFPKRAB fragment was amplified from pHR-SFFV-dCas9-BFP-KRAB (Addgene #46911) and was used to replace Clover fragment from pAC1360 to create pAC1414: PB3-neo(-)-pmax-BFPKRAB_NLSPUFa.
  • an NheI-CAGGS-NLSPUFb_p65HSF1-NheI fragment was amplified from pAC1413 and inserted into pAC1414 digested with NheI to create a dual expression vector for BFPKRAB-NLSPUFa and NLSPUFb-p65HSF1 (pAC1414: PB3-NLSPUFb_p65HSF1(-)neo(-)-BFPKRAB2_NLSPUFa).
  • HAT sequence was amplified with another pair of primers containing SgrAI-AclI site and cloned into SgrAI-ClaI site of pAC1405 to create pAC1416: pCR8-CBPHAT_4 ⁇ NLSPUFa_2 ⁇ NLS.
  • pAC1415 and pAC1416 were recombined into pAC90:pmax-DEST (Addgene #48222) to create expression vectors pAC1417: pmax-4 ⁇ NLSPUFa_2 ⁇ NLS_CBPHAT and pAC1418: pmax-CBPHAT_4 ⁇ NLSPUFa_2 ⁇ NLS, respectively.
  • FseI-mCherry-PacI fragment was amplified from a plasmid containing mCherry sequence and ligated with SgrAI-dCas9-FseI to PB3-neo(-)-pmax to generate pAC1419: PB3-neo(-)-pmax-dCas9Master_mCherry.
  • Expression vectors for sgRNA-PBS were constructed as follows: First, a sgRNA scaffold based on sgF+E with BbsI for oligo cloning of guide sequence and with 3′ BsaI (right upstream of the terminator) for insertion of PBS were ordered as a gBlock (IDT), and were cloned into pX330 (Addgene #42230) replacing the AflIII-NotI region to create vector pAC1394: pX-sgFE-BsaI(AGAT).
  • oligos encoding 5 ⁇ PBSa sites each separated by ggc-spacer flanked by 5′-AGAT-3′ overhangs on one side and 5′-ATCT-3′ on the other side were treated with T4PNK and annealed and ligated into pAC1394 digested with BsaI (to create compatible overhangs).
  • Clones were then screened for 1 copy (5 ⁇ PBS), 2 copies (10 ⁇ PBS), etc of the oligo insertions for the different number of PBS.
  • 1 ⁇ PBS and 2 ⁇ PBS vectors they were constructed using oligo containing one PBS site. Guide sequence for each target were then cloned onto the sgRNA-PBS expression vectors via BbsI site as previously described.
  • sgRNA expression vectors with GFP expression markers they were constructed by transferring the sgRNA-PBS expression cassette from the pX vectors onto a PB-GFP vector via AscI site.
  • the different sgRNA expression constructs are listed in Table S1.
  • HEK293T cells were cultivated in Dulbecco's modified Eagle's medium (DMEM)(Sigma) with 10% fetal bovine serum (FBS)(Lonza), 4% Glutamax (Gibco), 1% Sodium Pyruvate (Gibco) and penicillin-streptomycin (Gibco). Incubator conditions were 37° C. and 5% CO 2 .
  • DMEM Dulbecco's modified Eagle's medium
  • FBS fetal bovine serum
  • Gibco fetal bovine serum
  • Gibco fetal bovine serum
  • 1% Sodium Pyruvate Gibco
  • penicillin-streptomycin Gabco
  • Incubator conditions were 37° C. and 5% CO 2 .
  • cells were seeded into 12-well plates at 100,000 cells per well the day before being transfected with 200 ng of dCas9 construct, 100 ng of modified sgRNA and 100 ng of
  • RNA extraction After transfection, cells were grown for 48 hrs and harvested for either RNA extraction or fluorescent-activated cell sorting (FACS). For dual activation-repression experiments, transfection remained the same, however cells were seeded into 12-well plates at 150,000 cells per well and were grown for 72 hrs before being harvested for FACS. For experiments with OCT4 and SOX2 dual activation-repression, cells were triple-sorted by BFP (for the activator-repressor module PUFb-p65HSF1/BFPKRAB-PUFa), mCherry (for dCas9mCherry) and GFP (for the sgRNA-PBS on vectors co-expressing EGFP) before RNA extraction.
  • BFP for the activator-repressor module PUFb-p65HSF1/BFPKRAB-PUFa
  • mCherry for dCas9mCherry
  • GFP for the sgRNA-PBS on vectors co-expressing EGFP
  • cells were seeded into 6-well plates with 22 ⁇ 22 ⁇ 1 microscope cover glass at 300,000 cells per well the day before being transfected with 50 ng of dCas9 construct, 500 ng of modified sgRNA, and 50 ng of a PUF-fluorescent fusion with Attractene transfection reagent. After transfection, cells were grown for 48 hrs then immunostained.
  • a cDNA library was made using Applied Biosystems High Capacity RNA-to-cDNA kit with 1 ⁇ g of RNA.
  • TaqMan Gene expression assays were designed using GAPDH (Hs03929097, VIC) as endogenous control and OCT4 (Hs00999632, FAM) and SOX2 (Hs01053049, FAM) as targets.
  • Fluorescent-Activated Cell Sorting Cells were trypisinized and fixed for 10 min with 2% paraformaldehyde. Afterwards, the cells were centrifuged at 125 g for 5 min and resuspended in dPBS. Samples were analyzed on a FACScalibur flow cytometer using CellQuest Pro software (BD Bioscience). thousands events were collected in each run.
  • NLS PUFa VP64 SEQ ID NO: 32 MGILPPKKKRKVSRGRSRLLEDFRNNRYPNLQLREIAGHIMEFSQDQHGS RFIQLKLERATPAERQLVFNEILQAAYQLMVDVFGNYVIQKFFEFGSLEQ KLALAERIRGHVLSLALQMYGSRVIEKALEFIPSDQQNEMVRELDGHVLK CVKDQNGNHVVQKCIECVQPQFIIDAFKGQVFALSTHPYGCRVIQRI LEHCLPDQTLPILEELHQHTEQLVQDQYGNYVIQHVLEHGRPEDKSKIVA EIRGNVLVLSQHKFASNVVEKCVTHASRTERAVLIDEVCTMNDGPHSALY TMMKDQYANYVVQKMIDVAEPGQRKIVMHKIRPHIATLRKYTYGKHILAK LEKYYMKNGVDLGGPAGSGR ADALDDFDLD
  • NLS sequence is residues 6-12
  • PUFa SEQ ID NO:2
  • VP64 is residues 371-421.
  • NLS PUFb VP64 SEQ ID NO: 33 MGILPPKKKRKVSRGRSRLLEDFRNNRYPNLQLREIAGHIMEFSQDQHGS RFIQLKLERATPAERQLVFNEILQAAYQLMVDVFGNYVIQKFFEFGSLEQ KLALAERIRGHVLSLALQMYGCRVIQKALEFIPSDQQNEMVRELDGHVLK CVKDQNGNHVVQKCIECVQPQFIIDAFKGQVFALSTHPYGCRVIQRI LEHCLPDQTLPILEELHQHTEQLVQDQYGSYVIEHVLEHGRPEDKSKIVA EIRGNVLVLSQHKFANNVVQKCVTHASRTERAVLIDEVCTMNDGPHSALY TMMKDQYANYVVQKMIDVAEPGQRKIVMHKIRPHIATLRKYTYGKHILAK LEKYYMKNGVDLGGPAGSGR ADALDDFD
  • NLS sequence is residues 6-12
  • PUFb SEQ ID NO:3
