US20190169308A1 - Novel bispecific polypeptides against cd137 - Google Patents
Novel bispecific polypeptides against cd137 Download PDFInfo
- Publication number
- US20190169308A1 US20190169308A1 US16/094,127 US201716094127A US2019169308A1 US 20190169308 A1 US20190169308 A1 US 20190169308A1 US 201716094127 A US201716094127 A US 201716094127A US 2019169308 A1 US2019169308 A1 US 2019169308A1
- Authority
- US
- United States
- Prior art keywords
- seq
- antibody
- heavy chain
- light chain
- variable region
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
Images
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
- A61K39/3955—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
- A61K39/39558—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against tumor tissues, cells, antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/04—Immunostimulants
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2878—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/21—Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/31—Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
- C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
- C07K2317/622—Single chain antibody (scFv)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/71—Decreased effector function due to an Fc-modification
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/74—Inducing cell proliferation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/75—Agonist effect on antigen
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/94—Stability, e.g. half-life, pH, temperature or enzyme-resistance
Definitions
- Cancer is a leading cause of premature deaths in the developed world.
- Immunotherapy of cancer aims to mount an effective immune response against tumour cells. This may be achieved by, for example, breaking tolerance against tumour antigen, augmenting anti-tumor immune responses, and stimulating local cytokine responses at the tumor site.
- the key effector cell of a long lasting anti-tumor immune response is the activated tumor specific effector T cell. Potent expansion of activated tumour-specific effector T cells can redirect the immune response towards the tumor.
- various immunosuppressive mechanisms induced by the tumor microenvironment suppress the activity of effector T cells.
- Several immunosuppressive mediators are expressed by the tumor cells. Such mediators inhibit T cell activation, either directly, or indirectly by inducing e.g.
- Treg regulatory T cells
- myeloid-derived suppressor cells e.g., myeloid-derived suppressor cells. Depleting, inhibiting, reverting or inactivating such regulatory cells may therefore provide anti-tumor effects and revert the immune suppression in the tumor microenvironment. Further, incomplete activation of effector T cells by, for example, dendritic cells can result in sub-optimally activated or anergic T cells, resulting in an inefficient anti-tumor response. In contrast, adequate induction by dendritic cells can generate a potent expansion of activated effector T cells, redirecting the immune response towards the tumor.
- NK cells play an important role in tumor immunology by attacking tumor cells with down-regulated human leukocyte antigen (HLA) expression and by inducing antibody dependent cellular cytotoxicity (ADCC). Stimulation of NK cells may thus also reduce tumor growth.
- HLA human leukocyte antigen
- ADCC antibody dependent cellular cytotoxicity
- Tumor-associated antigens are cell surface proteins selectively expressed on tumor cells.
- the term tumor-associated indicates that TAA are not completely tumor-specific, but are rather over-expressed on the tumor.
- TAA Tumor-associated antigens
- Some well-studied TAA include the EGFR family molecules (HER2, HER3 and EGFR/HER1), VEGFR, EpCAM, CEA, PSA, PSMA, EphA2, gp100, GD2, MUC1, CD20, CD19, CD22 and CD33, summarized in (Cheever et al., 2009).
- 5T4 also designated trophoblast glycoprotein, TPBG, M6P1 and Waif1
- TPBG trophoblast glycoprotein
- M6P1 and Waif1 trophoblast glycoprotein
- 5T4 expression is tumor-selective, with no or low expression in most normal tissues.
- 5T4 is mainly expressed in the placenta (trophoblast and amniotic epithelium) and at low levels in some specialised epithelia (Hole and Stern, 1988), as well as low at levels in other normal tissues (see US 2010/0021483).
- placenta trophoblast and amniotic epithelium
- Hole and Stern, 1988 specialised epithelia
- Low at levels in other normal tissues see US 2010/0021483.
- the safety risk associated with this is considered low since expression levels in the tumor are considerably higher. This is supported by the fact that the phase III clinical programs, ANYARA and TroVax targeting 5T4 did not report severe 5T4-related toxicities.
- CD137 (4-1BB, TNFRSF9) is a tumor necrosis factor (TNF) receptor (TNFR) superfamily member. Its role in cancer immunotherapy has been reviewed in e.g. (Bartkowiak and Curran, 2015). Activation of CD137 is dependent on receptor oligomerization (Rabu et al., 2005; Wyzgol et al., 2009) which is induced by binding to CD137L expressed as a trimer on the cell surface of antigen presenting cells (APCs) and other cell types.
- APCs antigen presenting cells
- CD137 is expressed on various cell populations including activated CD4 + and CD8 + T cells, regulatory T cells (Treg), dendritic cells (DC), monocytes, mast cells, eosinophils and tumor endothelial cells.
- CD137 activation plays an important role in CD8 + T cell activation and survival (Lee et al., 2002; Pulle et al., 2006). It sustains and augments effector functions and preferentially supports Th1 cytokine production (Shuford et al., 1997).
- CD137 stimulation initially results in activation and later in activation-induced cell death, which is thought to explain why CD137 agonistic antibodies have shown therapeutic effect in tumor immunity as well as in autoimmunity (Zhang, J C I, 2007, Sun, Trends Mol Med, 2003). CD137 has also been reported to suppress Treg function or convert Tregs to cytotoxic CD4 + T-cells (Akhmetzyanova et al., 2016; So et al., 2008).
- CD137 is upregulated on NK cells activated by cytokines or CD16 (Fc ⁇ RIII) stimulation (ref in Melero, CCR 19 (5)1044-53, 2013). Activation of CD137 has been shown to increase antibody-dependent cellular cytotoxicity (ADCC) activity of NK cells in both murine and human cells (Kohrt 2012 and 2014 J Clin Invest, reviewed by Hout 2012, Oncoimm). Further, CD137 is expressed on APCs, such as DCs and macrophages, and stimulation of CD137 on these cell types may induce immune activation that can result in tumor immunity.
- APCs such as DCs and macrophages
- Agonistic CD137 antibody has been shown to activate endothelial cells in the tumor environment, leading to upregulation of ICAM-1 and VCAM-1 and improved T cell recruitment (Palazon, Cancer Res, 2011).
- the mode of action may include various cell types, with CD8 + T cells being one of the main effector cells involved in CD137-induced tumor immunity (Dubrot et al., 2010; Gauttier et al., 2014; Kim et al., 2001; McMillin et al., 2006; Melero et al., 1997; Miller et al., 2002; Sallin et al., 2014; Taraban et al., 2002; Uno et al., 2006; Vinay and Kwon, 2012; Wilcox et al., 2002).
- Urelumab (BMS-66513) is a fully human IgG4 antibody developed by Bristol-Myers Squibb.
- BMS-66513 is a fully human IgG4 antibody developed by Bristol-Myers Squibb.
- Phase II studies in various indications are currently ongoing.
- a Phase II study with Urelumab as a second line therapy in metastatic melanoma was terminated in 2009 due to liver toxicity (Garber, 2011; Li and Liu, 2013).
- PF-05082566 is a fully human IgG2 antibody developed by Pfizer. It is currently in phase I development in lymphoma and various solid cancers and preliminary data suggest that it is well tolerated but with only modest anti-tumor effects.
- Toxicity upon CD137 activation has been observed in patients as well as in mouse models (Ascierto et al., 2010; Dubrot et al., 2010; Niu et al., 2007).
- the toxicity includes skin toxicities and liver toxicities manifested as increased aspartate amino transferase/alanine amino transferase ratio (ASAT/ALAT) levels and cytokine release.
- ASAT/ALAT aspartate amino transferase/alanine amino transferase ratio
- ADA antidrug-antibodies
- mice The toxicities seen in mice are reversible and seem to depend on TNFa/CD8+cells (Ascierto et al., 2010). Toxicology studies in monkeys showed that both single and repeated dosing of up to 100mg/kg once weekly for four weeks was tolerable with no skin or liver toxicity detected (Ascierto 2010 Semin Onc).
- TNFR family members are dependent on receptor cross-linking for activation to be induced.
- Such crosslinking may either be induced by the natural ligand expressed on the cell surface of cells or by recombinant, multimerized ligand. Alternatively, it may be induced by an antibody binding to the receptor and cross-linked by its Fc region bound to an Fc ⁇ receptor (Fc ⁇ R).
- Fc ⁇ R Fc ⁇ receptor
- CD137 agonistic antibodies require cross-linking, e.g. via Fc ⁇ R for effective activation to occur in vivo.
- Fc ⁇ RII is not critical for induction of tumor immunity by CD137, whereas Fc ⁇ RIII impairs tumor immunity (Sallin et al., 2014; Sanmamed et al., 2015) in mouse studies.
- the present invention seeks to provide improved polypeptide-based therapies for the treatment of cancer.
- a first aspect of the invention provides a bispecific polypeptide comprising a first binding domain, designated B1, which is capable of binding specifically to CD137, and a second binding domain, designated B2, which is capable of specifically binding to a tumour cell-associated antigen.
- Such bispecific compounds comprising one immune-activating moiety, e.g. a CD137 agonist, and one tumor-targeting moiety, e.g. a 5T4 binder, can be used to establish a highly effective and safe cancer immunotherapy.
- one immune-activating moiety e.g. a CD137 agonist
- one tumor-targeting moiety e.g. a 5T4 binder
- tumor-localizing immunotherapeutic molecules such as immunocytokines and bispecific antibodies have shown beneficial immune activation and inhibition of tumor growth in preclinical studies as well as in the clinic (reviewed in Kiefer and Neri, 2016).
- the designs of the molecular format of a CD137 agonist may be optimised. For example, a good efficacy/safety profile can be obtained by a TAA-CD137 bispecific antibody that requires crosslinking by binding to the TAA for CD137 activation to occur. Then, pre-activated, CD137-expressing T cells residing in the tumor will preferentially be activated, whereas CD137 expressing cells in other tissues will not.
- activation in this context being a net immune activation that results in a tumor-directed T cell response, for example by down-regulation of Tregs suppressive function and/or upregulation of effector T cell function).
- the bispecific polypeptides of the invention provide a distinct advantage over bispecific antibodies targeting CD3.
- CD3-targeting bispecific molecules use T cells as effector cells and are capable of activating T cells independent of TAA binding. Thus, they do not activate tumor specific T-cells in particular. The resulting anti-tumor effects are therefore not likely to generate a long lasting anti-tumor immunity.
- CD3 since CD3 is expressed on all T cells, systemic T cell activation is associated with toxicity issues.
- the bispecific antibodies of the invention have the potential to selectively activate tumor specific T-cells and generate a long lasting tumour immunity.
- polypeptide is used herein in its broadest sense to refer to a compound of two or more subunit amino acids, amino acid analogs, or other peptidomimetics.
- polypeptide thus includes short peptide sequences as well as longer polypeptides and proteins.
- amino acid refers to either natural and/or unnatural or synthetic amino acids, including both D or L optical isomers, and amino acid analogs and peptidomimetics.
- bispecific as used herein means the polypeptide is capable of specifically binding at least two target entities.
- the polypeptide is a bispecific antibody (numerous examples of which are described in detail below).
- first and/or second binding domains may be selected from the group consisting of antibodies and antigen-binding fragments thereof.
- an antibody or an antigen-binding fragment thereof we include substantially intact antibody molecules, as well as chimaeric antibodies, humanised antibodies, isolated human antibodies, single chain antibodies, bispecific antibodies, antibody heavy chains, antibody light chains, homodimers and heterodimers of antibody heavy and/or light chains, and antigen-binding fragments and derivatives of the same.
- Suitable antigen-binding fragments and derivatives include Fv fragments (e.g. single chain Fv and disulphide-bonded Fv), Fab-like fragments (e.g. Fab fragments, Fab′ fragments and F(ab)2 fragments), single variable domains (e.g. VH and VL domains) and single domain antibodies (dAbs, including single and dual formats [i.e.
- dAb-linker-dAb dAb-linker-dAb
- nanobodies dAb-linker-dAb
- the smaller size of the fragments may lead to improved pharmacological properties, such as better penetration of solid tissue.
- antigen-binding fragments such as Fab, Fv, ScFv and dAb antibody fragments can be expressed in and secreted from E. coli, thus allowing the facile production of large amounts of the said fragments.
- the antigen-binding fragment is selected from the group consisting of: Fv fragments (such as a single chain Fv fragment, or a disulphide-bonded Fv fragment), Fab-like fragments (such as a Fab fragment; a Fab′ fragment or a F(ab) 2 fragment) and single domain antibodies.
- Fv fragments such as a single chain Fv fragment, or a disulphide-bonded Fv fragment
- Fab-like fragments such as a Fab fragment; a Fab′ fragment or a F(ab) 2 fragment
- single domain antibodies single domain antibodies
- first binding domain (B1) and/or the second binding domain (B2) may comprise or consist of a Fab fragment.
- first binding domain (B1) and/or the second binding domain (B2) may comprise or consist of an Fv fragment (such as an scFv or di-sulphide bridged Fv).
- Fv fragment such as an scFv or di-sulphide bridged Fv.
- the VH and VL regions therein may be joined by a linker sequence, for example:
- scFv polypeptides may be glycosylated, for example N-glycosylated, on one or more amino acid residues.
- an antibody or an antigen-binding fragment thereof is also intended to encompass antibody mimics (for example, non-antibody scaffold structures that have a high degree of stability yet allow variability to be introduced at certain positions).
- antibody mimics for example, non-antibody scaffold structures that have a high degree of stability yet allow variability to be introduced at certain positions.
- Exemplary antibody mimics include: affibodies (also called Trinectins; Nygren, 2008, FEBS J, 275, 2668-2676); CTLDs (also called Tetranectins; Innovations Pharmac. Technol. (2006), 27-30); adnectins (also called monobodies; Meth. Mol.
- chimaeric T-cell receptors also known as chimaeric T cell receptors, chimaeric immunoreceptors, and chimaeric antigen receptors or CARs
- CARs chimaeric antigen receptors
- Pule et al., 2003, Cytotherapy 5(3):211-26 the disclosures of which are incorporated herein by reference.
- engineered receptors which graft an arbitrary specificity onto an immune effector cell.
- CARs are used to graft the specificity of a monoclonal antibody onto a T cell; with transfer of their coding sequence facilitated by retroviral vectors.
- fusions comprising a single-chain variable fragment (scFv) derived from a monoclonal antibody fused to CD3-zeta transmembrane and endodomain.
- scFv single-chain variable fragment
- the invention also encompasses modified versions of antibodies and antigen-binding fragments thereof, whether existing now or in the future, e.g. modified by the covalent attachment of polyethylene glycol or another suitable polymer (see below).
- antibodies may be generated via any one of several methods which employ induction of in vivo production of antibody molecules, screening of immunoglobulin libraries (Orlandi et al, 1989. Proc. Natl. Acad. Sci. U.S.A. 86:3833-3837; Winter et al., 1991, Nature 349:293-299, the disclosures of which are incorporated herein by reference) or generation of monoclonal antibody molecules by cell lines in culture.
- antibody fragments can be obtained using methods well known in the art (see, for example, Harlow & Lane, 1988, “Antibodies: A Laboratory Manual”, Cold Spring Harbor Laboratory, New York, the disclosures of which are incorporated herein by reference).
- antibody fragments according to the present invention can be prepared by proteolytic hydrolysis of the antibody or by expression in E. coli or mammalian cells (e.g. Chinese hamster ovary cell culture or other protein expression systems) of DNA encoding the fragment.
- antibody fragments can be obtained by pepsin or papain digestion of whole antibodies by conventional methods.
- human or humanised antibodies are preferably used.
- Humanised forms of non-human (e.g. murine) antibodies are genetically engineered chimaeric antibodies or antibody fragments having preferably minimal-portions derived from non-human antibodies.
- Humanised antibodies include antibodies in which complementary determining regions of a human antibody (recipient antibody) are replaced by residues from a complementary determining region of a non-human species (donor antibody) such as mouse, rat or rabbit having the desired functionality.
- donor antibody such as mouse, rat or rabbit having the desired functionality.
- Fv framework residues of the human antibody are replaced by corresponding non-human residues.
- Humanised antibodies may also comprise residues which are found neither in the recipient antibody nor in the imported complementarity determining region or framework sequences.
- the humanised antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the complementarity determining regions correspond to those of a non-human antibody and all, or substantially all, of the framework regions correspond to those of a relevant human consensus sequence.
- Humanised antibodies optimally also include at least a portion of an antibody constant region, such as an Fc region, typically derived from a human antibody (see, for example, Jones et al., 1986. Nature 321:522-525; Riechmann et al., 1988, Nature 332:323-329; Presta, 1992, Curr. Op. Struct. Biol. 2:593-596, the disclosures of which are incorporated herein by reference).
- the humanised antibody has one or more amino acid residues introduced into it from a source which is non-human. These non-human amino acid residues, often referred to as imported residues, are typically taken from an imported variable domain. Humanisation can be essentially performed as described (see, for example, Jones et al., 1986, Nature 321:522-525; Reichmann et al., 1988. Nature 332:323-327; Verhoeyen et al., 1988, Science 239:1534-15361; U.S. Pat. No.
- humanised antibodies are chimaeric antibodies, wherein substantially less than an intact human variable domain has been substituted by the corresponding sequence from a non-human species.
- humanised antibodies may be typically human antibodies in which some complementarity determining region residues and possibly some framework residues are substituted by residues from analogous sites in rodent antibodies.
- Human antibodies can also be identified using various techniques known in the art, including phage display libraries (see, for example, Hoogenboom & Winter, 1991, J. Mol. Biol. 227:381; Marks et al., 1991, J. Mol. Biol. 222:581; Cole et al., 1985, In: Monoclonal antibodies and Cancer Therapy, Alan R. Liss, pp. 77; Boerner et al., 1991. J. Immunol. 147:86-95, the disclosures of which are incorporated herein by reference).