  • VP64 is residues 371-421.
  • NLS PUFw VP64 SEQ ID NO: 34 MGILPPKKKRKVSRGRSRLLEDFRNNRYPNLQLREIAGHIMEFSQDQHGS RFIQLKLERATPAERQLVFNEILQAAYQLMVDVFGNYVIQKFFEFGSLEQ KLALAERIRGHVLSLALQMYGCRVIQKALEFIPSDQQNEMVRELDGHVLK CVKDQNGNHVVQKCIECVQPQSLQFIIDAFKGQVFALSTHPYGCRVIQRI LEHCLPDQTLPILEELHQHTEQLVQDQYGNYVIQHVLEHGRPEDKSKIVA EIRGNVLVLSQHKFASNVVEKCVTHASRTERAVLIDEVCTMNDGPHSALY TMMKDQYANYVVQKMIDVAEPGQRKIVMHKIRPHIATLRKYTYGKHILAK LEKYYMKNGVDLGGPAGSGR ADALDDFDLD
  • NLS sequence is residues 6-12
  • PUFw SEQ ID NO:5
  • VP64 is residues 371-421.
  • NLS PUFc VP64 SEQ ID NO: 35 MGILPPKKKRKVSRGRSRLLEDFRNNRYPNLQLREIAGHIMEFSQDQHGS RFIQLKLERATPAERQLVFNEILQAAYQLMVDVFGNYVIQKFFEFGSLEQ KLALAERIRGHVLSLALQMYGSRVIEKALEFIPSDQQNEMVRELDGHVLK CVKDQNGNHVVQKCIECVQPQFIIDAFKGQVFALSTHPYGCRVIQRI LEHCLPDQTLPILEELHQHTEQLVQDQYGSYVIEHVLEHGRPEDKSKIVA EIRGNVLVLSQHKFANNVVQKCVTHASRTERAVLIDEVCTMNDGPHSALY TMMKDQYANYVVQKMIDVAEPGQRKIVMHKIRPHIATLRKYTYGKHILAK LEKYYMKNGVDLGGPAGSGR ADALDDFD
  • NLS sequence is residues 6-12
  • PUFc SEQ ID NO:4
  • VP64 is residues 371-421.
  • Example 4 Targeted DNA Demethylation and Methylation Using the Subject 3-Component CRISPR/Cas Complex/System (Casilio) and dCas9-Tethered Enzymes
  • CRISPR/Cas Complex/System may also be referred to as “Casilio” herein.
  • the Example demonstrated a robust activation of hMLH1 transcription, a gene that is epigenetically silenced in HEK293T cells and other cancer cells due to hypermethylation in the promoter regions. Reactivation of hMLH1 transcription leads to (restoration of) expression of MLH1 protein.
  • the Example showed that Casilio-ME-mediated delivery of TET1 activity to hMLH1 promoter region induced a robust cytosine demethylation within the targeted CpG island, providing a proof-of-principal that Casilio-ME is a robust platform to editing methylcytosine mark of the epigenome.
  • dCas9 nuclease-deficient dCas9, modified sgRNAs containing sites for Pumilio (PUF) RNA binding domain (sgRNA-PBS) and an effector module made of Pumilio RNA binding domain fused to an effector protein.
  • dCas9 binds DNA when complexed with sgRNA without producing double-stranded breaks, serving as a RNA-programmable DNA binding protein whose specificity is determined by a sequence in the sgRNA component of the system.
  • PUF domains can be programmed to bind to any 8-mer RNA sequences (PBS) appended in multiple copies to the 3′ end of the sgRNA without interfering with the sgRNA-mediated DNA binding of dCas9 (Cheng, A. W., et al., Casilio: a versatile CRISPR - Cas 9- Pumilio hybrid for gene regulation and genomic labeling . Cell Res, 2016. 26(2): p. 254-7).
  • PBS 8-mer RNA sequences
  • TET1-effector modules were constructed as N-terminal or C-terminal fusions of PUFa to TET1 catalytic domain that includes residues 1418 to 2136 (TET1(CD)).
  • the promoter region of hMLH1 whose hypermethylation is known to induce silencing of hMLH1 expression (Deng, G., et al., Methylation of CpG in a small region of the hMLH 1 promoter invariably correlates with the absence of gene expression . Cancer Res, 1999. 59(9): p. 2029-33), was chosen as the target for this study.
  • MLH1 protein is a component of the methyl directed mismatch repair system of the cell.
  • hMLH1 is in fact silenced in HEK293T cells as is in other cancer cells, and therefore represents a good cellular model to test TET1-effectors in their ability to induce demethylation-mediated gene activation.
  • Nine sgRNAs were designed around the promoter region whose methylation is associated with down-regulation of hMLH1 in cancer cells ( FIG. 3A ) (Deng, G., et al., Methylation of CpG in a small region of the hMLH 1 promoter invariably correlates with the absence of gene expression . Cancer Res, 1999. 59(9): p. 2029-33).
  • HEK293T cells were transfected with Casilio-ME components including Ct or Nt-fusion TET1-effector and a combination of 3 or 2 sgRNAs.
  • Relative levels of hMLH1 mRNA were determined in TaqMan assays by using RNA extracted from cells 60 hours post-transfection and GAPDH as endogenous control for normalization of qRT-PCR measurements. This showed that PUFa-TET1(CD)C-terminal fusion effector restored a robust hMLH1 expression that reached 135 fold over background in the presence sgRNAs 3+7 ( FIG. 3B ).
  • TET1(CD)-PUFa N-terminal effector fusion showed a much weaker activation (20 fold at best) in the presence of the same sgRNA combo, presumably due to steric hindrance as TET1(CD) is natively located at the C-terminus of TET1 full length protein.
  • Casilio-mediated delivery of demethylation enzymes to specific genomic locus enables robust alteration of gene expression.
  • TET1-mediated activation of hMLH1 expression was replaced by p65HSF1-effector.
  • this showed higher activation that reached 200-fold over the background ( FIG. 3B ).
  • Casilio-ME-mediated activation of hMLH1 expression can achieve about 70% of the activation obtained by a strong transcription activator module such as p65HSF1, indicating that Casilio-ME is an efficient tool enabling efficient targeting and delivery of demethylation enzymes to alter methylation state of the genome and the associated silencing activities.
  • dCas9-TET1(CD) direct fusion to activate hMLH1 expression in HEK293T cells in comparison to Casilio-ME
  • N-terminal and C-terminal fusions of dCas9 to TET1(CD) were constructed.
  • the dCas9-TET1(CD)C-terminal fusion showed a relatively weak activation of hMLH1, as indicated by the relative change in mRNA levels ( FIG. 3C ).
  • dCas9-TET1(CD)-induced activation represents at best about 14% of the obtained activation using the Casilio-ME with the same sgRNAs combination in parallel experiment (19-vs 135-fold change in mRNA levels).