- phage display libraries see, for example, Hoogenboom & Winter, 1991, J. Mol. Biol. 227:381; Marks et al., 1991, J. Mol. Biol. 222:581; Cole et al., 1985, In: Monoclonal antibodies and Cancer Therapy, Alan R. Liss, pp. 77; Boerner et al., 1991. J. Immunol. 147:86
- bispecific polypeptides e.g. antibodies
- the bispecific polypeptides may be of any suitable structural format.
- bispecific antibodies of the invention are provided:
- the bispecific antibody may comprise a human Fc region, or a variant of a said region, where the region is an IgG1, IgG2, IgG3 or IgG4 region, preferably an IgG1 or IgG4 region.
- One approach to improve the efficacy of a therapeutic antibody is to increase its serum persistence, thereby allowing higher circulating levels, less frequent administration and reduced doses.
- FcRn which is expressed on the surface of endothelial cells, binds the IgG in a pH-dependent manner and protects it from degradation.
- the Fc portion of the bispecific antibody should bind with no or very low affinity to Fc ⁇ R, since Fc ⁇ R-mediated crosslinking of a CD137 antibody may induce activation.
- very low affinity we include that the Fc portion exhibits at least 10 times reduced affinity to Fc ⁇ RI, Fc ⁇ RII and III compared to wild-type IgG1, as determined by the concentration where half maximal binding is achieved in flow cytometric analysis of Fc ⁇ R expressing cells (Hezareh et al., 2001, J Virol, 75(24):12161-8) or by Fc ⁇ R ELISA (Shields et al., 2001, J Biol Chem. 276(9):6591-604).
- ADCC antibody-dependent cellular cytotoxicity
- ADCP antibody-dependent cellular phagocytosis
- CDC complement-dependent cytotoxicity
- the four human IgG isotypes bind the activating Fc ⁇ receptors (Fc ⁇ RI, Fc ⁇ RIIa, Fc ⁇ RIIIa), the inhibitory Fc ⁇ RIIb receptor, and the first component of complement (C1q) with different affinities, yielding very different effector functions (Bruhns et al., 2009, Blood. 113(16):3716-25, the disclosures of which are incorporated herein by reference).
- IgG1 molecules have the highest affinity and capacity to induce effector functions, whereas IgG2, IgG3 and IgG4 are less effective (Bruhns, 2012; Hogarth and Pietersz, 2012; Stewart et al., 2014) (Wang 2015 Front 1m; Vidarson 2014 Fron Imm).
- certain mutations in the Fc region of IgG1 dramatically reduces Fc ⁇ R affinity and effector function while retaining neonatal FcR (FcRn) interaction (Ju and Jung, 2014; Leabman et al., 2013; Oganesyan et al., 2008; Sazinsky et al., 2008).
- IgG1 mutants are N297A alone or in combination with D265A, as well as mutations at positions L234 and L235, including the so-called “LALA” double mutant L234A/L235A.
- Another position described to further silence IgG1 by mutation is P329 (see US 2012/0251531).
- choosing a mutated IgG1 format with low effector function but retained binding to FcRn may result in a bispecific antibody with 5T4-dependent activation of CD137, and exhibiting a favorable efficacy/safety profile and good PK properties.
- the polypeptide is incapable of inducing antibody dependent cell cytotoxicity (ADCC), antibody-dependent cellular phagocytosis (ADCP), and/or complement-dependent cytotoxicity (CDC).
- ADCC antibody dependent cell cytotoxicity
- ADCP antibody-dependent cellular phagocytosis
- CDC complement-dependent cytotoxicity
- the Fc region may be a variant of a human IgG1 Fc region comprising a mutation at one or more of the following positions:
- alanine may be present at the mutated positions(s).
- the IgG1 variant may be a variant of a human IgG1 Fc region comprising mutations L234A and L235A (i.e. the LALA double mutant; see SEQ ID NO: 86).
- bispecific polypeptides of the invention may be of several different structural formats (for example, see Chan & Carter, 2016, Nature Reviews Immunology 10, 301-316, the disclosures of which are incorporated herein by reference).
- the bispecific antibody is selected from the groups consisting of:
- the bispecific antibody may be an IgG-scFv antibody (see FIG. 1 ).
- the IgG-scFv antibody (and, specifically, the scFv domain therein) may be in either VH-VL or VL-VH orientation.
- the scFv may be stabilised by a S-S bridge between VH and VL.
- the bispecific antibody may be an scFv 2 -Fc antibody, for example a dimer wherein each polypeptide comprises, from the N-terminus to C-terminus, a first scFv, a hinge domain, an Fc domain and a second scFv (see FIG. 1 ).
- binding domain B1 and binding domain B2 are fused directly to each other.
- binding domain B1 and binding domain B2 are joined via a polypeptide linker.
- a polypeptide linker may be a short linker peptide between about 10 to about 25 amino acids.
- the linker is usually rich in glycine for flexibility, as well as serine or threonine for solubility, and can either connect the N-terminus of the VH with the C-terminus of the VL, or vice versa.
- binding domain B1 and binding domain B2 are separated by immunoglobulin constant regions (such as an Fc region) on a polypeptide.
- amino acid as used herein includes the standard twenty genetically-encoded amino acids and their corresponding stereoisomers in the ‘D’ form (as compared to the natural ‘L’ form), omega-amino acids other naturally-occurring amino acids, unconventional amino acids (e.g. a,a-disubstituted amino acids, N-alkyl amino acids, etc.) and chemically derivatised amino acids (see below).
- amino acid When an amino acid is being specifically enumerated, such as “alanine” or “Ala” or “A”, the term refers to both L-alanine and D-alanine unless explicitly stated otherwise.
- Other unconventional amino acids may also be suitable components for polypeptides of the present invention, as long as the desired functional property is retained by the polypeptide.
- each encoded amino acid residue where appropriate, is represented by a single letter designation, corresponding to the trivial name of the conventional amino acid.
- the antibody polypeptides as defined herein comprise or consist of L-amino acids.
- antibody polypeptides of the invention may comprise or consist of one or more amino acids which have been modified or derivatised.
- Chemical derivatives of one or more amino acids may be achieved by reaction with a functional side group.
- derivatised molecules include, for example, those molecules in which free amino groups have been derivatised to form amine hydrochlorides, p-toluene sulphonyl groups, carboxybenzoxy groups, t-butyloxycarbonyl groups, chloroacetyl groups or formyl groups.
- Free carboxyl groups may be derivatised to form salts, methyl and ethyl esters or other types of esters and hydrazides.
- Free hydroxyl groups may be derivatised to form O-acyl or O-alkyl derivatives.
- Also included as chemical derivatives are those peptides which contain naturally occurring amino acid derivatives of the twenty standard amino acids.
- 4-hydroxyproline may be substituted for proline
- 5-hydroxylysine may be substituted for lysine
- 3-methylhistidine may be substituted for histidine
- homoserine may be substituted for serine and ornithine for lysine.
- Derivatives also include peptides containing one or more additions or deletions as long as the requisite activity is maintained.
- Other included modifications are amidation, amino terminal acylation (e.g. acetylation or thioglycolic acid amidation), terminal carboxylamidation (e.g. with ammonia or methylamine), and the like terminal modifications.
- one or more amino acid may be glycosylated, such as N-linked glycosylation (in which glycan moieties are attached to a nitrogen of asparagine or arginine side chains) and/or O-linked glycosylation (in which glycan moieties are attached to the hydroxyl oxygen of serine, threonine, tyrosine, hydroxylysine or hydroxyproline).
- N-linked glycosylation in which glycan moieties are attached to a nitrogen of asparagine or arginine side chains
- O-linked glycosylation in which glycan moieties are attached to the hydroxyl oxygen of serine, threonine, tyrosine, hydroxylysine or hydroxyproline.
- peptidomimetic refers to a compound that mimics the conformation and desirable features of a particular peptide as a therapeutic agent.
- the said polypeptide includes not only molecules in which amino acid residues are joined by peptide (—CO—NH—) linkages but also molecules in which the peptide bond is reversed.
- Such retro-inverso peptidomimetics may be made using methods known in the art, for example such as those described in Meziere et al. (1997) J. lmmunol. 159, 3230-3237, which is incorporated herein by reference. This approach involves making pseudo-peptides containing changes involving the backbone, and not the orientation of side chains.
- Retro-inverse peptides which contain NH—CO bonds instead of CO—NH peptide bonds, are much more resistant to proteolysis.
- the said polypeptide may be a peptidomimetic compound wherein one or more of the amino acid residues are linked by a —y(CH 2 NH)— bond in place of the conventional amide linkage.
- the peptide bond may be dispensed with altogether provided that an appropriate linker moiety which retains the spacing between the carbon atoms of the amino acid residues is used; it may be advantageous for the linker moiety to have substantially the same charge distribution and substantially the same planarity as a peptide bond.
- the said polypeptide may conveniently be blocked at its N- or C-terminus so as to help reduce susceptibility to exo-proteolytic digestion.
- a presumed bioactive conformation may be stabilised by a covalent modification, such as cyclisation or by incorporation of lactam or other types of bridges, for example see Veber et al., 1978, Proc. Natl. Acad. Sci. USA 75:2636 and Thursell et al., 1983, Biochem. Biophys. Res. Comm. 111:166, which are incorporated herein by reference.
- the bispecific polypeptide of the invention is capable of inducing tumour immunity. This can be tested in vitro in T cell activation assays, e.g. by measuring IL-2 and IFN ⁇ production. Activation of effector T cells would indicate that a tumour specific T cell response can be achieved in vivo. Further, an anti-tumour response in an in vivo model, such as a mouse model would imply that a successful immune response towards the tumour has been achieved.
- the bispecific polypeptide may modulate the activity of a target immune system cell, wherein said modulation is an increase or decrease in the activity of said cell.
- a target immune system cell include T cells, dendritic cells and natural killer cells.
- the immune system cell is typically a T cell.
- the antibody may increase the activity of a CD4+ or CD8+ effector T cell, or may decrease the activity of a regulatory T cell (Treg). In either case, the net effect of the antibody will be an increase in the activity of effector T cells, particularly CD8+ effector T cells.
- Methods for determining a change in the activity of effector T cells are well known and include, for example, measuring for an increase in the level of T cell cytokine production (e.g. IFN- ⁇ or IL-2) or an increase in T cell proliferation in the presence of the antibody relative to the level of T cell cytokine production and/or T cell proliferation in the presence of a control. Assays for cell proliferation and/or cytokine production are well known.
- polypeptide may be capable of inducing:
- the polypeptide or binding domains of the invention can also be characterised and defined by their binding abilities.
- Standard assays to evaluate the binding ability of ligands towards targets are well known in the art, including for example, ELISAs, Western blots, RIAs, and flow cytometry analysis.
- the binding kinetics (e.g., binding affinity) of the polypeptide also can be assessed by standard assays known in the art, such as by Surface Plasmon Resonance analysis (SPR).
- SPR Surface Plasmon Resonance analysis
- binding activity and “binding affinity” are intended to refer to the tendency of a polypeptide molecule to bind or not to bind to a target. Binding affinity may be quantified by determining the dissociation constant (Kd) for a polypeptide and its target. A lower Kd is indicative of a higher affinity for a target. Similarly, the specificity of binding of a polypeptide to its target may be defined in terms of the comparative dissociation constants (Kd) of the polypeptide for its target as compared to the dissociation constant with respect to the polypeptide and another, non-target molecule.
- Kd dissociation constant
- this dissociation constant can be determined directly by well-known methods, and can be computed even for complex mixtures by methods such as those, for example, set forth in Caceci et al. (Byte 9:340-362, 1984; the disclosures of which are incorporated herein by reference).
- the Kd may be established using a double-filter nitrocellulose filter binding assay such as that disclosed by Wong & Lohman (Proc. Natl. Acad. Sci. USA 90, 5428-5432, 1993).
- Other standard assays to evaluate the binding ability of ligands such as antibodies towards targets are known in the art, including for example, ELISAs, Western blots, RIAs, and flow cytometry analysis.
- the binding kinetics (e.g., binding affinity) of the antibody also can be assessed by standard assays known in the art, such as by BiacoreTM system analysis.
- a competitive binding assay can be conducted in which the binding of the antibody to the target is compared to the binding of the target by another, known ligand of that target, such as another antibody.
- the concentration at which 50% inhibition occurs is known as the Ki.
- the Ki is equivalent to Kd.
- the Ki value will never be less than the Kd, so measurement of Ki can conveniently be substituted to provide an upper limit for Kd.
- EC50 indicates the concentration at which a polypeptide achieves 50% of its maximum binding to a fixed quantity of target.
- IC50 indicates the concentration at which a polypeptide inhibits 50% of the maximum binding of a fixed quantity of competitor to a fixed quantity of target. In both cases, a lower level of EC50 or IC50 indicates a higher affinity for a target.
- the EC50 and IC50 values of a ligand for its target can both be determined by well-known methods, for example ELISA. Suitable assays to assess the EC50 and IC50 of polypeptides are set out in the Examples.
- a polypeptide of the invention is preferably capable of binding to its target with an affinity that is at least two-fold, 10-fold, 50-fold, 100-fold or greater than its affinity for binding to another non-target molecule.
- the bispecific polypeptides of the invention comprise a binding domain (B1) which is capable of specifically binding to CD137.
- binding domain B1 binds to human CD137 with a K D of less than 10 ⁇ 10 ⁇ 9 M, for example less than 4 ⁇ 10 ⁇ 9 M or less than 1.2 ⁇ 10 ⁇ 9 M.
- binding domain B1 comprises:
- binding domain B1 may comprise:
- bispecific polypeptides of the invention may alternatively comprise variants of the above-defined variable regions.
- a variant of any one of the heavy or light chain amino acid sequences recited herein may be a substitution, deletion or addition variant of said sequence.
- a variant may comprise 1, 2, 3, 4, 5, up to 10, up to 20, up to 30 or more amino acid substitutions and/or deletions from the said sequence.
- “Deletion” variants may comprise the deletion of individual amino acids, deletion of small groups of amino acids such as 2, 3, 4 or 5 amino acids, or deletion of larger amino acid regions, such as the deletion of specific amino acid domains or other features.
- “Substitution” variants preferably involve the replacement of one or more amino acids with the same number of amino acids and making conservative amino acid substitutions.
- an amino acid may be substituted with an alternative amino acid having similar properties, for example, another basic amino acid, another acidic amino acid, another neutral amino acid, another charged amino acid, another hydrophilic amino acid, another hydrophobic amino acid, another polar amino acid, another aromatic amino acid or another aliphatic amino acid.
- an alternative amino acid having similar properties, for example, another basic amino acid, another acidic amino acid, another neutral amino acid, another charged amino acid, another hydrophilic amino acid, another hydrophobic amino acid, another polar amino acid, another aromatic amino acid or another aliphatic amino acid.
- Amino acids herein may be referred to by full name, three letter code or single letter code.
- derivatives or “variants” include those in which instead of the naturally occurring amino acid the amino acid which appears in the sequence is a structural analog thereof.
- Amino acids used in the sequences may also be derivatised or modified, e.g. labelled, providing the function of the antibody is not significantly adversely affected.
- Derivatives and variants as described above may be prepared during synthesis of the antibody or by post-production modification, or when the antibody is in recombinant form using the known techniques of site-directed mutagenesis, random mutagenesis, or enzymatic cleavage and/or ligation of nucleic acids.
- variants have an amino acid sequence which has more than 60%, or more than 70%, e.g. 75 or 80%, preferably more than 85%, e.g. more than 90 or 95% amino acid identity to a sequence as shown in the sequences disclosed herein (e.g. the VH or VL region sequences, or CDR sequences therein). This level of amino acid identity may be seen across the full length of the relevant SEQ ID NO sequence or over a part of the sequence, such as across 20, 30, 50, 75, 100, 150, 200 or more amino acids, depending on the size of the full-length polypeptide.
- variants of the above CDR sequences may comprise one, two three, four, five, six, seven, eight or more amino acid mutations relative to the reference sequence (such as a deletion, substitution and/or insertion of an amino acid).
- sequence identity refers to sequences which have the stated value when assessed using ClustalW (Thompson et al., 1994, Nucleic Acids Res. 22(22):4673-80; the disclosures of which are incorporated herein by reference) with the following parameters:
- Pairwise alignment parameters Method: accurate, Matrix: PAM, Gap open penalty: 10.00, Gap extension penalty: 0.10;
- binding domain B1 may comprises one or more variants of the above-defined light chain variable regions and/or said heavy chain variable regions having at least 90% sequence identity thereto.
- binding domain B1 comprises:
- binding domain B1 comprises the light chain variable region and the heavy chain variable region of antibody 1200/1201 (SEQ ID NO: 19 and/or SEQ ID NO: 17), or a variant which has more than 60%, or more than 70%, e.g. 75 or 80%, preferably more than 85%, e.g. more than 90 or 95% amino acid identity to SEQ ID NO: 19 and/or SEQ ID NO: 17).
- binding domain B1 comprises the light chain variable region and the heavy chain variable region of antibody 1618/1619 (SEQ ID NO: 35 and/or SEQ ID NO: 33), or a variant which has more than 60%, or more than 70%, e.g. 75 or 80%, preferably more than 85%, e.g. more than 90 or 95% amino acid identity to SEQ ID NO: 35 and/or SEQ ID NO: 33).
- the bispecific polypeptides of the invention further comprise a binding domain (B2) which is capable of specifically binding a tumour cell-associated antigen.
- tumour cell-associated antigen we include proteins accessible on the extracellular surface of tumour cells, such that they are accessible to the bispecific polypeptides of the invention following administration into the body.
- the tumour cell-associated antigen is tumour specific, i.e. it is found exclusively on tumour cells and not on normal, healthy cells.
- the tumour cell-associated antigen may be preferentially expressed on tumour cells, i.e. it is expressed on tumour cells at a higher level than on normal, healthy cells (thus, expression of the antigen on tumour cells may be at least five times more than on normal, healthy cells, for example expression levels on tumour cells of at least ten times more, twenty times more, fifty time more or greater).