  • TET1(CD)-dCas9 fusion showed a much weaker activation than its respective C-terminal fusion, indicating a possible steric hindrance affecting TET1 activity when N-terminally fused to either dCas9 or PUFa proteins ( FIGS. 3B & 3C ).
  • HEK293T cells were transfected with dCas9-p65HSF1 along with the same sgRNA combination. Analysis of mRNA levels showed that dCas9-TET1 activation of hMLH1 was at best twice the activity obtained with transcription activator dCas9 fusion ( FIG. 3C ), therefore indicating that TET1 targeting to specific locus can activate gene, presumably via alteration of epigenetic DNA methylation at the target site.
  • Casilio-mediated delivery of demethylation enzymes alters methylation state of targeted genomic locus.
  • Evidence that the shown Casilio-ME-induced activation of hMLH1 transcription is a result of TET1-mediated cytosine demethylation within the targeted promoter region came from DNA sequencing of hMLH1 promoter after bisulfite conversion.
  • Bisulfite treatment of genomic DNA deaminates unmethylated cytosines to produce uracils that are subsequently replicated as thymine.
  • methylated cytosines are protected from conversion to uracils, thus allowing one to determine cytosine methylation states at single-nucleotide resolution by direct sequencing.
  • HEK293T were transfected with Casilio-ME components that includes Ct-fusion PUFa-TET1 effector and a combination of 2 sgRNAs (RNA guides 3 and 7).
  • TaqMan assays showed that the activation of hMLH1 transcription was maintained during the course of these transient transfections ( FIG. 4A ), thus showing a sustained change of hMLH1 mRNA levels during the 6 days of the experiment.
  • Casilio-mediated delivery of methyltranferases silent gene expression Programmable methyltranferases were constructed by either direct fusions of catalytic domains of Dnmt3a, Dnmt3L, or a hybrid Dnmt3a-3L to N-terminus or C-terminus of dCas9 ( FIG. 5A ). N- or C-terminal fusions of these effectors to PUFa were also constructed, for use with dCas9 and sgRNA-PBS (Casilio-ME with Dnmt effectors; FIG. 5B ).
  • Casilio-ME with a Dnmt3a-PUF achieved more robust repression of SOX2 gene expression compared to direct fusions, demonstrating superior activity using Casilio-ME for directed DNA methylation ( FIGS. 6A and 6B ).
  • HEK293T cells were cultivated in Dulbecco's modified Eagle's medium (DMEM)(Sigma) with 10% fetal bovine serum (FBS)(Lonza), 4% Glutamax (Gibco), 1% Sodium Pyruvate (Gibco) and penicillin-streptomycin (Gibco) in an incubator set to 37° C. and 5% CO 2 .
  • DMEM Dulbecco's modified Eagle's medium
  • FBS fetal bovine serum
  • Gibco fetal bovine serum
  • Gibco fetal bovine serum
  • Gibco fetal bovine serum
  • 1% Sodium Pyruvate Gibco
  • penicillin-streptomycin Gibco
  • dCas9-direct fusion experiments cells were transfected with 200 ng dCas9-fusion constructs and 200 ng of modified sgRNA constructs. Transfected cells were harvested 60 hours after transfection, or otherwise indicated, and cell pellets were used for extractions of RNA, genomic DNA and protein.
  • GAPDH Hs03929097, VIC
  • hMLH1 Hs00179866, FAM
  • Genomic DNAs were extracted using all AllPrep DNA/RNA/Protein Mini Kit according the manufacturer's instructions (Qiagen). The kit allows extraction of genomic DNA as well as RNA and total protein from the same cellular pellet for parallel downstream analyses. Bisulfite conversion experiments were performed by using EpiTect Fast DNA Bisulfite Kit and extracted genomic DNAs according to manufacturer's instructions (Qiagen). Bisulfite treated DNAs served then as templates to PCR amplify two DNA fragments of 350-400 bp long that cover the whole hMLH1 promoter region using ZymoTaq PreMix according to manufacturer's instructions (Zymo Research).
  • PCR fragments were then cloned by SLIC into EcoRI-linearized PUC19 plasmid using T4 DNA polymerize (Jeong, J. Y., et al., One - step sequence - and ligation - independent cloning as a rapid and versatile cloning method for functional genomics studies . Appl Environ Microbiol, 2012. 78(15): p. 5440-3).
  • Six independent positive clones for each sample were then subjected to Singer sequencing for determination of the frequency of cytosine to thymine conversion at individual CpG of the hMLH1 promoter region.
  • dCas9-expressing cell line The day prior to transfection, Lenti -X 293T cells were seeded into 6-well plates at 1.2 million cells per well. The cells were transfected with the supercoiled packaging plasmids (pLP1 (gag/pol), pLP2 (rev), and VSV-G (envelope)) and a dCas9 lentiviral expression plasmid through Lipofectamine 3000 reagent (Invitrogen). At 6 h posttransfection, medium was exchanged for fresh. At 24 h posttransfection, 2 ml of medium containing the lentivirus were collected and centrifuged for 10 minutes at 2,000 rpm to remove cellular debris.
  • HEK293T cells seeded into a 12-well plate at 150,000 cells per well, were transduced with 500 ⁇ l of the dCas9 lentivirus in culture medium supplemented with 5 ⁇ g/ml polybrene for 12 hours, and subsequently selected with Blasticidin antibiotics on the third day post transduction.
  • HEK293T, and HEK293T/dCas9 cell lines were seeded into 12-well plates at 150,000 cells per well.
  • Cells were transfected with 200 ng of the Dnmt effector constructs and 200 ng of the sgRNA-PBS with Attractene transfection reagent (Qiagen).
  • Attractene transfection reagent Qiagen.
  • the cells were sorted for GFP (sgRNA expression constructs are marked by GFP) with fluorescence-activated cell sorting (FACS) and re-plated into 12 or 24-well plates.