- binding domain B2 binds to a tumour cell-associated antigen selected from the group consisting of:
- the tumour cell-associated antigen may be selected from the group consisting of 5T4, CD20, CD19, MUC-1, carcinoembryonic antigen (CEA), CA-125, 0017-1A, E p CAM, HER2, EGFR, HER3, GD2, Podocalyxin, TROP-2, DLK-1, Ox1R, Nectin-4, FAP, EphA2, EphA3, mesothelin, E-cadherin, CD24 and VEGFR.
- CEA carcinoembryonic antigen
- the tumour cell-associated antigen is an oncofetal antigen.
- the tumour cell-associated antigen may be 5T4 (for example, see UniProt Q13641).
- the tumour cell is a solid tumour cell.
- the solid tumour may be selected from the groups consisting of renal cell carcinoma, colorectal cancer, lung cancer, prostate cancer, breast cancer, melanomas, bladder cancer, brain/CNS cancer, cervical cancer, oesophageal cancer, gastric cancer, head/neck cancer, kidney cancer, liver cancer, lymphomas, ovarian cancer, pancreatic cancer and sarcomas.
- binding domain B2 binds to the tumour cell-associated antigen with a K D of less than 10 ⁇ 10 ⁇ 9 M, for example less than 4 ⁇ 10 ⁇ 9 M or less than 1.2 ⁇ 10 ⁇ 9 M.
- binding domain B2 comprises:
- the numbering of the antibody e.g. Antibody X/Y
- binding domain B2 may comprise:
- binding domain B2 may alternatively comprise variants of said light chain variable regions and/or said heavy chain variable regions, for example having at least 90% sequence identity thereto.
- variants of the above CDR sequences may comprise one, two three, four, five, six, seven, eight or more amino acid mutations relative to the reference sequence (such as a deletion, substitution and/or insertion of an amino acid).
- binding domain B2 comprises:
- binding domain B2 comprises the heavy chain variable region and the light chain variable region of antibody 1208/1135 (SEQ ID NO: 7 and SEQ ID NO: 5), or a variant which has more than 60%, or more than 70%, e.g. 75 or 80%, preferably more than 85%, e.g. more than 90 or 95% amino acid identity to SEQ ID NO: 7 and/or SEQ ID NO: 5).
- binding domain B2 comprises the heavy chain variable region and the light chain variable region of antibody 1210/1211 (SEQ ID NO: 11 and SEQ ID NO: 9), or a variant which has more than 60%, or more than 70%, e.g. 75 or 80%, preferably more than 85%, e.g. more than 90 or 95% amino acid identity to SEQ ID NO: 11 and/or SEQ ID NO: 9).
- binding domain B2 comprises the heavy chain variable region and the light chain variable region of antibody 2992/2993 (SEQ ID NO: 96 and SEQ ID NO: 97), or a variant which has more than 60%, or more than 70%, e.g. 75 or 80%, preferably more than 85%, e.g. more than 90 or 95% amino acid identity to SEQ ID NO: 96 and/or SEQ ID NO: 97.
- binding domain B2 comprises the heavy chain variable region and the light chain variable region of antibody 2994/2995 (SEQ ID NO: 98 and SEQ ID NO: 99), or a variant which has more than 60%, or more than 70%, e.g. 75 or 80%, preferably more than 85%, e.g. more than 90 or 95% amino acid identity to SEQ ID NO: 98 and/or SEQ ID NO: 99.
- binding domain B1 is an IgG and binding domain B2 is an scFv.
- binding domain B1 may be an scFv and binding domain B2 may be an IgG.
- binding domain B1 is an scFv and binding domain B2 is an scFv (e.g. in an scFv 2 -Fc format).
- bispecific polypeptides of the invention In exemplary bispecific polypeptides of the invention:
- B1 comprises the light chain variable region and/or the heavy chain variable region of antibody 1200/1201 (SEQ ID NO: 19 and/or SEQ ID NO: 17) and B2 comprises the light chain variable region and/or the heavy chain variable region of antibody 1210/1211 (SEQ ID NO: 11 and/or SEQ ID NO: 9), or variants of said light chain variable regions and/or said heavy chain variable regions (for example, having at least 90% sequence identity thereto).
- B1 comprises the light chain variable region and/or the heavy chain variable region of antibody 1210/1211 (SEQ ID NO: 11 and/or SEQ ID NO: 9) and B2 comprises the light chain variable region and/or the heavy chain variable region of antibody 1618/1619 (SEQ ID NO: 35 and/or SEQ ID NO: 33), or variants of said light chain variable regions and/or said heavy chain variable regions (for example, having at least 90% sequence identity thereto).
- the bispecific antibody polypeptides of the invention will comprise constant region sequences, in addition to the above-defined variable region sequences.
- An exemplary heavy chain constant region amino acid sequence which may be combined with any VH region sequence disclosed herein (to form a complete heavy chain) is the following IgG1 heavy chain constant region sequence:
- L234A and L235A L234A and L235A (“LALA”) mutations (see amino acid residues highlighted above).
- an exemplary light chain constant region amino acid sequence which may be combined with any VL region sequence disclosed herein (to form a complete light chain) is the kappa chain constant region sequence reproduced here:
- the bispecific antibody of the invention may comprise:
- the bispecific antibody of the invention is an IgG-scFv bispecific antibody (for example, wherein B1 is an intact IgG and B2 is an scFv attached to the C-terminus of a heavy chain of the IgG, or vice versa).
- the bispecific antibody may comprise the following components:
- the antibody polypeptide is or comprises a recombinant polypeptide.
- Suitable methods for the production of such recombinant polypeptides are well known in the art, such as expression in prokaryotic or eukaryotic hosts cells (for example, see Green & Sambrook, 2012, Molecular Cloning, A Laboratory Manual, Fourth Edition, Cold Spring Harbor, New York, the relevant disclosures in which document are hereby incorporated by reference).
- Antibody polypeptides of the invention can also be produced using a commercially available in vitro translation system, such as rabbit reticulocyte lysate or wheatgerm lysate (available from Promega).
- the translation system is rabbit reticulocyte lysate.
- the translation system may be coupled to a transcription system, such as the TNT transcription-translation system (Promega). This system has the advantage of producing suitable mRNA transcript from an encoding DNA polynucleotide in the same reaction as the translation.
- antibody polypeptides of the invention may alternatively be synthesised artificially, for example using well known liquid-phase or solid phase synthesis techniques (such as t-Boc or Fmoc solid-phase peptide synthesis).
- a second aspect of the invention provides an isolated nucleic acid molecule encoding a bispecific polypeptide according to any one of the preceding claims, or a component polypeptide chain thereof.
- the nucleic acid molecule may comprise any of the nucleotide sequences provided in Table A.
- a polynucleotide of the invention may encode any polypeptide as described herein, or all or part of B1 or all or part of B2.
- the terms “nucleic acid molecule” and “polynucleotide” are used interchangeably herein and refer to a polymeric form of nucleotides of any length, either deoxyribonucleotides or ribonucleotides, or analogs thereof.
- Non-limiting examples of polynucleotides include a gene, a gene fragment, messenger RNA (mRNA), cDNA, recombinant polynucleotides, plasmids, vectors, isolated DNA of any sequence, isolated RNA of any sequence, nucleic acid probes, and primers.
- a polynucleotide of the invention may be provided in isolated or substantially isolated form.
- substantially isolated it is meant that there may be substantial, but not total, isolation of the polypeptide from any surrounding medium.
- the polynucleotides may be mixed with carriers or diluents which will not interfere with their intended use and still be regarded as substantially isolated.
- a nucleic acid sequence which “encodes” a selected polypeptide is a nucleic acid molecule which is transcribed (in the case of DNA) and translated (in the case of mRNA) into a polypeptide in vivo when placed under the control of appropriate regulatory sequences.
- the boundaries of the coding sequence are determined by a start codon at the 5′ (amino) terminus and a translation stop codon at the 3′ (carboxy) terminus.
- such nucleic acid sequences can include, but are not limited to, cDNA from viral, prokaryotic or eukaryotic mRNA, genomic sequences from viral or prokaryotic DNA or RNA, and even synthetic DNA sequences.
- a transcription termination sequence may be located 3′ to the coding sequence.
- Representative polynucleotides which encode examples of a heavy chain or light chain amino acid sequence of an antibody may comprise or consist of any one of the nucleotide sequences disclosed herein, for example the sequences set out in Table A.
- a suitable polynucleotide sequence may alternatively be a variant of one of these specific polynucleotide sequences.
- a variant may be a substitution, deletion or addition variant of any of the above nucleic acid sequences.
- a variant polynucleotide may comprise 1, 2, 3, 4, 5, up to 10, up to 20, up to 30, up to 40, up to 50, up to 75 or more nucleic acid substitutions and/or deletions from the sequences given in the sequence listing.
- Suitable variants may be at least 70% homologous to a polynucleotide of any one of nucleic acid sequences disclosed herein, preferably at least 80 or 90% and more preferably at least 95%, 97% or 99% homologous thereto.
- homology and identity at these levels is present at least with respect to the coding regions of the polynucleotides.
- Methods of measuring homology are well known in the art and it will be understood by those of skill in the art that in the present context, homology is calculated on the basis of nucleic acid identity. Such homology may exist over a region of at least 15, preferably at least 30, for instance at least 40, 60, 100, 200 or more contiguous nucleotides. Such homology may exist over the entire length of the unmodified polynucleotide sequence.
- the PILEUP and BLAST algorithms can also be used to calculate homology or line up sequences (typically on their default settings), for example as described in Altschul, 1993, J Mol Evo! 36:290-300; Altschul et al, 1990, J Mol Blot 215:403-10, the disclosures of which are incorporated herein by reference).
- HSPs high scoring sequence pair
- Extensions for the word hits in each direction are halted when: the cumulative alignment score goes to zero or below, due to the accumulation of one or more negative-scoring residue alignments; or the end of either sequence is reached.
- the BLAST algorithm parameters W, T and X determine the sensitivity and speed of the alignment.
- the BLAST algorithm performs a statistical analysis of the similarity between two sequences; see e.g. Karlin & Altschul, 1993, Proc. Natl. Acad. Sci. USA 90:5873-5787; the disclosures of which are incorporated herein by reference.
- One measure of similarity provided by the BLAST algorithm is the smallest sum probability (P(N)), which provides an indication of the probability by which a match between two nucleotide or amino acid sequences would occur by chance.
- P(N) the smallest sum probability
- a sequence is considered similar to another sequence if the smallest sum probability in comparison of the first sequence to the second sequence is less than about 1, preferably less than about 0.1, more preferably less than about 0.01, and most preferably less than about 0.001.
- the homologue may differ from a sequence in the relevant polynucleotide by less than 3, 5, 10, 15, 20 or more mutations (each of which may be a substitution, deletion or insertion). These mutations may be measured over a region of at least 30, for instance at least 40, 60 or 100 or more contiguous nucleotides of the homologue.
- a variant sequence may vary from the specific sequences given in the sequence listing by virtue of the redundancy in the genetic code.
- the DNA code has 4 primary nucleic acid residues (A, T, C and G) and uses these to “spell” three letter codons which represent the amino acids the proteins encoded in an organism's genes.
- the linear sequence of codons along the DNA molecule is translated into the linear sequence of amino acids in the protein(s) encoded by those genes.
- the code is highly degenerate, with 61 codons coding for the 20 natural amino acids and 3 codons representing “stop” signals. Thus, most amino acids are coded for by more than one codon—in fact several are coded for by four or more different codons.
- a variant polynucleotide of the invention may therefore encode the same polypeptide sequence as another polynucleotide of the invention, but may have a different nucleic acid sequence due to the use of different codons to encode the same amino acids.
- a polypeptide of the invention may thus be produced from or delivered in the form of a polynucleotide which encodes, and is capable of expressing, it.
- Polynucleotides of the invention can be synthesised according to methods well known in the art, as described by way of example in Green & Sambrook (2012, Molecular Cloning—a laboratory manual, 4 th edition; Cold Spring Harbor Press; the disclosures of which are incorporated herein by reference).
- the nucleic acid molecules of the present invention may be provided in the form of an expression cassette which includes control sequences operably linked to the inserted sequence, thus allowing for expression of the polypeptide of the invention in vivo.
- These expression cassettes are typically provided within vectors (e.g., plasmids or recombinant viral vectors).
- vectors e.g., plasmids or recombinant viral vectors.
- Such an expression cassette may be administered directly to a host subject.
- a vector comprising a polynucleotide of the invention may be administered to a host subject.
- the polynucleotide is prepared and/or administered using a genetic vector.
- a suitable vector may be any vector which is capable of carrying a sufficient amount of genetic information, and allowing expression of a polypeptide of the invention.
- the present invention thus includes expression vectors that comprise such polynucleotide sequences.
- expression vectors are routinely constructed in the art of molecular biology and may for example involve the use of plasmid DNA and appropriate initiators, promoters, enhancers and other elements, such as for example polyadenylation signals which may be necessary, and which are positioned in the correct orientation, in order to allow for expression of a peptide of the invention.
- Other suitable vectors would be apparent to persons skilled in the art (see Green & Sambrook, supra).
- the invention also includes cells that have been modified to express a polypeptide of the invention.
- Such cells include transient, or preferably stable higher eukaryotic cell lines, such as mammalian cells or insect cells, lower eukaryotic cells, such as yeast or prokaryotic cells such as bacterial cells.
- Particular examples of cells which may be modified by insertion of vectors or expression cassettes encoding for a polypeptide of the invention include mammalian HEK293T, CHO, HeLa, NSO and COS cells.
- the cell line selected will be one which is not only stable, but also allows for mature glycosylation and cell surface expression of a polypeptide.
- Such cell lines of the invention may be cultured using routine methods to produce a polypeptide of the invention, or may be used therapeutically or prophylactically to deliver antibodies of the invention to a subject.
- polynucleotides, expression cassettes or vectors of the invention may be administered to a cell from a subject ex vivo and the cell then returned to the body of the subject.
- the nucleic acid molecule encodes an antibody heavy chain or variable region thereof.
- the nucleic acid molecule encodes an antibody light chain or variable region thereof.
- nucleic acid molecule we include DNA (e.g. genomic DNA or complementary DNA) and mRNA molecules, which may be single- or double-stranded.
- isolated we mean that the nucleic acid molecule is not located or otherwise provided within a cell.
- the nucleic acid molecule is a cDNA molecule.
- nucleic acid molecule may be codon-optimised for expression of the antibody polypeptide in a particular host cell, e.g. for expression in human cells (for example, see Angov, 2011, Biotechnol. J. 6(6):650-659, the disclosures of which are incorporated herein by reference).
- the present invention provides compositions comprising molecules of the invention, such as the antibodies, bispecific polypeptides, polynucleotides, vectors and cells described herein.
- the invention provides a composition comprising one or more molecules of the invention, such as one or more antibodies and/or bispecific polypeptides of the invention, and at least one pharmaceutically acceptable carrier.
- chelating agents such as EDTA, citrate, EGTA or glutathione.
- the pharmaceutical compositions may be prepared in a manner known in the art that is sufficiently storage stable and suitable for administration to humans and animals.
- the pharmaceutical compositions may be lyophilised, e.g. through freeze drying, spray drying, spray cooling, or through use of particle formation from supercritical particle formation.
- pharmaceutically acceptable we mean a non-toxic material that does not decrease the effectiveness of the CD137 and 5T4-binding activity of the antibody polypeptide of the invention.
- Such pharmaceutically acceptable buffers, carriers or excipients are well-known in the art (see Remington's Pharmaceutical Sciences, 18th edition, A. R Gennaro, Ed., Mack Publishing Company (1990) and handbook of Pharmaceutical Excipients, 3rd edition, A. Kibbe, Ed., Pharmaceutical Press (2000), the disclosures of which are incorporated herein by reference).
- buffer is intended to mean an aqueous solution containing an acid-base mixture with the purpose of stabilising pH.
- buffers are Trizma, Bicine, Tricine, MOPS, MOPSO, MOBS, Tris, Hepes, HEPBS, MES, phosphate, carbonate, acetate, citrate, glycolate, lactate, borate, ACES, ADA, tartrate, AMP, AMPD, AMPSO, BES, CABS, cacodylate, CHES, DIPSO, EPPS, ethanolamine, glycine, HEPPSO, imidazole, imidazolelactic acid, PIPES, SSC, SSPE, POPSO, TAPS, TABS, TAPSO and TES.
- diluent is intended to mean an aqueous or non-aqueous solution with the purpose of diluting the antibody polypeptide in the pharmaceutical preparation.
- the diluent may be one or more of saline, water, polyethylene glycol, propylene glycol, ethanol or oils (such as safflower oil, corn oil, peanut oil, cottonseed oil or sesame oil).
- adjuvant is intended to mean any compound added to the formulation to increase the biological effect of the antibody polypeptide of the invention.
- the adjuvant may be one or more of zinc, copper or silver salts with different anions, for example, but not limited to fluoride, chloride, bromide, iodide, tiocyanate, sulfite, hydroxide, phosphate, carbonate, lactate, glycolate, citrate, borate, tartrate, and acetates of different acyl composition.
- the adjuvant may also be cationic polymers such as cationic cellulose ethers, cationic cellulose esters, deacetylated hyaluronic acid, chitosan, cationic dendrimers, cationic synthetic polymers such as poly(vinyl imidazole), and cationic polypeptides such as polyhistidine, polylysine, polyarginine, and peptides containing these amino acids.
- cationic polymers such as cationic cellulose ethers, cationic cellulose esters, deacetylated hyaluronic acid, chitosan, cationic dendrimers, cationic synthetic polymers such as poly(vinyl imidazole), and cationic polypeptides such as polyhistidine, polylysine, polyarginine, and peptides containing these amino acids.
- the excipient may be one or more of carbohydrates, polymers, lipids and minerals.
- carbohydrates include lactose, glucose, sucrose, mannitol, and cyclodextrines, which are added to the composition, e.g. for facilitating lyophilisation.