  • GFP sgRNA expression constructs are marked by GFP
  • FACS fluorescence-activated cell sorting
  • sgRNA-PBS sequence sgSOX2-1-5xPBSa GCATGTGACGGGGGCTGTCAgtttAagagctaTGCTGGAAACAGCAta SEQ ID NO: 70 gcaagttTaaataaggctagtccgttatcaacttgaaaaagtggcacc gagtcggtgcCAATTGggtctccagatTGTATGTAGCCTGTATGTAGC CTGTATGTAGCCTGTATGTAGCCTGTATGTAagatCTTTTTTTTT sgSOX2-2-5xPBSa GCTGCCGGGTTTTGCATGAAgtttAagagctaTGCTGGAAACAGCAta SEQ ID NO: 71 gcaagttTaaataggctagtccgttatcaacttgaaaaagtggcacc gagtcggtgcCAATTGggtctccagatTGTATGTAGCCTGTATGTAGC CTGT
  • mC methylcytosine
  • TET1 TET1 mediated iterative mC oxidation
  • BER base-excision repair
  • NER nucleotide-excision repair
  • GADD45A protein Crowth Arrest and DNA-Damage-inducible Alpha
  • GADD45A protein Crowth Arrest and DNA-Damage-inducible Alpha
  • mC demethylation efficiency appears to be enhanced by GADD45A protein (Growth Arrest and DNA-Damage-inducible Alpha), a multi-faceted nuclear factor involved in maintenance of genomic stability, DNA repair and suppression of cell growth (Niehrs and Schafer, Trends Cell Biol 22(4): 220-227, 2012; Barreto et al., Nature 445(7128):671-675, 2007; Schuermann et al., DNA Repair ( Amst ) 44:92-102, 2016).
  • GADD45A was also found to interact with TET1 and with the BER enzyme Thymine DNA Glycosylase TDG (Kienhofer et al., Differentiation 90(1-3):59-68, 2015; Li et al., Nucleic Acids Res 43(8):3986-3997, 2015).
  • Another way to dually target the two components GADD45A and TET1(CD) to a genomic site to alter its methylation state and associated gene expression is to fuse the proteins to two independent PUFs, for example, PUFa for TET1(CD) and PUFc for GADD45A, and use a modified gRNA scaffold that comprises the corresponding PUF binding sites (PBS) ( FIG. 7A ).
  • PUFa-TET1(CD) and PUFc-GADD45A in the presence of corresponding gRNAs-PBSac showed significant stimulation of the TET1(CD) mediated hMLH1 activation, with GADD45A-PUFc showing higher activity compared to PUFc-GADD45A fusions ( FIG.
  • Methylcytosine is an epigenetic mark made by a process that covalently adds a methyl group at position 5 of cytosine ring of a CpG DNA sequence.
  • formation of 5-methylcytosine (5mC) mark is catalyzed and maintained by DNA methyltransferases.
  • Demethylation pathways which remove the methyl group to restore unmethylated DNA, involve the ten-eleven translocation (TET) family of proteins.
  • TET methylcytosine dioxygenases catalyze iterative oxidations of 5mC to 5-hydroxymethylcytosine (5hmC), 5-formylcytosine (5fC) and 5-carboxylcytosine (5caC) intermediates.
  • the two latter intermediates, 5fC and 5caC seem to serve as substrates for the base-excision repair (BER) machinery which cleaves off the oxidized base and replaces it with unmethylated cytosines.
  • BER base-excision repair
  • DNA glycosylases catalyze the initial and important step that excise the damaged base and generate an apurinic/apyrimidinic site (AP site) substrate that is subsequently processed by the BER machinery to restore the base.
  • Thymine DNA glycosylase (TDG) based BER pathways have been functionally linked to TET1-mediated active demethylation as they have been shown to specifically act on 5fC and 5caC and that NEIL1 and NEIL2 glycosylase/AP-lyase activities facilitate the restoration of unmethylated cytosine by displacing TDG from AP site to create a single strand DNA break substrate for downstream processing of BER machinery.
  • NEIL2 to enhance TET1-mediated gene activation required targeting of NEIL2 effector to promoter regions.
  • Coupling TET1 oxidative activities with NEIL2 glycosylase/AP-lyase activities using a simple and programmable Casilio platform enables robust demethylation-mediated transcription activation of methylation-silenced gene, providing thus a proof-of-principal that Casilio platform allows an unprecedented feature to harnessing players of independent pathways to synergize their association activities. This finding augments the capability of our Casilio-ME platform and paves the way to developing new applications to study important biological processes and to developing new therapies for methylation associated diseases.
  • gRNA non-targeting guide RNA
  • Dual expression of PUFa-TET1(CD) and PUFc-NEIL2 in the presence of gRNAs with both PBSa/c showed significant stimulation of the TET1(CD) mediated hMLH1 activation ( FIG. 10B ).
  • NEIL2 when fused to either ends of PUFc, showed 7-fold increase in hMLH1 expression as indicated by RT-quantitative PCR ( FIG. 10B ).
  • Evidence that NEIL2-mediated stimulation requires co-targeting of the effectors came from experiments where NEIL2 and TET1(CD) PUF-fusions were expressed in the presence of gRNA scaffold that comprised PBSa but lacked PBSc ( FIG. 11A ).
  • HEK293T cells were cultivated in Dulbecco's modified Eagle's medium (DMEM) (Sigma) with 10% fetal bovine serum (FBS) (Lonza), 4% Glutamax (Gibco), 1% Sodium Pyruvate (Gibco) and penicillin-streptomycin (Gibco) in an incubator set to 37° C. and 5% CO2.
  • DMEM Dulbecco's modified Eagle's medium
  • FBS fetal bovine serum
  • Gibco fetal bovine serum
  • Gibco fetal bovine serum
  • penicillin-streptomycin Gibco
  • Cells were seeded into 12-well plates at 150,000 cells per well the day before being transfected with 100 ng of dCas9 construct, 100 ng of modified sgRNA construct and 200 ng of PUF-fusion with Attractene transfection reagent according to manufacturer's instructions (Qiagen). Transfected cells were harvested 3 days after trans
  • GAPDH Hs03929097, VIC
  • hMLH1 Hs00179866, FAM