- polymers are starch, cellulose ethers, cellulose carboxymethylcellulose, hydroxypropylmethyl cellulose, hydroxyethyl cellulose, ethylhydroxyethyl cellulose, alginates, carageenans, hyaluronic acid and derivatives thereof, polyacrylic acid, polysulphonate, polyethylenglycol/polyethylene oxide, polyethyleneoxide/polypropylene oxide copolymers, polyvinylalcohol/polyvinylacetate of different degree of hydrolysis, and polyvinylpyrrolidone, all of different molecular weight, which are added to the composition, e.g., for viscosity control, for achieving bioadhesion, or for protecting the lipid from chemical and proteolytic degradation.
- lipids are fatty acids, phospholipids, mono-, di-, and triglycerides, ceramides, sphingolipids and glycolipids, all of different acyl chain length and saturation, egg lecithin, soy lecithin, hydrogenated egg and soy lecithin, which are added to the composition for reasons similar to those for polymers.
- minerals are talc, magnesium oxide, zinc oxide and titanium oxide, which are added to the composition to obtain benefits such as reduction of liquid accumulation or advantageous pigment properties.
- the antibody polypeptides of the invention may be formulated into any type of pharmaceutical composition known in the art to be suitable for the delivery thereof.
- the pharmaceutical compositions of the invention may be in the form of a liposome, in which the antibody polypeptide is combined, in addition to other pharmaceutically acceptable carriers, with amphipathic agents such as lipids, which exist in aggregated forms as micelles, insoluble monolayers and liquid crystals.
- Suitable lipids for liposomal formulation include, without limitation, monoglycerides, diglycerides, sulfatides, lysolecithin, phospholipids, saponin, bile acids, and the like.
- Suitable lipids also include the lipids above modified by poly(ethylene glycol) in the polar headgroup for prolonging bloodstream circulation time. Preparation of such liposomal formulations is can be found in for example U.S. Pat. No. 4,235,871, the disclosures of which are incorporated herein by reference.
- compositions of the invention may also be in the form of biodegradable microspheres.
- Aliphatic polyesters such as poly(lactic acid) (PLA), poly(glycolic acid) (PGA), copolymers of PLA and PGA (PLGA) or poly(caprolactone) (PCL), and polyanhydrides have been widely used as biodegradable polymers in the production of microspheres. Preparations of such microspheres can be found in U.S. Pat. No. 5,851,451 and in EP 0 213 303, the disclosures of which are incorporated herein by reference.
- compositions of the invention are provided in the form of polymer gels, where polymers such as starch, cellulose ethers, cellulose carboxymethylcellulose, hydroxypropyl methyl cellulose, hydroxyethyl cellulose, ethylhydroxyethyl cellulose, alginates, carageenans, hyaluronic acid and derivatives thereof, polyacrylic acid, polyvinyl imidazole, polysulphonate, polyethylenglycol/polyethylene oxide, polyethyleneoxide/polypropylene oxide copolymers, polyvinylalcohol/polyvinylacetate of different degree of hydrolysis, and polyvinylpyrrolidone are used for thickening of the solution containing the agent.
- the polymers may also comprise gelatin or collagen.
- the antibody polypeptide may simply be dissolved in saline, water, polyethylene glycol, propylene glycol, ethanol or oils (such as safflower oil, corn oil, peanut oil, cottonseed oil or sesame oil), tragacanth gum, and/or various buffers.
- oils such as safflower oil, corn oil, peanut oil, cottonseed oil or sesame oil
- tragacanth gum and/or various buffers.
- compositions of the invention may include ions and a defined pH for potentiation of action of the active antibody polypeptide. Additionally, the compositions may be subjected to conventional pharmaceutical operations such as sterilisation and/or may contain conventional adjuvants such as preservatives, stabilisers, wetting agents, emulsifiers, buffers, fillers, etc.
- compositions according to the invention may be administered via any suitable route known to those skilled in the art.
- routes of administration include parenteral (intravenous, subcutaneous, and intramuscular), topical, ocular, nasal, pulmonar, buccal, oral, parenteral, vaginal and rectal. Also administration from implants is possible.
- the pharmaceutical compositions are administered parenterally, for example, intravenously, intracerebroventricularly, intraarticularly, intra-arterially, intraperitoneally, intrathecally, intraventricularly, intrasternally, intracranially, intramuscularly or subcutaneously, or they may be administered by infusion techniques. They are conveniently used in the form of a sterile aqueous solution which may contain other substances, for example, enough salts or glucose to make the solution isotonic with blood. The aqueous solutions should be suitably buffered (preferably to a pH of from 3 to 9), if necessary. The preparation of suitable parenteral formulations under sterile conditions is readily accomplished by standard pharmaceutical techniques well known to those skilled in the art.
- Formulations suitable for parenteral administration include aqueous and non-aqueous sterile injection solutions which may contain anti-oxidants, buffers, bacteriostats and solutes which render the formulation isotonic with the blood of the intended recipient; and aqueous and non-aqueous sterile suspensions which may include suspending agents and thickening agents.
- the formulations may be presented in unit-dose or multi-dose containers, for example sealed ampoules and vials, and may be stored in a freeze-dried (lyophilised) condition requiring only the addition of the sterile liquid carrier, for example water for injections, immediately prior to use.
- Extemporaneous injection solutions and suspensions may be prepared from sterile powders, granules and tablets of the kind previously described.
- compositions of the invention are particularly suitable for parenteral, e.g. intravenous, administration.
- compositions may be administered intranasally or by inhalation (for example, in the form of an aerosol spray presentation from a pressurised container, pump, spray or nebuliser with the use of a suitable propellant, such as dichlorodifluoromethane, trichlorofluoro-methane, dichlorotetrafluoro-ethane, a hydrofluoroalkane such as 1,1,1,2-tetrafluoroethane (HFA 134A3 or 1,1,1,2,3,3,3-heptafluoropropane (HFA 227EA3), carbon dioxide or other suitable gas).
- a suitable propellant such as dichlorodifluoromethane, trichlorofluoro-methane, dichlorotetrafluoro-ethane, a hydrofluoroalkane such as 1,1,1,2-tetrafluoroethane (HFA 134A3 or 1,1,1,2,3,3,3-heptafluoroprop
- the dosage unit may be determined by providing a valve to deliver a metered amount.
- the pressurised container, pump, spray or nebuliser may contain a solution or suspension of the active polypeptide, e.g. using a mixture of ethanol and the propellant as the solvent, which may additionally contain a lubricant, e.g. sorbitan trioleate.
- a lubricant e.g. sorbitan trioleate.
- Capsules and cartridges (made, for example, from gelatin) for use in an inhaler or insufflator may be formulated to contain a powder mix of a compound of the invention and a suitable powder base such as lactose or starch.
- compositions will be administered to a patient in a pharmaceutically effective dose.
- the amount of a compound may vary depending on its specific activity. Suitable dosage amounts may contain a predetermined quantity of active composition calculated to produce the desired therapeutic effect in association with the required diluent.
- a therapeutically effective amount of the active component is provided.
- a therapeutically effective amount can be determined by the ordinary skilled medical or veterinary worker based on patient characteristics, such as age, weight, sex, condition, complications, other diseases, etc., as is well known in the art.
- the administration of the pharmaceutically effective dose can be carried out both by single administration in the form of an individual dose unit or else several smaller dose units and also by multiple administrations of subdivided doses at specific intervals. Alternatively, the does may be provided as a continuous infusion over a prolonged period.
- compositions are formulated for systemic administration.
- composition may preferably be formulated for sustained release over a period of time.
- the composition may be provided in or as part of a matrix facilitating sustained release.
- Preferred sustained release matrices may comprise a montanide or ⁇ -polyglutamic acid (PGA) nanoparticles.
- the antibody polypeptides can be formulated at various concentrations, depending on the efficacy/toxicity of the polypeptide being used.
- the formulation may comprise the active antibody polypeptide at a concentration of between 0.1 ⁇ M and 1 mM, more preferably between 1 ⁇ M and 500 ⁇ M, between 500 ⁇ M and 1 mM, between 300 ⁇ M and 700 ⁇ M, between 1 ⁇ M and 100 ⁇ M, between 100 ⁇ M and 200 ⁇ M, between 200 ⁇ M and 300 ⁇ M, between 300 ⁇ M and 400 ⁇ M, between 400 ⁇ M and 500 ⁇ M, between 500 ⁇ M and 600 ⁇ M, between 600 ⁇ M and 700 ⁇ M, between 800 ⁇ M and 900 ⁇ M or between 900 ⁇ M and 1 mM.
- the formulation comprises the active antibody polypeptide at a concentration of between 300 ⁇ M and 700 ⁇ M.
- the therapeutic dose of the antibody polypeptide (with or without a therapeutic moiety) in a human patient will be in the range of 100 ⁇ g to 700 mg per administration (based on a body weight of 70 kg).
- the maximum therapeutic dose may be in the range of 0.1 to 10 mg/kg per administration, e.g. between 0.1 and 5 mg/kg or between 1 and 5 mg/kg or between 0.1 and 2 mg/kg. It will be appreciated that such a dose may be administered at different intervals, as determined by the oncologist/physician; for example, a dose may be administered daily, twice-weekly, weekly, bi-weekly or monthly.
- compositions of the invention may be administered alone or in combination with other therapeutic agents used in the treatment of cancers, such as antimetabolites, alkylating agents, anthracyclines and other cytotoxic antibiotics, vinca alkyloids, etoposide, platinum compounds, taxanes, topoisomerase I inhibitors, other cytostatic drugs, antiproliferative immunosuppressants, corticosteroids, sex hormones and hormone antagonists, and other therapeutic antibodies (such as antibodies against a tumour-associated antigen or an immune checkpoint modulator).
- other therapeutic agents used in the treatment of cancers such as antimetabolites, alkylating agents, anthracyclines and other cytotoxic antibiotics, vinca alkyloids, etoposide, platinum compounds, taxanes, topoisomerase I inhibitors, other cytostatic drugs, antiproliferative immunosuppressants, corticosteroids, sex hormones and hormone antagonists, and other therapeutic antibodies (such as antibodies against a tumour-associated antigen or an
- compositions of the invention may be administered in combination with an immunotherapeutic agent that binds a target selected from the group consisting of PD-1/PD-1L, CTLA-4, 0X40, CD40, GITR, LAGS, TIM3, CD27 and KIR.
- an immunotherapeutic agent that binds a target selected from the group consisting of PD-1/PD-1L, CTLA-4, 0X40, CD40, GITR, LAGS, TIM3, CD27 and KIR.
- the invention encompasses combination therapies comprising a bispecific polypeptide of the invention together with a further immunotherapeutic agent, effective in the treatment of cancer, which specifically binds to an immune checkpoint molecule.
- a further immunotherapeutic agent effective in the treatment of cancer, which specifically binds to an immune checkpoint molecule.
- the therapeutic benefit of the further immunotherapeutic agent may be mediated by attenuating the function of an inhibitory immune checkpoint molecule and/or by activating the function of a stimulatory immune checkpoint or co-stimulatory molecule.
- the further immunotherapeutic agent is selected from the group consisting of:
- the further immunotherapeutic agent may be a PD1 inhibitor, such as an anti-PD1 antibody, or antigen-binding fragment thereof capable of inhibiting PD1 function (for example, Nivolumab, Pembrolizumab, Lambrolizumab, PDR-001, MEDI-0680 and AMP-224).
- the PD1 inhibitor may comprise or consist of an anti-PD-L1 antibody, or antigen-binding fragment thereof capable of inhibiting PD1 function (for example, Durvalumab, Atezolizumab, Avelumab and MDX-1105).
- the further immunotherapeutic agent is a CTLA-4 inhibitor, such as an anti-CTLA-4 antibody or antigen-binding portion thereof.
- the further immunotherapeutic agent activates OX40, such as an agonistic anti-OX40 antibody or antigen-binding portion thereof.
- the further immunotherapeutic agent activates CD40, such as an agonistic anti-CD40 antibody or antigen-binding portion thereof.
- synergistic we include that the therapeutic effect of the two agents in combination (e.g. as determined by reference to the rate of growth or the size of the tumour) is greater than the additive therapeutic effect of the two agents administered on their own.
- Such synergism can be identified by testing the active agents, alone and in combination, in a relevant cell line model of the solid tumour.
- kits comprising polypeptides or other compositions of the invention and instructions for use.
- the kit may further contain one or more additional reagents, such as an additional therapeutic or prophylactic agent as discussed above.
- polypeptides in accordance with the present invention may be used in therapy or prophylaxis.
- polypeptides or compositions are administered to a subject already suffering from a disorder or condition, in an amount sufficient to cure, alleviate or partially arrest the condition or one or more of its symptoms.
- Such therapeutic treatment may result in a decrease in severity of disease symptoms, or an increase in frequency or duration of symptom-free periods.
- An amount adequate to accomplish this is defined as “therapeutically effective amount”.
- polypeptides or compositions are administered to a subject not yet exhibiting symptoms of a disorder or condition, in an amount sufficient to prevent or delay the development of symptoms. Such an amount is defined as a “prophylactically effective amount”.
- the subject may have been identified as being at risk of developing the disease or condition by any suitable means.
- a seventh aspect of the invention provides a bispecific polypeptide according to the first aspect of the invention for use in medicine.
- An eighth aspect of the invention provides a bispecific polypeptide according to the first aspect of the invention for use in treating a neoplastic disorder in a subject.
- treatment we include both therapeutic and prophylactic treatment of the patient.
- the term ‘prophylactic’ is used to encompass the use of an agent, or formulation thereof, as described herein which either prevents or reduces the likelihood of a neoplastic disorder, or the spread, dissemination, or metastasis of cancer cells in a patient or subject.
- the term ‘prophylactic’ also encompasses the use of an agent, or formulation thereof, as described herein to prevent recurrence of a neoplastic disorder in a patient who has previously been treated for the neoplastic disorder.
- the neoplastic disorder is associated with the formation of solid tumours within the subject's body.
- the solid tumour may be selected from the group consisting of prostate cancer, breast cancer, lung cancer, colorectal cancer, melanomas, bladder cancer, brain/CNS cancer, cervical cancer, oesophageal cancer, gastric cancer, head/neck cancer, kidney cancer, liver cancer, lymphomas, ovarian cancer, pancreatic cancer and sarcomas.
- the solid tumour may be selected from the groups consisting of renal cell carcinoma, colorectal cancer, lung cancer, prostate cancer and breast cancer.
- a ninth aspect of the invention provides a use of a bispecific polypeptide according to the first aspect of the invention in the preparation of a medicament for treating or preventing a neoplastic disorder in a subject.
- the neoplastic disorder is associated with the formation of solid tumours within the subject's body (for example, as detailed above).
- a tenth aspect of the invention provides a method for the treatment or diagnosis of a neoplastic disorder in a subject, comprising the step of administering to the subject an effective amount of a bispecific polypeptide according to the first aspect of the invention.
- the neoplastic disorder is associated with the formation of solid tumours within the subject's body (for example, as detailed above).
- the subject is human.
- the method comprises administering the bispecific antibody systemically.
- the methods further comprises administering to the subject one or more additional therapeutic agents.
- FIG. 1 shows a schematic representation of the structure of exemplary formats for a bispecific antibody of the invention.
- the constant regions are shown as filled light grey; variable heavy chain regions VH1 are shown as chequered black and white; variable light chain regions VL1 are shown as filled white; variable heavy chain regions VH2 are shown as filled black; and variable light chain regions VL2 are shown as white with diagonal lines.
- CD137 binding domains (binding domain 1) are typically represented as a pair of a chequered black and white domain with a filled white domain (VH1/VL1); tumour-associated antigen binding domains (binding domain 2) are typically represented as a pair of a filled black domain and a white domain with diagonal lines (VH2/VL2).
- binding domains 1 and 2 may be switched. That is, a CD137 binding domain may occur in a position shown in this figure for a tumour-associated antigen domain, and vice versa.
- FIG. 2 shows an example of a dose-response experiment of 5T4 antibodies binding to 5T4-transfected B16 cells, analysed by flow cytometry.
- FIG. 3 shows flow cytometry data showing normalized mean fluorescence intensity (MFI) of 5T4 mAb binding at a concentration of 2.5 ⁇ g/ml to 5T4-transfected B16 cells.
- MFI mean fluorescence intensity
- FIG. 4 shows dose-response analysis of 5T4 antibody binding to cynomolgus 5T4-transfected CHO cells.
- FIG. 5 is an illustration of 5T4 chimeras used for epitope mapping of 5T4 antibodies.
- FIG. 6 shows binding of exemplary anti-CD137 antibodies to human and cynomolgus CD137. Data from two separate experiments are included.
- FIG. 7 shows an overview of human/mouse CD137 chimeras. Black: mouse sequence, white: human sequence.
- FIG. 8 shows stimulation index values normalized to reference 1811/1812.
- FIG. 9 shows the summary of two experiments of CD137 mAb competition with CD137L binding to CHO-huCD137 cells (25 ⁇ g/ml).
- FIG. 10 shows CD137 activation in the presence of crosslinking antibody.
- FIG. 11 shows CD137 activation in the absence of crosslinking antibody.
- FIG. 12 shows dose-response curves in dual ELISA of 5T4-CD137 bispecific antibodies.
- Each graph includes data based on one 5T4 binder (1206 [i.e. 1206/1207], 1208, 1210 or 1212) combined with various CD137 agonistic antibodies (1200 [i.e. 1200/1201], 1202, 1204, 1214, 1618, 1620 or 1626).
- FIG. 13 shows 5T4-dependent T cell activation by exemplary bispecific antibodies (bsAb) of the invention.
- bsAb bispecific antibodies
- FIG. 14 shows the dose-response of 5T4-CD137 bsAbs showing 5T4 dependent T cell activation. Data is analysed as fold change to reference (1200-1210 at 1 ⁇ g/ml). Upper panel: CD137 agonist as IgG and 5T4 binder as scFv fused to C-terminus of IgG. Lower panel: 5T4 binder as IgG and CD137 agonist as scFv fused to C-terminus of IgG. Clone designation follows the same principle as described for FIG. 10 .