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Organic Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Zoology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Wood Science & Technology (AREA)
  • General Health & Medical Sciences (AREA)
  • Molecular Biology (AREA)
  • General Engineering & Computer Science (AREA)
  • Biochemistry (AREA)
  • Biomedical Technology (AREA)
  • Biotechnology (AREA)
  • Medicinal Chemistry (AREA)
  • Microbiology (AREA)
  • Biophysics (AREA)
  • Plant Pathology (AREA)
  • Physics & Mathematics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • General Chemical & Material Sciences (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Mycology (AREA)
  • Toxicology (AREA)
  • Hematology (AREA)
  • Oncology (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Enzymes And Modification Thereof (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
US16/333,137 2016-09-13 2017-09-13 Targeted enhanced dna demethylation Pending US20190218261A1 (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
US16/333,137 US20190218261A1 (en) 2016-09-13 2017-09-13 Targeted enhanced dna demethylation

Applications Claiming Priority (5)

Application Number Priority Date Filing Date Title
US201662393944P 2016-09-13 2016-09-13
US201762485210P 2017-04-13 2017-04-13
US201762535113P 2017-07-20 2017-07-20
PCT/US2017/051411 WO2018053037A1 (fr) 2016-09-13 2017-09-13 Déméthylation d'adn améliorée ciblée
US16/333,137 US20190218261A1 (en) 2016-09-13 2017-09-13 Targeted enhanced dna demethylation