- FIG. 15 shows the functional activity of exemplary 5T4-CD137 bispecific antibodies on human CD8+ T cells cultured with 5T4-expressing tumor cells. All generated bsAbs were evaluated at 1 ⁇ g/ml in the fully cell-based T cell assay to verify the results obtained in the assay performed with coated 5T4-Fc. Results are presented as fold change to reference (1200-1210) and the error bars are the SD. Clone designation follows the same principle as described for FIG. 10 .
- FIG. 16 shows binding curves for 5T4 lead optimised clones to (A) CHOh5T4 and (B) CHOcyno5T4 cells.
- FIG. 17 shows binding curves for CD137 lead optimised clones to (A) CHOhCD137 and (B) CHOcynoCD137 cells.
- FIG. 18 shows the normalised interferon gamma (IFN ⁇ ) response in human CD8+ T cells cultured in 5T4-Fc coated plates, represented as a three-parameter sigmoidal dose-response model to enable determination of EC50.
- IFN ⁇ interferon gamma
- FIG. 19 shows results for lead optimised bsAb in a CD8+ T cell assay with crosslinked 5T4-Fc, with normalised IFN ⁇ levels to enable correlation of results between assay plates.
- FIG. 20 shows results for bsAbs generated with different linkers in a CD8+T cell assay with crosslinked 5T4-Fc, with normalised IFN ⁇ levels to enable correlation of results between assay plates.
- FIG. 21 shows the normalised interferon gamma (IFN ⁇ ) response using lead optimised bsAb in human CD8+T cells cultured with 5T4-expressing and 5T4-non-expressing tumour cells, represented as a three-parameter sigmoidal dose-response model to enable determination of EC50
- FIG. 22 shows the interferon gamma (IFN ⁇ ) response from CD137-mediated activation of PBMCs with and without the presence of 5T4-Fc.
- IFN ⁇ interferon gamma
- FIG. 23 shows the interferon gamma (IFN ⁇ ) response from co-culture of CD8+ T cells and CD32-expressing L cells.
- FIG. 24 shows results from a dual ELISA detecting CD137, for TAA-CD137 bispecific antibodies.
- FIG. 25 shows the interferon gamma (IFN ⁇ ) response using TAA-CD137 bispecific antibodies in CD8+ T cells cultured on CD3/TAA-coated plates where the TAA is (A) EpCAM, (B) EGFR and (C) Her2.
- FIG. 26 shows 5T4-dependent localization of bispecific antibody to the antigen-expressing tumors.
- FIG. 27 shows 5T4-dependent localization of bispecific antibody to the antigen-expressing tumors.
- CT26 and CT26-5T4 tumors were collected from SCID-Beige mice treated with vehicle, 1618-1210, 1618 or 2112. Localization of antibody to the tumors was detected (A) with anti-human IgG or (B) by binding of biotinylated CD137, and analyzed by flow cytometry.
- FIG. 28 shows the percentage of tumor cells that are positive for binding of biotinylated CD137 and the tumor antigen 5T4.
- SKOV-3 tumors were collected from SCID-Beige mice treated with vehicle, 1618-1210, 1618 or 2112. Localization of antibody to the 5T4 positive tumour cells was detected with anti-human IgG and anti-human 5T4-antibody.
- VL and VH amino acid (aa) and nucleotide (nt) sequences SEQ ID NO. CHAIN NO. TYPE SEQUENCE 1 1206, heavy aa EVQLLESGGGLVQPGGSLRLSCAASGFTFSGSSMSW chain, VH VRQAPGKGLEWVSSIYYSGSGTYYADSVKGRFTISRD NSKNTLYLQMNSLRAEDTAVYYCARYGRNVHPYNLDY WGQGTLVTVSS 2 1206, heavy nt GAGGTGCAGCTGTTGGAGAGCGGGAGGCTTGGT chain, VH ACAGCCTGGGGGGTCCCTGCGCCTCTCCTGTGCAG CCAGCGGATTCACCTTTTCTGGTTCTTCTATGTCTTG GGTCCGCCAGGCTCCAGGGAAGGGGCTGGAGTGG GTCTCATCTATTTACTACTCTGGTTCTGGTACATACT ATGCAGACTCCGTGAAGGGCCGGTTCACCATCTCCC GTGACAATTCCAAGAACACGCTGTATCT
- IgG1 LALA-sequence (SEQ ID NO: 86) ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGV HTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP KSCDKTHTCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVS HEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGK EYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTC LVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW QQGNVFSCSVMHEALHNHYTQKSLSPGK
- SEQ ID NO: 87 SGGGGSGGGGS (SEQ ID NO: 88) SGGGGSGGGGSAP (SEQ ID NO: 89) NFSQP, (SEQ ID NO: 90) KRTVA (SEQ ID NO: 91) GGGSGGGG (SEQ ID NO: 92) GGGGSGGGGS (SEQ ID NO: 93) GGGGSGGGGSGGGGS
- IgG1 heavy chain constant region sequence (SEQ ID NO: 94) ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGV HTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP KSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVS HEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGK EYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTC LVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW QQGNVFSCSVMHEALHNHYTQKSLSPGK IgG1 light chain constant region sequence: (SEQ ID NO: 95) RTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYP
- Heavy chain [A (underlined); Heavy chain Fc sequence with modification m2; connector m6 (italic); C (bold); linker; D (bold underlined)] [SEQ ID NO: 167] EVQLLESGGGLVQPGGSLRLSCAASGFTFSYGSMYWVRQAPGKGLEWVSS ISSGSGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARSS YYGSYYSIDYWGQGTLVTVSS ASTKGPSVFPLAPSSKSTSGGTAALGCLV KDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQ TYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPE AA GGPSVFLFPPK PKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY NSTYRVVSVLTVLHQDWLNGKEYKCKVSNK
- Phage display selections against h5T4 were performed using the scFv library ALLIGATOR-GOLDTM, a fully human scFv library containing more than 1 ⁇ 10 10 unique members (Alligator Bioscience AB, Lund, Sweden).
- selection strategies including solid phase selection, selection in solution using biotinylated 5T4-Fc, selection with biotinylated 5T4-Fc coupled to streptavidin beads as well as one round of selection against 5T4 expressing B16 cells using a phage stock that previously had been selected against the recombinant h5T4-Fc.
- phage stocks Prior to selection, phage stocks were pre-selected against streptavidin, Beriglobin or SLIT2 in order to remove potential binders to streptavidin, the Fc part of the target and binders cross reactive to other leucine rich repeat proteins.
- the selected 14 5T4 scFv clones were converted to full IgG1 for further characterization.
- a reference anti-5T4 antibody, designated 1628 was used in this study as a positive control.
- ELISA was performed using a standard protocol. Plates (#655074, Greiner Bio-One GmbH, Germany) were pre-coated with 0.5 ⁇ g/ml 5T4-Fc (obtained from Peter L. Stern, University of Manchester) overnight. 5T4 antibodies were diluted from 6 to 1.5 ⁇ 10 ⁇ 3 ⁇ g/ml in 1:4 dilutions and added in duplicates of 50 ⁇ l to each well. Binding was detected with rabbit anti-h kappa L-chain-HRP (P0129, Dako Denmark) and the ELISA was developed with SuperSignal ELISA PICO Chemiluminescent substrate (Thermo Scientific Pierce, Rockford, Ill. USA) for 2-10 minutes and read in an automated microplate based multi-detection reader (FLUOstar OPTIMA, Netherlands).
- the potency of 5T4 antibodies in binding to cynomolgus 5T4 was determined by flow cytometry.
- CHO cells were stably transfected with Macaca mulatta (cynomolgus) 5T4.
- Cells were stained with 5T4 antibodies diluted in FACS buffer (PBS, 0.5% BSA and 0.02% NaN 3 ) using a 1:4 titration starting at 2.5 nM. Binding was detected with the secondary antibody anti-IgG (Fc)-PE (109-115-098, Jackson ImmunoResearch Europe, UK) diluted 1:100. Samples were analysed either on a FACSCalibur or a FACSverse (BD Biosciences, Heidelberg, Germany) and mean fluorescence intensity (MFI) determined.
- FACS buffer PBS, 0.5% BSA and 0.02% NaN 3
- Binding kinetics of the 5T4-specific mAbs have been studied using two different SPR-based platforms, the Biacore 3000 (GE Healthcare) and the MASS-1 platform (Sierra Sensors). Briefly, 5T4 was captured at the sensor chip surface either via direct amine coupling (Biacore platform) or using a streptavidin coated chip and biotinylated 5T4 (MASS-1 platform). The different 5T4-specific mAbs were then injected over the chip in increasing concentrations and the association and dissociation rates studied in real time. A 1:1 Langmuir model was used for curve fitting.
- Epitope mapping was performed by investigation of loss of binding by the antibodies using a panel of human/mouse chimeric 5T4 constructs by flow cytometry. This strategy was possible since none of the 5T4 antibodies cross-react with murine 5T4. Two strategies were used for the epitope mapping as illustrated in FIG. 5 . In one approach, seven human/mouse 5T4 chimeras were constructed based on dividing 5T4 into seven different domains ( FIG. 5 ). By replacing each domain with the corresponding mouse sequence seven human/mouse 7 5T4 human/mouse chimeras were generated.
- the chimeras were generated using the human protein 5T4 sequence NP_006661.1 (reference mRNA sequence NM_006670.4) and the corresponding mouse sequence NP_035757.2 (reference mRNA sequence NM_011627.4).
- Stably transfected CHO cells were generated and 5T4 expressing cells enriched by MACS sorting, resulting in 60-80% positive cells.
- binding levels were normalized within each chimera by dividing % positive cells for each clone with % positive cells for the clones resulting in the highest % positive cells (% pos cells cloneX /% positive cells max ).
- a normalized value ⁇ 0.75 was defined as mAb binding being dependent on the replaced region, whereas a normalized value ⁇ 0.25 was defined as complete dependence.
- the four 5T4 antibodies were shown to be more or less dependent on at least one of domains E2, E3, E4, E6 or aa 173-420, whereas no clear dependence on E1, E5 or E7 was observed (Table 7).
- the reference antibody 1628 differed from all the exemplary antibodies of the invention, and was completely dependent on E4 and aa173-420.
- Phage display selections were performed using a human antibody (scFv) library, Alligator GOLD® (Alligator Bioscience, Lund, Sweden). Selections towards recombinant CD137 in soluble form, coated onto the surface of beads or tubes, or expressed on the surface of CD137-transfected cells were performed. CTLA4-Fc and an irrelevant His-tagged protein were used as non-targets included in excess in the selections. Prior to each selection round, the phage stocks were pre-selected towards biotinylated beriglobin, CTLA4-Fc, beads or CD137 negative cells to remove unspecific binders.
- CD137 antibodies Binding of CD137 antibodies to recombinant human CD137 was determined by sandwich ELISA. Briefly, ELISA plates (Greiner #655074) coated with recombinant human CD137-Fc (R&D #838-4B) were incubated with serial dilutions of the various CD137 antibodies to be investigated. CD137 antibodies were detected using HRP-conjugated goat-anti-human kappa light chain (AbD Serotec #STAR127P) and developed with SuperSignal ELISA Pico Chemiluminescent substrate (Pierce #37069). EC50 values of the various antibodies were determined in 2-6 separate experiments.
- Binding and EC50 was determined using flow cytometric analysis of CHO cells transfected with human CD137, cynomolgus CD137 or empty vector.
- the extracellular part of human or cynomolgus CD137 was fused to the transmembrane and intracellular part of human CD40 and cloned into pcDNA3.1.
- the vector was subsequently stably transfected into CHO cells.
- Expression of CD137 was confirmed by flow cytometry using CD137 antibody (human CD137-PE, BD Biosciences #555956) for 30 min at 4° C.
- CD137-transfected and empty vector-transfected cells were incubated with CD137 antibodies for at least 1h at 4° C. to saturate the binding.
- MFI data was normalized for each antibody, where 0% is defined as the lowest value and 100% is the highest value in the dose titration for each antibody.
- EC50 and 95% confidence interval were calculated with Graph Pad Prism based on data from the two experiments (non-linear regression (curve fit), constraints set to 0 and 100).
- the EC50 determination is presented as 95% confidence intervals for each CD137 antibody tested in order to include the inter and intra assay variations (Table 9).
- Human CD137 (R&D systems) was immobilized to the BiacoreTM sensor chip, CMS, using conventional amine coupling.
- the tested antibody and control (serially diluted 1/2 10-0.63 nM) were analyzed for binding in HBS-P (GE, #BR-1003-68) at a flow rate of 30 ⁇ l/ml.
- the association was followed for 5 minutes and the dissociation for 15 minutes.
- Regeneration was performed twice using 10 mM Glycine pH 1.7 for 30 seconds.
- the kinetic parameters and the affinity constants were calculated using 1:1 Langmuir model.
- the affinities of the antibodies were in the nanomolar to sub-nanomolar range (Table 10) measured using bivalent antibodies flowed over CD137 coated on the chip surface.
- Binding to TNFR superfamily members for which ELISA methods had already been established (CD40 and OX40) was evaluated to detect potential propensity to cross react to non-target proteins.
- a BLAST search was performed identifying TNFRSF21 as the most similar sequence (34% sequence identity). Since this sequence similarity is rather low, determination of non-target binding to OX40 and CD40 was considered sufficient.
- ELISA plates (Greiner #655074) were coated with 50 ⁇ l/well of recombinant human OX40 (R&D #1493-CD), CD40-Fc (Ancell #504-820) or CD137 (R&D #838-4B) diluted to a final concentration of 0.5 ⁇ g/ml in PBS for 1h at 37° C. or overnight at 4° C. Plates were washed with PBS+0.05% TWEEN20 (PBST), followed by block with PBST+1% bovine serum albumin (BSA).
- PBST PBS+0.05% TWEEN20
- BSA bovine serum albumin
- Antibody samples were prepared as serial 1/10 dilutions from 10-0.01 ⁇ g/ml in PBST+1% BSA and incubated for 1 h in room temperature, followed by detection using a horse radish peroxidase-conjugated anti-human kappa light chain antibody (AbD Serotec #STAR127P) and developed using SuperSignal ELISA Pico Chemiluminescent substrate (Pierce ThermoScientific #37069).
- the chimeras were designed by exchanging domains or modules of the human CD137 with the corresponding mouse domain ( FIG. 7 ).
- Genes of CD137 human/mouse chimeras were synthesized (GenScript) and constructs cloned into pcDNA3.1 vector (Invitrogen) and transiently transfected into FreeStyle 293-F cells (Invitrogen).
- the transfected cells were incubated with CD137 antibodies and control antibodies, followed by incubation with anti-human IgG-PE (Jackson Immunoresearch) for detection and analyzed with FACS Verse (BD Biosciences). Binding to the different chimeric constructs was calculated as relative MFI compared to the binding of the isotype control, followed by normalization to the full-length human CD137 construct to minimize the effect of affinity differences between individual antibodies.
- Antibodies 1811/1812 (Reference antibody) and 1618/1619 are dependent on domain 1.
- Antibodies 1200/1201, 1202/1203 and 1204/1205 are mainly dependent on domain 2. In addition, some loss of binding is also seen for construct 1555, indicating an impact of domain 1 as well.
- Antibodies 1813/1814 (Reference antibody) and 1620/1621 appear to be mainly dependent on domains 3B-4A. However, loss of binding is seen for all constructs, making this pattern quite similar to pattern D.
- CD137 antibodies were evaluated in a T cell assay based on primary human CD8 + T cells. Briefly, CD8 + T cells were separated from human peripheral blood mononuclear cells by MACS separation (Miltenyi #130-096-495) according to the manufacturer's protocol. Cells were incubated in 96-well microtiter plates (NuncThermo Scientific #268200), pre-coated with anti-CD3 antibody (clone OKT3, Affymetrix eBioscience #16-0037) and titrated concentrations of the CD137 antibody to be tested. Following 72 or 96 hour incubation, culture medium was harvested and IFN- ⁇ levels were determined by ELISA (BD #555142).
- Each clone was analyzed in at least 6 donors and compared to the reference CD137 antibody 1811/1812 and the negative control antibody.
- the stimulation index (SI, fold induction by antibody compared to negative control) was determined for each sample and normalized to the stimulation index for the reference antibody 1811/1812.
- FIG. 8 Data are summarized in FIG. 8 , which indicates the absolute IFN- ⁇ levels induced by CD137 stimulation.
- all antibodies were not analyzed head-to-head in all donors, and the normalized SI is more relevant for comparison of the efficacy.
- the antibodies were evaluated in an IgG1 format, and the efficacy was measured using antibodies coated to the surface of the wells, which may influence the efficacy.
- the aim was to determine if the exemplary CD137 antibodies block the CD137 ligand binding.
- CD137 antibodies were divided in different groups based on their binding to similar subdomains of the CD137 antigen. If the CD137 antibodies bind to epitopes close to the ligand binding region, binding to the antigen can lead to partial or total blockade of ligand binding. Binding close to the CD137 ligand binding epitope may also affect the ligand binding due to steric hindrance or conformational changes of the CD137 ligand binding epitope. All CD137 antibodies were titrated against a fixed concentration of CD137L for evaluation of ligand blocking properties.
- CHO-cells transfected with human CD137 were used for the ligand competition.
- the extracellular part of human CD137 was fused to the transmembrane and intracellular part of hCD40 and cloned into pcDNA3.1.
- the vector was subsequently stably transfected into CHO cells.
- the expression of CD137 was confirmed by staining with commercial antibody targeting CD137.
- the CHO-huCD137 were pre-incubated with CD137 monoclonal antibodies, titrating down from 10:1 down to 0.01:1 molar ratio CD137 mAb (250 ⁇ g/ml) to CD137L (hCD137_CD8 Ligand) (Ancell #503-020), for 1 h at +4C before the addition of CD137 ligand at a concentration at EC50. After co-incubation for another 30 min at +4C, cells were washed and bound CD137 ligand was detected with ⁇ CD8a-PE (clone 53-6.7) (BD #553033) and fixed with paraformaldehyde (10 ⁇ concentrate BD CellFIX, BD biosciences). Analysis was performed with FACSverse and the MFI (Median Fluorescence Intensity) was calculated with FlowJo software
- CD137L blocking experiment was performed in duplicate. It can be concluded that not all CD137 mAbs tested were blocking the CD137 ligand binding (Table 13, FIG. 9 ). CD137 mAbs belonging to group B and C (1204 and 1620), binding to domain 2B-4A, were blocking the CD137L. Antibody 1814 also blocks the CD137L binding. 1618, belonging to group A which bound to domain 1, did not block CD137 ligand.
- the competition ELISA is performed by co-incubating biotinylated CD137 antibodies with non-biotinylated CD137 antibodies when binding to coated CD137-Fc. Competition is defined as loss of signal from the biotinylated CD137 antibody. Low competition values could either be due to no competition between the antibodies or binding kinetics of the antibodies. Binding of one antibody could also lead to steric hindrance or conformational changes when binding the antigen which affects the binding of the other CD137 antibody.
- CD137 antibodies were biotinylated (EZ-link NHS-LC-Biotin, ThermoFisher) and intact binding properties to CD137-Fc were verified with ELISA by comparing EC50 between biotinylated and non-biotinylated anti-CD137 mAbs.
- Non-biotinylated anti-CD137 (anti-CD137-bio) was pre-incubated with CD137-Fc at concentrations 30 times higher than the determined EC50 for 0.5 h. Without washing, anti-CD137-bio was added and co-incubated for another 1 h.
- the binding of anti-CD137-bio was detected with Streptavidin-HRP (Pierce). Competition was calculated as the relative number by dividing the binding measured to other antibodies relative to its maximum competition (competing with itself). The relative values obtained were normalized against the maximum blocking capacity (Table 4).
- CD137 antibodies The crosslinking dependency of CD137 antibodies was evaluated in a T cell assay based on primary human CD8 + T cells. Briefly, cells were incubated in 96-well microtiter plates (NuncThermo Scientific #268200) pre-coated with anti-CD3 antibody (clone OKT3, Affymetrix eBioscience #16-0037). Titrated concentrations of CD137 antibodies in the presence and absence of crosslinking antibody, goat-anti human Fc F(ab′)2 (Jackson Immuno #109-006-098) at 1:3 molar ratio were added to the plated. Following 72, culture medium was harvested and IFN- ⁇ levels were determined by ELISA (BD #555142).
- 5T4-CD137 bsAb based on four 5T4 and eight CD137 antibodies were cloned as bsAb with one of the binding moieties cloned as a scFv and fused to the C-terminus of heavy chain of the IgG (i.e. in the Morrison format).
- the majority of the bsAb were clones with the 5T4 binder as scFv and the CD137 agonist as IgG, but in some constructs, a CD137 scFv was fused to the heavy chain of a 5T4 IgG (Table 15).
- isotype control constructs where either the 5T4 or the CD137 binder had been replaced with an isotype control antibody were included.
- bsAb were produced by transient transfection of Freestyle293 cells (Thermo Fischer) and purified by Protein A chromatography.
- the designation “1200-1206” refers to the 5T4 binder 1206 (i.e. comprising the variable domain heavy and light chain sequences of antibody 1206/1207) in scFv format fused to the C-terminus of the Fc of the CD137 agonist antibody 1200 (i.e. comprising the variable domain heavy and light chain sequences of antibody 1200/1201).
- CD137 and 5T4 Bispecific binding to both targets, CD137 and 5T4, was evaluated using a standard ELISA protocol. Plates (#655074, Greiner Bio-One GmbH, Germany) were pre-coated with 0.5 ⁇ g/ml 5T4-Fc (obtained from Professor Peter Stern, University of Manchester) overnight. CD137-5T4 bsAb were diluted from 8 to 2 ⁇ 10 ⁇ 3 ⁇ g/ml in 1:4 dilutions and added in duplicates of 50 ⁇ l to each well. CD137-bio (Ancell #502-030) was used as detection antibody at 0.5 ⁇ g/ml and the binding was detected with Streptavidin-HRP (Pierce #21126).
- the ELISA was developed with SuperSignal ELISA PICO Chemiluminescent substrate (Thermo Scientific Pierce, Rockford, Ill. USA) during 2-10 minutes and read in an automated microplate based multi-detection reader (FLUOstar OPTIMA, Netherlands).
- CD137-5T4 bsAbs Binding kinetics of a selection of the CD137-5T4 bsAbs was evaluated using the SPR-based MASS-1 platform (Sierra Sensors). Briefly, CD137 or 5T4 was captured at the sensor chip surface using a streptavidin coated chip and biotinylated antigen. The different CD137-5T4 bsAbs were then injected over the chip in increasing concentrations and the association and dissociation rates studied in real time.
- 5T4-CD137 bsAb The functional activity of 5T4-CD137 bsAb was evaluated in a CD8 T cell assay, where cells were cultured in microtiter plates coated with 5T4-Fc and CD3 antibody.
- Peripheral blood mononuclear cells MNC
- p 1.077 g/m1 GE Healthcare #17-1440-02
- CD8 + T cells were enriched by negative selection using the CD8 + T cell isolation kit (Miltenyi 130-096-495). Plates were coated overnight at 4° C.
- CD137-5T4 bsAbs were diluted in RPM! containing 10% FCS and 10 mM Hepes and added to the plates 30 minutes before addition of CD8 + T cells (0.07 ⁇ 10 6 cells/well). Assay plates were incubated for either 68 or 92 h at 37° C. and culture supernatant harvested. IFN- ⁇ levels in the supernatants were measured by ELISA (BD OptiEIA #555142). Results are shown as fold change compared to CE_1200-1210, which was used as an internal control in all experiments.
- Results from the first set of bsAbs used at a fixed concentration of 1 ⁇ g/ml show that the majority of the bsAbs based on either of the 5T4 binders 1206, 1208 or 1210 were functional in the T cell assay, whereas those that were based on the 5T4 antibody 1212 were not.
- the agonistic effect of the 5T4-CD137 bsAb was dependent on cross-linking by 5T4, since no activation was obtained in the absence of 5T4 or using bsAb comprising one isotype control moiety.
- CD8 T cells were isolated as described above, and cultured in the presence of 5T4-expressing cells B16 cells.
- B16 cells transfected with empty vector were used as negative control.
- CD3 stimulation was performed with ⁇ CD3 (OKT-3) coated beads (Dynal M-450 Tosylactivated #14013) according to the manufactures protocol.
- Irradiated B16 tumor cells (6000 cells/well) were added to the 96 well plates and let to attached for 2 h.
- CD137-5T4 bsAbs were added and incubated for 30 minutes prior to addition of CD8 + T cells (0.1 ⁇ 10 6 cells/well) and ⁇ CD3 coated beads (0.5 ⁇ 10 5 beads/well). Plates were cultured for 68 or 92 h and IFN- ⁇ levels in the media measured by ELISA (BD OptiEIA #555142).
- Results from the fully cell-based assay show that the majority of the bsAb are functional and that the effect is 5T4-specific, with no activation induced by 5T4 negative B 16 cells or isotype-CD137 bsAb ( FIG. 15 ).
- the aim of the optimization was to generate versions of the 5T4-specific 1210/1211 antibody in regards to affinity and biophysical properties. Selections were performed towards 5T4 with lead optimized library 1210LOlib1. In total, 170 unique clones were identified in the initial primary screening with good target signal as well as target/non-target ratio. These clones were further investigated in an extended primary screening with regards to temperature stability. The temperature stability evaluation showed that the majority of the identified unique clones displayed a better stability compared to the wild type 1210/1211 scFv clone. The top 96 clones were further evaluated in a dose-response ELISA and they all showed a similar and acceptable binding behaviour. Sequence analysis from the test-screening and primary screening showed similar trends.
- the top 96 identified clones from the primary and the extended primary screening were further re-cloned as the scFv-part in the Morrison-format, with 1618/1619 as the monoclonal antibody (mAb) part, and were evaluated based on binding, affinity and stability.
- the data are summarised in Table 18.
- the affinity evaluation showed that the affinity (KD) had been improved between 3 to more than 10 times compared to the wild type 1618-1210 clone.
- the EC50 evaluation on cells also showed similar behaviour of the different optimized variants and all showed an improved performance compared to the wild type 1618-1210 clone.
- the top performing clones show less than 10% aggregation after protein A purification and have a Tm higher than the Tm of the Fc (>70° C.) as measured by HPLC and DSF respectively.
- the aim of the optimization was to generate versions of the CD137-specific 1618/1619 antibody in regards to affinity and biophysical properties. Selections were performed towards CD137 with lead optimized library 1618LOlib1. In total, 153 unique clones were identified in the initial primary screening with good target signal as well as target/non-target ratio. These clones were further investigated in an extended primary screening with regards to temperature stability. The temperature stability evaluation allowed for identification of the best performing unique clones in regards to temperature stability compared to the wild type 1618/1619 scFv clone. The top 50 clones were further evaluated in a dose-response ELISA and they all showed a similar and acceptable binding behaviour. Sequence analysis from the test-screening and primary screening showed similar trends.
- the top 50 identified clones from the primary and the extended primary screening were further re-cloned as the scFv-part in the Morrison-format, with 1210/1211 as the monoclonal antibody (mAb) part, and were evaluated based on binding, affinity and stability.
- Kinetic measurements were performed using the Octet RED96 platform equipped with Anti-human Fab-CH1 2 nd generation sensor tips (ForteBio).
- Bispecific antibodies were diluted to 1.5 ⁇ g/ml in 1 ⁇ kinetic buffer (ForteBio) and coupled to the biosensors.
- Human CD137-Fc (R&D Systems, #838-4B) was diluted in 1 ⁇ Kinetics Buffer to 50 nM, 10 nM and 2 nM.
- Binding kinetics were studied in 1 ⁇ Kinetics buffer where association was allowed for 300 sec followed by dissociation for 600 sec. Sensor tips were regenerated using 10 mM glycine, pH 2.2. Data generated were referenced by subtracting a parallel buffer blank, the baseline was aligned with the y-axis, inter-step correlation by alignment against dissociation was performed and the data were smoothed by a Savitzky-Golay filter in the data analysis software (v.9.0.0.14). The processed data were fitted using a 1:1 Langmuir binding model with X 2 as a measurement of fitting accuracy.
- Optimized bispecific antibodies with improved biophysical properties were obtained using different strategies including combining lead optimized binding domains and the use of additional mutations and connectors.
- the bispecific antibody in this example is an IgG-scFv bispecific antibody.
- the CD137 binding domain is an intact IgG and the 5T4 binding domain is an scFv attached to the C-terminus of a heavy chain of the IgG.
- the bispecific antibodies comprise for example the following components: (1) Two heavy chains each comprising, in order from the N-terminus to the C terminus: [a VH sequence; A in Table 20]-[an H chain constant region of IgG1 subtype with no mutations unless stated by an mX suffix in Table 20]-[an m6, m15, m16 or m17 connector ]-[a scFv, wherein the variable chains (heavy or light) are ordered from the N-terminus to the C terminus so that chain C in Table 20 is followed by a linker and then followed by Chain D in Table 20]; and (2) Two light chains each comprising, in order from the N-terminus to the C terminus: [a VL sequence; B in Table 20]-[an L chain constant region].
- the scFv for some of the bispecific antibodies in this example carry recombinant N-glycosylation sites placed either in the
- Optimized bispecific antibody encoding genes were designed in house and synthesized at GeneArt (Thermo Fisher, Life Technologies) or generated by standard cloning methods into expression vectors. Bispecific antibodies were produced by transient transfection of Expi293TM (Thermo Fischer Scientific) and purified by Protein A chromatography. Bispecific binding to both targets, CD137 and 5T4, was evaluated using a standard ELISA protocol. Plates (#655074, Greiner Bio-One GmbH, Germany) were pre-coated with 0.5 ⁇ g/ml 5T4-Fc (obtained from Professor Peter Stern, University of Manchester) overnight.
- CD137-5T4 bsAb were diluted from 8 to 2 ⁇ 10 ⁇ 3 ⁇ g/ml in 1:4 dilutions and added in duplicates of 50 ⁇ l to each well.
- CD137-bio (Ancell #502-030) was used as detection antibody at 0.5 ⁇ g/ml and the binding was detected with Streptavidin-HRP (Pierce #21126).
- the ELISA was developed with SuperSignal ELISA PICO Chemiluminescent substrate (Thermo Scientific Pierce, Rockford, Ill. USA) during 2-10 minutes and read in an automated microplate based multi-detection reader (FLUOstar OPTIMA, Netherlands).
- the optimized bispecific antibodies consisting of lead optimized CD137 binding domains and/or lead optimized 5T4 binding domains and/or stabilised bispecific antibodies using novel connectors and/or additional stabilising strategies including reversed heavy and light chain order or N-glycosylation sites, display dual binding for both targets, CD137 and 5T4.
- Binding domains with improved binding such as for example 1210L01 and 1210L02 provide improved dual binding as observed as lower EC50 values compared to bispecific antibodies comprising non-optimized 1210 binding domains.
- ELISA was performed using a standard protocol. Plates (#655074, Greiner Bio-One GmbH, Germany) were pre-coated with 0.5 ⁇ g/ml 5T4-Fc (produced in-house) overnight. 5T4 antibodies were diluted in PBST+1% BSA and 50 ⁇ l was added to each well. Binding was detected with anti-human kappa light chain antibody (AbD Serotec #STAR127P) and the ELISA was developed with SuperSignal ELISA PICO Chemiluminescent substrate (Thermo Scientific Pierce, Rockford, Ill. USA) for 2-10 minutes and read in an automated microplate based multi-detection reader (FLUOstar OPTIMA, Netherlands).
- Binding curves for CHOh5T4 and CHOcyno5T4 cells can be seen in FIG. 16 (A and B). All the lead optimized variants have similar binding potency towards both human and cyno 5T4 expressing cells as well as towards human 5T4 measured with ELISA compared to the original antibody. The lead optimized variants have an improved affinity for both human and cyno 5T4 as measured with both ELISA and FACS.
- CD137 mAb binding with flow cytometry was performed using human and cyno CD137-transfected CHO-K cell lines and as negative control, mock transfected cells.
- Cells were stained with CD137 lead optimised clones (as scFv in bsAb format) diluted in FACS buffer (PBS, 0.5% BSA and 0.02% NaN 3 ). Binding was detected with the secondary antibody anti-IgG (Fc)-PE (109-115-098, Jackson ImmunoResearch Europe, UK) diluted 1:100. Samples were run on a FACSverse (BD Biosciences, Heidelberg, Germany) and mean fluorescence intensity (MFI) was determined using the FlowJo software.
- Fc secondary antibody anti-IgG
- ELISA plates (Greiner #655074) were coated with 50 ⁇ l/well of recombinant CD137 (R&D #838-4B) diluted to a final concentration of 0.5 ⁇ g/ml in PBS for 1 h at 37° C. or overnight at 4° C. Plates were washed with PBS+0.05% TWEEN20 (PBST), followed by block with PBST+1% bovine serum albumin (BSA).
- PBST PBS+0.05% TWEEN20
- BSA bovine serum albumin
- Antibody samples were diluted in PBST+1% BSA and incubated for 1 h in room temperature, followed by detection using a horse radish peroxidase-conjugated anti-human kappa light chain antibody (AbD Serotec #STAR127P) and developed using SuperSignal ELISA Pico Chemiluminescent substrate (Pierce ThermoScientific #37069).
- Binding curves of the bispecific antibodies to CHOhCD137 and CHOcynoCD137 cells can be seen in FIG. 17 (A and B).
- the EC50 values are comparable to the wild type 1210-1618 (1618 as scFv) clone for both human and cyno CD137.
- the functional activity of the 5T4-CD137 bsAb was evaluated in a CD8+ T cell assay, where cells were cultured in microtiter plates coated with 5T4-Fc and CD3 antibody.
- Peripheral blood mononuclear cells (MNC) were isolated by density gradient centrifugation using Ficoll-Paque (p 1.077g/ml) (GE Healthcare #17-1440-02) from leucocyte concentrates obtained from healthy donors (Clinical Immunology and Transfusion Medicine, Labmedicin Region Sk ⁇ ne, Lund Sweden).
- CD8+T cells were enriched by negative selection using the CD8+T cell isolation kit (Miltenyi 130-096-495). Plates were coated overnight at 4° C.
- 1618-1210 bsAb was diluted in RPMI containing 10% FCS and 10 mM Hepes and added to the plates 30 minutes before addition of CD8+ T cells (0.07 ⁇ 10 6 cells/well). Assay plates were incubated for 68 h at 37° C., and culture supernatant harvested. IFN- ⁇ levels in the supernatants were measured by ELISA (BD OptiEIA #555142).
- the potency of the 1618-1210 bsAb was determined to EC50 0.6-0.9 nM using human CD8+ T cells cultured in 5T4-Fc coated plates and was based on two experiments and a total of six donors. The data were normalised and the EC50 was determined using a three-parameter sigmoidal dose-response model ( FIG. 18 ).
- Bispecific antibodies variants with optimized variable domains of 1618-1619 and 1210-1211 were generated as outlined in Table D, Table E, Table 18, Table 19 and Table 20.
- the generated bsAbs variants with optimized variable sequences were functional in the CD8+ T cell assay with crosslinked 5T4-Fc as seen in FIG. 19 .
- the calculated IFN ⁇ levels were normalised to a plate reference.
- Bispecific antibodies were also generated with different linkers as outlined in the Table D, Table E and Table 20, and were evaluated in the CD8 T cell assay. As shown in FIG. 20 the generated bsAbs could induce a CD137 activation only in the presence of the tumour antigen. As in previous FIG. 19 , the obtained IFN ⁇ values were normalised to a positive control in the plate.