Publications (1)

Publication Number Publication Date
US20190218261A1 true US20190218261A1 (en) 2019-07-18

Family

ID=61619233

Family Applications (3)

Application Number Title Priority Date Filing Date
US16/333,134 Active 2040-09-13 US11780895B2 (en) 2016-09-13 2017-09-13 Targeted DNA demethylation and methylation
US16/333,137 Pending US20190218261A1 (en) 2016-09-13 2017-09-13 Targeted enhanced dna demethylation
US18/454,192 Pending US20240132557A1 (en) 2016-09-13 2023-08-23 Targeted dna demethylation and methylation

Family Applications Before (1)

Application Number Title Priority Date Filing Date
US16/333,134 Active 2040-09-13 US11780895B2 (en) 2016-09-13 2017-09-13 Targeted DNA demethylation and methylation

Family Applications After (1)

Application Number Title Priority Date Filing Date
US18/454,192 Pending US20240132557A1 (en) 2016-09-13 2023-08-23 Targeted dna demethylation and methylation

Country Status (7)

Country Link
US (3) US11780895B2 (fr)
EP (2) EP3512535A4 (fr)
JP (1) JP7063885B2 (fr)
CN (1) CN109982710B (fr)
AU (1) AU2017327384B2 (fr)
CA (1) CA3036695A1 (fr)
WO (2) WO2018053035A1 (fr)

Cited By (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11434484B2 (en) * 2015-03-13 2022-09-06 The Jackson Laboratory Three-component CRISPR/Cas complex system and uses thereof
US11434491B2 (en) 2018-04-19 2022-09-06 The Regents Of The University Of California Compositions and methods for gene editing
US11780895B2 (en) 2016-09-13 2023-10-10 The Jackson Laboratory Targeted DNA demethylation and methylation