- CD8+ T cells were isolated as described above, and cultured in the presence of tumour associated antigen (TAA) 5T4-expressing cells B16 cells.
- TAA tumour associated antigen
- B16 cells transfected with empty vector were used as negative control.
- CD3 stimulation was performed with ⁇ CD3 (OKT3) coated beads (Dynal M-450 Tosylactivated #14013) according to the manufacturer's protocol.
- Irradiated B16 tumour cells (6000 cells/well) were added to the 96 well plates and left to attach for 2 hours.
- CD137-5T4 bsAbs were added and incubated for 30 minutes prior to addition of CD8+T cells (0.1 ⁇ 10 6 cells/well) and ⁇ CD3 coated beads (0.5 ⁇ 10 5 beads/well). Plates were cultured for 68 hours and IFN- ⁇ levels in the media were measured by ELISA (BD OptiEIA #555142).
- the bispecific antibody 1618-1210 induced IFN ⁇ production in CD8+ T cells in a dose dependent manner when cultured on cells expressing 5T4 (TAA), but not when cultured on cells that do not express 5T4.
- TAA 5T4
- the results further confirm that CD137-TAA antibodies stimulate T cells only in the presence of tumour antigens.
- the potency of 1618-1210 bsAb was determined to EC50 0.2-0.7 nM in the CD8+ T cell assay performed with B16-5T4 expressing tumour cells.
- the EC50 was based on the normalised data from two donors and determined by using a three-parameter sigmoidal dose-response model ( FIG. 21 ).
- 5T4-CD137 bsAb The functional activity of 5T4-CD137 bsAb was evaluated in a PBMC assay, where cells were cultured in microtiter plates coated with 5T4-Fc antibody.
- Peripheral blood mononuclear cells PBMC
- PBMC Peripheral blood mononuclear cells
- CD8+ T cells were enriched by negative selection using the CD8+ T cell isolation kit (Miltenyi 130-096-495). Plates were coated with 5 ⁇ g/ml 5T4-Fc for 2 h at 37° C.
- 1618-1210 bsAb were diluted in RPMI containing 10% FCS and 10 mM Hepes and added to the plates 30 minutes before addition of CD8+ T cells (0.1 ⁇ 10 6 cells/well).
- CD3 stimulation was performed with 1 ⁇ g/ml soluble ⁇ CD3.
- Assay plates were incubated for 68 hours at 37° C., and culture supernatant harvested. IFN- ⁇ levels in the supernatants were measured by ELISA (BD OptiEIA #555142).
- CD8 T cells were isolated as described above, and cultured in the presence of CD32-expressing L cells.
- CD3 stimulation was performed with ⁇ CD3 (OKT3) coated beads (Dynal M-450 Tosylactivated #14013) according to the manufacturer's protocol.
- CD32 L cells (10000 cells/well) were added to the 96 well plates and left to attach for 2 hours.
- CD137 (1618) mAb with and without the LALA mutation was added and incubated for 30 minutes prior to addition of CD8+ T cells (0.1 ⁇ 10 6 cells/well) and ⁇ CD3 coated beads (0.5 ⁇ 10 5 beads/well). Plates were cultured for 68 hours and IFN- ⁇ levels in the media were measured by ELISA (BD OptiEIA #555142).
- results from the co-culture assay of CD32-expressing cells with CD8+ T cells demonstrate that CD137 activation is only induced by 1618 containing the wt IgG1 and not by the Fc silenced 1618 IgG1 containing the LALA mutation, further supporting the conclusion that activation of T cells via CD137 with antibodies such as 1618/1619 requires cross linking.
- Bispecific antibodies against three tumor associated antigens TAA, EpCAM, HER2 and EGFR were generated.
- a scFv (1204/1205) binding to CD137 was fused to the C-terminal end of three different IgG antibodies with the sequences corresponding to the binding domains of Edrecolomab, Cetuximab and Herceptin.
- bsAbs were produced by transient transfection of Expi293TM (Thermo Fischer Scientific) and purified by Protein A chromatography.
- TAA-bsAb Bispecific binding to both targets, CD137 and TAA, was evaluated using a standard ELISA protocol. Plates (#655074, Greiner Bio-One GmbH, Germany) were pre-coated with 0.5 ⁇ g/ml TAA (hEGFR-His, SinoBiological#10001-H08H, hEpCAM-Fc, SinoBiological #10694-H02H, HER2-His, SinoBiological #10004-H08H and 5T4-Fc) overnight. TAA-bsAb were diluted from 20 ⁇ g/ml in 1:4 dilutions and added in duplicates of 50 ⁇ l to each well.
- CD137-bio (Ancell #502-030) was used as detection antibody at 0.5 ⁇ g/ml and the binding was detected with Streptavidin-HRP (Pierce #21126).
- the ELISA was developed with SuperSignal ELISA PICO Chemiluminescent substrate (Thermo Scientific Pierce, Rockford, Ill. USA) during 2-10 minutes and read in an automated microplate based multi-detection reader (FLUOstar OPTIMA, Netherlands).
- PBMCs Peripheral blood mononuclear cells
- CD8+ T cells were enriched by negative selection using the CD8+ T cell isolation kit (Miltenyi 130-096-495). Plates were coated overnight at 4° C. with 3 ⁇ g/ml ⁇ CD3, clone OKT3 (Affymetrix eBioscience #16-0037-85), washed and coated with 5 ⁇ g/ml TAA for 2 h at 37° C. After the TAA coating, plates were washed and blocked for a minimum of 30 minutes with RPMI (Gibco #61870010) containing 10% FCS (Heat inactivated, Gibco #10270-106 lot 41Q9248K) and 10 mM Hepes (Gibco #15630056).
- RPMI Gibco #6187001010
- FCS Heat inactivated, Gibco #10270-106 lot 41Q9248K
- TAA-CD137 bsAbs were diluted in RPMI containing 10% FCS and 10 mM Hepes and added to the plates 30 minutes before addition of CD8+ T cells (0.07 ⁇ 10 6 cells/well). Assay plates were incubated for 68 hours at 37° C., and culture supernatant harvested. IFN- ⁇ levels in the supernatants were measured by ELISA (BD OptiEIA #555142).
- the anti-tumor effect of 1618-1210 was investigated using transgenic mice for human CD137 and subcutaneous syngeneic tumor model of CT26 colon carcinoma expressing human 5T4.
- the bispecific antibody 1618-1210 demonstrated tumor volume inhibition compared to monoclonal antibody 1618 targeting CD137.
- Human 4-1BB knock-in mouse model was developed by Prof. Lieping Chen and heterozygote F1 females were used in the experiments.
- the heterozygotes were generated by breeding male homozygotes for human CD137 in C57 background together with BalbC females. All experiments were done by approval of Malmo/Lund ethical committee.
- CT26 colon cancer cells were obtained from ATCC and transfected with human 5T4.
- the CT26-5T4 cell line growing in log phase was injected subcutaneously (0.5 ⁇ 10 6 cells in 100 ⁇ L on day 0 (D0)) into the right hind/flank. Intraperitoneal treatments (1.33 nM) were done on days 7, 10, and 13.
- the tumor was measured in width, length and height with a calliper, of which the tumor volume was calculated (w/2 ⁇ l/2 ⁇ h/2 ⁇ pi ⁇ (4/3)).
- the animals were terminated before the tumor volume reached 2 cm 3 , at wounding, or affected health of the mice.
- the data were analysed for tumor volume inhibition by the bispecific antibody compared to the monoclonal antibody using GraphPad Prism and Excel.
- Anti-tumor efficacy was demonstrated using treatment with bispecific antibody 1618-1210 compared to treatment with monoclonal antibody 1618 at days 8-22 in the form of tumor growth inhibition.
- the percentage of tumor volume inhibition ranged from 0-68% when treated with 1618-1210 (see Table 22).
- the anti-tumor effect of 1618-1210 was investigated using transgenic mice for human CD137 and a subcutaneous tumor model of CT26 colon carcinoma transfected with human 5T4.
- the bispecific antibody 1618-1210 demonstrated tumor volume inhibition compared to monoclonal CD137 mAb 1618.
- Bispecific 5T4-CD137 antibodies localize to the tumor area
- mice Female SCID-Beige mice (7-8 w) from Taconic (Denmark) were used in the experiments. All experiments were done by approval of the Malmo/Lund ethical committee.
- B16.F10 wt (B16) melanoma was obtained from ATCC and cultivated according to recommendations by ATCC.
- B16-514 was obtained from Professor Peter Stern and cultivated in the same medium, supplemented with 1.2 mg/mL G418.
- CT26 and CT26-5T4 cells were cultivated in RPMI, 10% FCS, NaPy and HEPES.
- CT-5T4 medium was supplemented with 1.2 mg/mL G418.
- Intraperitoneal antibody treatments (100 ⁇ g) were done on days 6 and 13 for B16 tumors and days 6, 13 and 20 for CT26 tumors.
- each mouse received a single tumor in the right flank.
- the cell line growing in log phase, was injected subcutaneously (10 ⁇ 10 6 cells in 100 ⁇ L on day 0).
- Human PBMCs (10 ⁇ 10 6 in 100 ⁇ L), isolated from leukocyte concentrates, were injected intraperitoneally once the average tumor volume reached above 100 mm 3 .
- Intraperitoneal antibody treatments (100 ⁇ g) were done starting at 6 days after the PBMC transfer, on days 55, 62 and 67.
- mice were sacrificed 24 h after the final treatment and tumors were collected. Tumors were enzymatically digested using Liberase TL (Roche #05401020001) and DNase I (Roche #10104159001). Digested tumor material was passed through a 70 ⁇ m cell strainer (Fisher Scientific #22363548) and the resulting single cell suspension was stained for FACS analysis.
- Tm measurements were performed on soluble scFv or bispecific antibodies using protein fluorescence with the UNcle platform (Unchained Labs). Onset of aggregation was measured with static light scattering (SLS) with the UNcle platform. Measurements were performed in the temperature range 20° C.-95° C. with ramping speed of 0.4° C. per min. in PBS and at a protein concentration range of 0.12-1.32 mg/ml. The data analysis was performed with the UNcle Analysis software version 2.0 using default settings.
- the optimized sequences exhibit improved Tm1 and Tagg compared to the wildtype sequences (1618 and 1210, respectively).
- thermostability is increased when the optimized sequences are employed in the bispecific format.
- FcgammaRlotalotaB controls the potency of agonistic anti-TNFR mAbs. Cancer Immunol Immunother 62, 941-948.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Immunology (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Genetics & Genomics (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Cell Biology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Mycology (AREA)
- Epidemiology (AREA)
- Microbiology (AREA)
- Oncology (AREA)
- Biomedical Technology (AREA)
- Endocrinology (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Investigating Or Analysing Materials By Optical Means (AREA)
Applications Claiming Priority (3)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| GB201607046 | 2016-04-22 | ||
| GB1607046.8 | 2016-04-22 | ||
| PCT/EP2017/059656 WO2017182672A1 (en) | 2016-04-22 | 2017-04-24 | Novel bispecific polypeptides against cd137 |
Related Parent Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/EP2017/059656 A-371-Of-International WO2017182672A1 (en) | 2016-04-22 | 2017-04-24 | Novel bispecific polypeptides against cd137 |
Related Child Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US17/482,708 Continuation US12173082B2 (en) | 2016-04-22 | 2021-09-23 | Bispecific polypeptides against CD137 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| US20190169308A1 true US20190169308A1 (en) | 2019-06-06 |
Family
ID=58609424
Family Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US16/094,127 Abandoned US20190169308A1 (en) | 2016-04-22 | 2017-04-24 | Novel bispecific polypeptides against cd137 |
| US17/482,708 Active 2038-04-04 US12173082B2 (en) | 2016-04-22 | 2021-09-23 | Bispecific polypeptides against CD137 |
Family Applications After (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US17/482,708 Active 2038-04-04 US12173082B2 (en) | 2016-04-22 | 2021-09-23 | Bispecific polypeptides against CD137 |
Country Status (14)
| Country | Link |
|---|---|
| US (2) | US20190169308A1 (https=) |
| EP (1) | EP3445788B1 (https=) |
| JP (2) | JP2019523630A (https=) |
| KR (1) | KR102426765B1 (https=) |
| CN (1) | CN109195994A (https=) |
| AU (1) | AU2017252233A1 (https=) |
| BR (1) | BR112018071612A2 (https=) |
| CA (1) | CA3021618A1 (https=) |
| DK (1) | DK3445788T3 (https=) |
| ES (1) | ES2910365T3 (https=) |
| IL (1) | IL262482A (https=) |
| MX (1) | MX2018012897A (https=) |
| RU (1) | RU2018139339A (https=) |
| WO (1) | WO2017182672A1 (https=) |
Cited By (11)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| KR20200037288A (ko) * | 2017-07-20 | 2020-04-08 | 압테보 리서치 앤드 디벨롭먼트 엘엘씨 | 5t4 및 4-1bb에 결합하는 항원 결합 단백질 및 관련 조성물 및 방법 |
| US11098117B2 (en) | 2017-04-13 | 2021-08-24 | Agenus Inc. | Anti-CD137 antibodies and methods of use thereof |
| WO2021170071A1 (en) * | 2020-02-28 | 2021-09-02 | Shanghai Henlius Biotech, Inc. | Anti-cd137 constructs, multispecific antibody and uses thereof |
| KR20220038768A (ko) * | 2019-07-26 | 2022-03-29 | 에이비엘바이오 주식회사 | 항-her2/항-4-1bb 이중 특이 항체 및 이의 용도 |
| WO2022158889A1 (en) * | 2021-01-25 | 2022-07-28 | Yuhan Corporation | Methods for purifying an anti-4-1bb/anti-her2 bispecific antibody |
| WO2023034564A3 (en) * | 2021-09-02 | 2023-04-06 | Memorial Sloan-Kettering Cancer Center | Anti-cd33 antibodies and uses thereof |
| WO2023061421A1 (en) * | 2021-10-12 | 2023-04-20 | Concept To Medicine Biotech Co., Ltd. | Single-domain 4-1bb antibodies |
| EP4004053A4 (en) * | 2019-07-26 | 2023-10-18 | ABL Bio, Inc. | BISPECIFIC ANTI-EGFR/ANTI-4-1BB ANTIBODIES AND USE THEREOF |
| US12146000B2 (en) | 2020-05-19 | 2024-11-19 | Boehringer Ingelheim International Gmbh | Bispecific and tetravalent CD137 and FAP molecules for the treatment of cancer |
| WO2025035107A3 (en) * | 2023-08-09 | 2025-05-08 | Curadh Mtr, Inc. | Trophoblast glycoprotein antibody compositions and methods of use |
| US12454577B2 (en) | 2018-06-06 | 2025-10-28 | Leadartis, S.L. | Trimeric polypeptide complexes comprising a collagen XVIII homotrimerization domain and/or a collagen xv homotrimerization and an agonist of a TNFR family costimulatory receptor, encoding polynucleotide thereof and method of use thereof to treat cancer |
Families Citing this family (74)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN107148425B (zh) | 2014-10-29 | 2021-08-03 | 拜斯科阿迪有限公司 | 对mt1-mmp特异性的双环肽配体 |
| BR112018074453A2 (pt) | 2016-05-27 | 2019-03-19 | Abbvie Biotherapeutics Inc. | proteínas de ligação biespecíficas ligando uma protéina imunomoduladora e um antígeno tumoral |
| HRP20210602T1 (hr) | 2016-06-20 | 2021-05-14 | F-Star Delta Limited | Vezujuće molekule koje vežu pd-l1 i lag-3 |
| SG11201811184UA (en) | 2016-06-20 | 2019-01-30 | F Star Beta Ltd | Lag -3 binding members |