Families Citing this family (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CA3047011A1 (fr) 2017-01-26 2018-08-02 The Regents Of The University Of California Demethylation ciblee de genes dans des plantes
CN113454216A (zh) * 2018-11-29 2021-09-28 旗舰先锋创新V股份有限公司 调节rna的方法
US20220333172A1 (en) * 2019-08-16 2022-10-20 The Jackson Laboratory Live cell imaging of non-repetitive genomic loci
CN111755072B (zh) * 2020-08-04 2021-02-02 深圳吉因加医学检验实验室 一种同时检测甲基化水平、基因组变异和插入片段的方法及装置
CN114835816B (zh) * 2021-01-14 2023-12-22 中国科学院遗传与发育生物学研究所 一种调控植物基因组dna特定区域甲基化水平的方法
IT202200006287A1 (it) * 2022-03-30 2023-09-30 Fondazione St Italiano Tecnologia Molecole di acido nucleico funzionali per regolazione epigenetica
WO2023247789A1 (fr) 2022-06-24 2023-12-28 European Molecular Biology Laboratory Outil modulaire basé sur une crispr pour l'introduction spécifique de modifications épigénétiques sur des loci cibles
WO2024173896A1 (fr) * 2023-02-17 2024-08-22 Whitehead Institute For Biomedical Research Compositions et procédés pour effectuer des modifications épigénétiques

Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20140315985A1 (en) * 2013-03-14 2014-10-23 Caribou Biosciences, Inc. Compositions and methods of nucleic acid-targeting nucleic acids

Family Cites Families (28)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4911920A (en) 1986-07-30 1990-03-27 Alcon Laboratories, Inc. Sustained release, comfort formulation for glaucoma therapy
US5235033A (en) 1985-03-15 1993-08-10 Anti-Gene Development Group Alpha-morpholino ribonucleoside derivatives and polymers thereof
US5034506A (en) 1985-03-15 1991-07-23 Anti-Gene Development Group Uncharged morpholino-based polymers having achiral intersubunit linkages
FR2588189B1 (fr) 1985-10-03 1988-12-02 Merck Sharp & Dohme Composition pharmaceutique de type a transition de phase liquide-gel
US5585362A (en) 1989-08-22 1996-12-17 The Regents Of The University Of Michigan Adenovirus vectors for gene therapy
EP0495421B1 (fr) 1991-01-15 1996-08-21 Alcon Laboratories, Inc. Utilisation de carragheenane dans des compositions ophthalmologiques topiques
US5212162A (en) 1991-03-27 1993-05-18 Alcon Laboratories, Inc. Use of combinations gelling polysaccharides and finely divided drug carrier substrates in topical ophthalmic compositions
DE69233013T2 (de) 1991-08-20 2004-03-04 The Government Of The United States Of America As Represented By The Secretary Of National Institute Of Health, Office Of Technology Transfer Adenovirus vermittelter gentransfer in den gastrointestinaltrakt
US5252479A (en) 1991-11-08 1993-10-12 Research Corporation Technologies, Inc. Safe vector for gene therapy
FR2688514A1 (fr) 1992-03-16 1993-09-17 Centre Nat Rech Scient Adenovirus recombinants defectifs exprimant des cytokines et medicaments antitumoraux les contenant.
WO1994012649A2 (fr) 1992-12-03 1994-06-09 Genzyme Corporation Therapie genique de la fibrose kystique
CA2166118C (fr) 1993-06-24 2007-04-17 Frank L. Graham Vecteurs d'adenovirus pour therapie genique
PT797676E (pt) 1993-10-25 2006-05-31 Canji Inc Vector adenoviral recombinante e metodos de utilizacao
US7078387B1 (en) 1998-12-28 2006-07-18 Arch Development Corp. Efficient and stable in vivo gene transfer to cardiomyocytes using recombinant adeno-associated virus vectors
US6613318B1 (en) * 1999-03-25 2003-09-02 The United States Of America As Represented By The Department Of Health And Human Services Methods for identifying inhibitors of GADD45 polypeptide activity, and inhibitors of such activity
KR101234281B1 (ko) * 2004-04-09 2013-02-18 가부시키가이샤 진케어켄큐쇼 염색체 안정화에 관한 유전자를 표적으로 하는 암세포 특이적 아포토시스 유도제
WO2010075303A1 (fr) * 2008-12-23 2010-07-01 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Facteurs d'épissage avec un domaine de liaison à l'arn de protéine puf et domaine effecteur d'épissage et leurs utilisations
WO2010074758A2 (fr) * 2008-12-24 2010-07-01 The Johns Hopkins University Compositions favorisant la déméthylation de l'adn épigénétique et leurs méthodes d'application
US8889394B2 (en) * 2009-09-07 2014-11-18 Empire Technology Development Llc Multiple domain proteins
US9499805B2 (en) 2010-06-18 2016-11-22 The University Of North Carolina At Chapel Hill Methods and compositions for synthetic RNA endonucleases
DE102010026500A1 (de) 2010-07-07 2012-01-12 Arthrogen Gmbh Verfahren zur Herstellung von autologen Proteinen
DK2800811T3 (en) 2012-05-25 2017-07-17 Univ Vienna METHODS AND COMPOSITIONS FOR RNA DIRECTIVE TARGET DNA MODIFICATION AND FOR RNA DIRECTIVE MODULATION OF TRANSCRIPTION
US9890364B2 (en) * 2012-05-29 2018-02-13 The General Hospital Corporation TAL-Tet1 fusion proteins and methods of use thereof
US10077453B2 (en) 2014-07-30 2018-09-18 President And Fellows Of Harvard College CAS9 proteins including ligand-dependent inteins
US10330674B2 (en) * 2015-01-13 2019-06-25 Massachusetts Institute Of Technology Pumilio domain-based modular protein architecture for RNA binding
EP3268472B1 (fr) * 2015-03-13 2021-05-05 The Jackson Laboratory Système de complexe cas/crispr à trois constituants et utilisations de ce dernier
EP3500675A4 (fr) * 2016-08-19 2020-01-29 Whitehead Institute for Biomedical Research Méthodes d'édition de la méthylation de l'adn
EP3512535A4 (fr) 2016-09-13 2020-05-06 The Jackson Laboratory Déméthylation d'adn améliorée ciblée

Patent Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20140315985A1 (en) * 2013-03-14 2014-10-23 Caribou Biosciences, Inc. Compositions and methods of nucleic acid-targeting nucleic acids

Cited By (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11434484B2 (en) * 2015-03-13 2022-09-06 The Jackson Laboratory Three-component CRISPR/Cas complex system and uses thereof
US11780895B2 (en) 2016-09-13 2023-10-10 The Jackson Laboratory Targeted DNA demethylation and methylation
US11434491B2 (en) 2018-04-19 2022-09-06 The Regents Of The University Of California Compositions and methods for gene editing

Also Published As

Publication number Publication date
CN109982710B (zh) 2024-09-10
US20200071369A1 (en) 2020-03-05
US11780895B2 (en) 2023-10-10
WO2018053035A1 (fr) 2018-03-22
EP3512565A1 (fr) 2019-07-24
JP7063885B2 (ja) 2022-05-09
WO2018053037A1 (fr) 2018-03-22
AU2017327384A1 (en) 2019-04-11
EP3512535A1 (fr) 2019-07-24
CA3036695A1 (fr) 2018-03-22
AU2017327384B2 (en) 2021-05-20
JP2019528718A (ja) 2019-10-17
EP3512565A4 (fr) 2020-05-06
CN109982710A (zh) 2019-07-05
EP3512535A4 (fr) 2020-05-06
US20240132557A1 (en) 2024-04-25

Similar Documents

Publication Publication Date Title
US20240132557A1 (en) Targeted dna demethylation and methylation
US10793842B2 (en) Cas9 variants and methods of use thereof
US11118194B2 (en) Modified site-directed modifying polypeptides and methods of use thereof
US11008555B2 (en) Variant Cas9 polypeptides comprising internal insertions
US11208638B2 (en) Heterodimeric Cas9 and methods of use thereof
JP7044373B2 (ja) ヌクレアーゼ非依存的な標的化遺伝子編集プラットフォームおよびその用途
ES2960803T3 (es) Métodos y composiciones para la modificación de ADN diana dirigida por RNA y para la modulación de la transcripción dirigida por RNA
US20180320202A1 (en) Compositions and methods for modifying a target nucleic acid
KR20230169449A (ko) Rna-가이드된 핵산 변형 효소 및 이의 사용 방법
US20220315914A1 (en) Variant type v crispr/cas effector polypeptides and methods of use thereof
US20200291369A1 (en) Improved CRISPR-Cas9 Genome Editing Tool
KR20220019794A (ko) 표적화된 유전자 편집 작제물 및 이의 사용 방법
KR20180102025A (ko) C2c1 엔도뉴클레아제를 포함하는 유전체 교정용 조성물 및 이를 이용한 유전체 교정 방법
US9816077B2 (en) Use of integrase for targeted gene expression
WO2024124237A2 (fr) Endonucléases de modification génique
WO2024124238A1 (fr) Endonucléases de modification génique

Legal Events

Date Code Title Description
STPP Information on status: patent application and granting procedure in general

Free format text: APPLICATION UNDERGOING PREEXAM PROCESSING

AS Assignment

Owner name: THE JACKSON LABORATORY, MAINE

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:CHENG, ALBERT;TAGHBALOUT, AZIZ;JILLETTE, NATHANIEL;REEL/FRAME:058487/0844

Effective date: 20210813

STPP Information on status: patent application and granting procedure in general

Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION

STPP Information on status: patent application and granting procedure in general

Free format text: NON FINAL ACTION MAILED

STPP Information on status: patent application and granting procedure in general

Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER

STPP Information on status: patent application and granting procedure in general

Free format text: NON FINAL ACTION MAILED