| WO2018011421A1 (en) | 2016-07-14 | 2018-01-18 | Genmab A/S | Multispecific antibodies against cd40 and cd137 |
| GB201612520D0 (en) | 2016-07-19 | 2016-08-31 | F-Star Beta Ltd | Binding molecules |
| ES2981272T3 (es) | 2016-09-23 | 2024-10-08 | Merus Nv | Moléculas de unión que modulan una actividad biológica expresada por una célula |
| SG11201909160WA (en) | 2017-04-11 | 2019-10-30 | Inhibrx Inc | Multispecific polypeptide constructs having constrained cd3 binding and methods of using the same |
| EP3645549A1 (en) | 2017-06-26 | 2020-05-06 | BicycleRD Limited | Bicyclic peptide ligands with detectable moieties and uses thereof |
| SG11202000198QA (en) | 2017-08-04 | 2020-02-27 | Genmab As | Binding agents binding to pd-l1 and cd137 and use thereof |
| JP7670481B2 (ja) | 2017-08-04 | 2025-04-30 | バイスクルテクス・リミテッド | Cd137に対して特異的な二環式ペプチドリガンド |
| EP3710478A1 (en) * | 2017-11-13 | 2020-09-23 | Crescendo Biologics Limited | Molecules that bind to cd137 and psma |
| TWI825046B (zh) | 2017-12-19 | 2023-12-11 | 英商拜西可泰克斯有限公司 | Epha2特用之雙環胜肽配位基 |
| EP3728316B1 (en) | 2017-12-19 | 2025-02-26 | invoX Pharma Limited | Fc binding fragments comprising a pd-l1 antigen-binding site |
| CN109970865B (zh) * | 2017-12-28 | 2022-10-04 | 上海细胞治疗研究院 | 一种cd137双向激活共刺激分子受体及其用途 |
| CN111902429A (zh) | 2018-02-23 | 2020-11-06 | 拜斯科技术开发有限公司 | 多聚体双环肽配体 |
| SG11202008399QA (en) | 2018-03-12 | 2020-09-29 | Genmab As | Antibodies |
| EP3774851A1 (en) * | 2018-04-04 | 2021-02-17 | BicycleTX Limited | Heterotandem bicyclic peptide complexes |
| KR20260046525A (ko) | 2018-04-11 | 2026-04-07 | 인히브릭스 바이오사이언스, 인크. | 제한된 cd3 결합을 갖는 다중특이적 폴리펩티드 컨스트럭트 및 관련된 방법 및 용도 |
| US12168691B2 (en) | 2018-05-31 | 2024-12-17 | Board Of Regents, The University Of Texas System | VHS format bi-specific antibodies specific for HER2 and VEGF and use thereof |
| GB201810316D0 (en) | 2018-06-22 | 2018-08-08 | Bicyclerd Ltd | Peptide ligands for binding to EphA2 |
| IL279489B2 (en) * | 2018-06-22 | 2025-10-01 | Bicycletx Ltd | Bicyclic peptide ligands specific for nectin-4, a drug conjugate containing the peptide ligands and a pharmaceutical composition containing the drug conjugate |
| GB201811450D0 (en) * | 2018-07-12 | 2018-08-29 | F Star Delta Ltd | Mesothelin and CD137 binding molecules |
| GB201811410D0 (en) | 2018-07-12 | 2018-08-29 | F Star Beta Ltd | OX40 Binding molecules |
| GB201811403D0 (en) | 2018-07-12 | 2018-08-29 | F Star Beta Ltd | Antibody molecules |
| GB201811415D0 (en) | 2018-07-12 | 2018-08-29 | F Star Beta Ltd | Anti-Mesothelin Anti bodies |
| GB201811408D0 (en) | 2018-07-12 | 2018-08-29 | F Star Beta Ltd | CD137 Binding Molecules |
| GB201811404D0 (en) * | 2018-07-12 | 2018-08-29 | F Star Beta Ltd | Anti-CD137 Antibodies |
| PT3820569T (pt) | 2018-07-12 | 2025-01-14 | Invox Pharma Ltd | Moléculas de anticorpo que se ligam a pd-l1 e cd137 |
| ES3044118T3 (en) | 2018-07-12 | 2025-11-26 | Invox Pharma Ltd | Antibody molecules that bind cd137 and ox40 |
| EP3827019A1 (en) | 2018-07-24 | 2021-06-02 | Inhibrx, Inc. | Multispecific polypeptide constructs containing a constrained cd3 binding domain and a receptor binding region and methods of using the same |
| JP7596263B2 (ja) * | 2018-10-10 | 2024-12-09 | ザイムワークス ビーシー インコーポレイテッド | 4-1bb及び腫瘍関連抗原に結合する抗体構築物ならびにその使用 |
| JP2022504802A (ja) | 2018-10-11 | 2022-01-13 | インヒブルクス インコーポレイテッド | 5t4シングルドメイン抗体およびその治療組成物 |
| US20210403575A1 (en) * | 2018-10-22 | 2021-12-30 | Shanghai Yichen Biomed Co. Ltd | Bispecific antibody |
| CN113286825B (zh) * | 2018-11-30 | 2024-06-18 | 爱必乐生物公司 | 抗pd-l1/抗4-1bb双特异性抗体及其用途 |
| GB201820325D0 (en) | 2018-12-13 | 2019-01-30 | Bicyclerd Ltd | Bicyclic peptide ligands specific for psma |
| GB201820295D0 (en) | 2018-12-13 | 2019-01-30 | Bicyclerd Ltd | Bicyclic peptide ligands specific for MT1-MMP |
| GB201820288D0 (en) | 2018-12-13 | 2019-01-30 | Bicycle Tx Ltd | Bicycle peptide ligaands specific for MT1-MMP |
| EP3898679A2 (en) * | 2018-12-17 | 2021-10-27 | Alligator Bioscience AB | Polypeptides |
| GB201820556D0 (en) * | 2018-12-17 | 2019-01-30 | Alligator Bioscience Ab | Novel polypeptides |
| CN113677703A (zh) * | 2018-12-17 | 2021-11-19 | 鳄鱼生物科学公司 | 多肽 |
| WO2020132672A1 (en) * | 2018-12-21 | 2020-06-25 | Actinium Pharmaceuticals, Inc. | Combination of radioimmunotherapy and immune checkpoint therapy in the treatment of cancer |
| WO2020128527A1 (en) | 2018-12-21 | 2020-06-25 | Bicyclerd Limited | Bicyclic peptide ligands specific for pd-l1 |
| US12492224B2 (en) | 2018-12-21 | 2025-12-09 | Bicycletx Limited | Bicyclic peptide ligands specific for PD-L1 |
| GB201900529D0 (en) | 2019-01-15 | 2019-03-06 | Bicycletx Ltd | Bicyclic peptide ligands specific for CD38 |
| TWI793395B (zh) * | 2019-01-25 | 2023-02-21 | 大陸商信達生物製藥(蘇州)有限公司 | 結合pd-l1和ox40的雙特異性抗體 |
| GB201905100D0 (en) * | 2019-04-10 | 2019-05-22 | Antibody Innovation Ltd | Polypeptides and methods of use |
| WO2020225577A1 (en) | 2019-05-09 | 2020-11-12 | Bicycletx Limited | Bicyclic peptide ligands specific for ox40 |
| TWI860386B (zh) * | 2019-07-30 | 2024-11-01 | 英商拜西可泰克斯有限公司 | 異質雙環肽複合物 |
| CN112592404B (zh) * | 2019-09-20 | 2023-07-25 | 上海交通大学医学院 | 抗体活性改造及其筛选方法 |
| SMT202500247T1 (it) * | 2019-10-03 | 2025-09-12 | Bicycletx Ltd | Complessi peptidici eterotandem biciclici |
| EP3816185A1 (en) | 2019-11-04 | 2021-05-05 | Numab Therapeutics AG | Multispecific antibody directed against pd-l1 and a tumor-associated antigen |
| WO2021101346A1 (en) * | 2019-11-21 | 2021-05-27 | Dong-A St Co., Ltd. | Anti-ror1/anti-4-1bb bispecific antibodies and uses thereof |
| US20230048361A1 (en) | 2019-12-31 | 2023-02-16 | Kahr Medical Ltd. | Methods of culturing t cells and uses of same |
| WO2021137231A1 (en) | 2019-12-31 | 2021-07-08 | Kahr Medical Ltd. | Methods of culturing t cells with a 4-1bbl fusion polypeptide and uses of same |
| IL294557A (en) | 2020-01-07 | 2022-09-01 | Univ Texas | Improved human methylthioadenosine/adenosine depleting enzyme variants for cancer therapy |
| JP7789002B2 (ja) | 2020-01-29 | 2025-12-19 | インヒブルクス バイオサイエンシズ インコーポレイテッド | Cd28シングルドメイン抗体ならびにその多価および多重特異性の構築物 |
| CN115362270A (zh) | 2020-01-29 | 2022-11-18 | 得克萨斯州大学系统董事会 | Egfr/her2酪氨酸激酶抑制剂和/或her2/her3抗体在具有nrg1融合的癌症的治疗中的用途 |
| JP7777533B2 (ja) | 2020-01-29 | 2025-11-28 | ボード オブ リージェンツ,ザ ユニバーシティ オブ テキサス システム | Nrg1融合体を有するがんの治療のためのポジオチニブの使用 |
| JP7702961B6 (ja) * | 2020-02-28 | 2025-07-17 | 上海復宏漢霖生物技術股▲フン▼有限公司 | 抗cd137コンストラクト、多重特異性抗体及びその使用 |
| US20230265202A1 (en) * | 2020-04-15 | 2023-08-24 | Zymeworks Inc. | Antibody constructs binding 4-1bb and folate receptor alpha and uses thereof |
| EP4155319A4 (en) * | 2020-06-30 | 2024-06-12 | Nona Biosciences (Suzhou) Co., Ltd. | 4-1BB BINDING PROTEIN AND ITS USE |
| AU2021322934A1 (en) | 2020-08-03 | 2023-03-30 | Bicycletx Limited | Peptide-based linkers |
| KR20230042524A (ko) | 2020-08-07 | 2023-03-28 | 주식회사 유틸렉스 | 항-her2 / 항-4-1bb 이중특이적 항체 및 이의 용도 |
| AU2021374803A1 (en) * | 2020-11-03 | 2023-06-22 | Deutsches Krebsforschungszentrum Stiftung des öffentlichen Rechts | Target-cell restricted, costimulatory, bispecific and bivalent anti-cd28 antibodies |
| WO2023056361A1 (en) | 2021-09-29 | 2023-04-06 | Board Of Regents, The University Of Texas System | Anti-hsp70 antibodies and therapeutic uses thereof |
| WO2023174521A1 (en) * | 2022-03-15 | 2023-09-21 | Genmab A/S | Binding agents binding to epcam and cd137 |
| WO2024051752A1 (en) * | 2022-09-06 | 2024-03-14 | I-Mab Biopharma Co., Ltd. | Multispecific constructs and uses thereof |
| CN119790076A (zh) * | 2022-09-22 | 2025-04-08 | 成都盛世君联生物技术有限公司 | 一种抗4-1bb纳米抗体及其制备和应用 |
| JP7730432B2 (ja) * | 2022-10-19 | 2025-08-27 | アステラス製薬株式会社 | がん治療におけるpd-1シグナル阻害剤との組み合わせによる抗cldn4-抗cd137二重特異性抗体の使用 |
| KR20240095012A (ko) * | 2022-11-29 | 2024-06-25 | (주) 테라베스트 | Cd137 세포외 도메인을 포함하는 융합단백질, 이를 발현하는 면역세포 및 이의 용도 |
| EP4644417A4 (en) * | 2022-12-30 | 2026-02-11 | Abclon Inc | AFFICORPS SPECIFICALLY BINDING TO CD137 AND ITS USE |
| WO2025056180A1 (en) * | 2023-09-15 | 2025-03-20 | BioNTech SE | Methods of treatment using agents binding to epcam and cd137 in combination with pd-1 axis binding antagonists |
| WO2026042803A1 (ja) * | 2024-08-21 | 2026-02-26 | アステラス製薬株式会社 | がん治療におけるプラチナ系薬剤との組み合わせによる抗cldn4-抗cd137二重特異性抗体の使用 |
Family Cites Families (22)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4235871A (en) | 1978-02-24 | 1980-11-25 | Papahadjopoulos Demetrios P | Method of encapsulating biologically active materials in lipid vesicles |
| US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
| SE459005B (sv) | 1985-07-12 | 1989-05-29 | Aake Rikard Lindahl | Saett att framstaella sfaeriska polymerpartiklar |
| CA2192782C (en) | 1995-12-15 | 2008-10-14 | Nobuyuki Takechi | Production of microspheres |
| ATE411342T1 (de) * | 1999-11-18 | 2008-10-15 | Oxford Biomedica Ltd | Scfv antikörper gegen krankheiten-assoziierte moleküle |
| WO2001056603A1 (en) * | 2000-02-01 | 2001-08-09 | Tanox, Inc. | Cd40-binding apc-activating molecules |
| JP2003531588A (ja) | 2000-04-11 | 2003-10-28 | ジェネンテック・インコーポレーテッド | 多価抗体とその用途 |
| SV2007002227A (es) | 2004-09-10 | 2007-03-20 | Wyeth Corp | Anticuerpos anti-5t4 humanizados y conjugados anticuerpo anti-5t4/calicheamicina ref. 040000-0317637 |
| US7612181B2 (en) | 2005-08-19 | 2009-11-03 | Abbott Laboratories | Dual variable domain immunoglobulin and uses thereof |
| ES2617983T3 (es) * | 2011-01-10 | 2017-06-20 | Ct Atlantic Ltd. | Terapia de combinación que incluye anticuerpos de unión a antígenos asociados a tumores |
| ES2692268T5 (en) | 2011-03-29 | 2025-02-26 | Roche Glycart Ag | Antibody fc variants |
| WO2013026839A1 (en) | 2011-08-23 | 2013-02-28 | Roche Glycart Ag | Bispecific antibodies specific for t-cell activating antigens and a tumor antigen and methods of use |
| CA2846432A1 (en) * | 2011-09-23 | 2013-03-28 | Amgen Research (Munich) Gmbh | Bispecific binding molecules for 5t4 and cd3 |
| WO2014116846A2 (en) * | 2013-01-23 | 2014-07-31 | Abbvie, Inc. | Methods and compositions for modulating an immune response |
| AU2015244814B2 (en) * | 2014-04-07 | 2020-12-24 | Chugai Seiyaku Kabushiki Kaisha | Immunoactivating antigen-binding molecule |
| US20150307620A1 (en) * | 2014-04-16 | 2015-10-29 | University Of Connecticut | Linked immunotherapeutic agonists that costimulate multiple pathways |
| CN105233291A (zh) * | 2014-07-09 | 2016-01-13 | 博笛生物科技有限公司 | 用于治疗癌症的联合治疗组合物和联合治疗方法 |
| SI3242890T1 (sl) * | 2015-01-08 | 2020-01-31 | BioNTech SE | Agonistična sredstva, ki vežejo receptorje TNF |
| CA2973720A1 (en) * | 2015-01-14 | 2016-07-21 | Compass Therapeutics Llc | Multispecific immunomodulatory antigen-binding constructs |
| CN114181309B (zh) * | 2015-05-21 | 2024-07-30 | 鳄鱼生物科学公司 | 新型多肽 |
| AU2018224094B2 (en) * | 2017-02-24 | 2025-04-17 | Macrogenics, Inc. | Bispecific binding molecules that are capable of binding CD137 and tumor antigens, and uses thereof |
| EP3655439A1 (en) | 2017-07-20 | 2020-05-27 | Aptevo Research and Development LLC | Antigen binding proteins binding to 5t4 and 4-1bb and related compositions and methods |
-
2017
- 2017-04-24 EP EP17718928.9A patent/EP3445788B1/en active Active
- 2017-04-24 MX MX2018012897A patent/MX2018012897A/es unknown
- 2017-04-24 WO PCT/EP2017/059656 patent/WO2017182672A1/en not_active Ceased
- 2017-04-24 CA CA3021618A patent/CA3021618A1/en active Pending
- 2017-04-24 DK DK17718928.9T patent/DK3445788T3/da active
- 2017-04-24 AU AU2017252233A patent/AU2017252233A1/en not_active Abandoned
- 2017-04-24 KR KR1020187030680A patent/KR102426765B1/ko active Active
- 2017-04-24 BR BR112018071612-0A patent/BR112018071612A2/pt not_active IP Right Cessation
- 2017-04-24 CN CN201780025116.2A patent/CN109195994A/zh active Pending
- 2017-04-24 US US16/094,127 patent/US20190169308A1/en not_active Abandoned
- 2017-04-24 RU RU2018139339A patent/RU2018139339A/ru unknown
- 2017-04-24 JP JP2018555198A patent/JP2019523630A/ja active Pending
- 2017-04-24 ES ES17718928T patent/ES2910365T3/es active Active
-
2018
- 2018-10-21 IL IL262482A patent/IL262482A/en unknown
-
2021
- 2021-09-23 US US17/482,708 patent/US12173082B2/en active Active
- 2021-11-26 JP JP2021192091A patent/JP2022058338A/ja active Pending
Cited By (21)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11098117B2 (en) | 2017-04-13 | 2021-08-24 | Agenus Inc. | Anti-CD137 antibodies and methods of use thereof |
| US12492393B2 (en) | 2017-04-13 | 2025-12-09 | Agenus Inc. | Anti-CD137 antibodies and methods of use thereof |
| US11242385B2 (en) | 2017-04-13 | 2022-02-08 | Agenus Inc. | Anti-CD137 antibodies and methods of use thereof |
| US11725060B2 (en) * | 2017-07-20 | 2023-08-15 | Aptevo Reserch and Development LLC | Antigen binding proteins binding to 5T4 and 4-1BB and related compositions and methods |
| US20200223933A1 (en) * | 2017-07-20 | 2020-07-16 | Aptevo Research and Development, LLC | Antigen binding proteins binding to 5t4 and 4-1bb and related compositions and methods |
| KR20200037288A (ko) * | 2017-07-20 | 2020-04-08 | 압테보 리서치 앤드 디벨롭먼트 엘엘씨 | 5t4 및 4-1bb에 결합하는 항원 결합 단백질 및 관련 조성물 및 방법 |
| US11312786B2 (en) * | 2017-07-20 | 2022-04-26 | Aptevo Research And Development Llc | Oncofetal antigen binding proteins and related compositions and methods |
| KR102649757B1 (ko) | 2017-07-20 | 2024-03-21 | 압테보 리서치 앤드 디벨롭먼트 엘엘씨 | 5t4 및 4-1bb에 결합하는 항원 결합 단백질 및 관련 조성물 및 방법 |
| US12454577B2 (en) | 2018-06-06 | 2025-10-28 | Leadartis, S.L. | Trimeric polypeptide complexes comprising a collagen XVIII homotrimerization domain and/or a collagen xv homotrimerization and an agonist of a TNFR family costimulatory receptor, encoding polynucleotide thereof and method of use thereof to treat cancer |
| KR20220038768A (ko) * | 2019-07-26 | 2022-03-29 | 에이비엘바이오 주식회사 | 항-her2/항-4-1bb 이중 특이 항체 및 이의 용도 |
| EP4004053A4 (en) * | 2019-07-26 | 2023-10-18 | ABL Bio, Inc. | BISPECIFIC ANTI-EGFR/ANTI-4-1BB ANTIBODIES AND USE THEREOF |
| EP4004054A4 (en) * | 2019-07-26 | 2023-10-25 | Yuhan Corporation | ANTI-HER2/ANTI-4-1BB BISPECIFIC ANTIBODIES AND ITS APPLICATION |
| US12168690B2 (en) * | 2019-07-26 | 2024-12-17 | Abl Bio Inc. | Anti-EGFR/anti-4-1BB bispecific antibody |
| US12240913B2 (en) | 2019-07-26 | 2025-03-04 | Abl Bio Inc. | Anti-HER2/anti-4-1BB bispecific antibody and use thereof |
| KR102820082B1 (ko) * | 2019-07-26 | 2025-06-13 | 주식회사유한양행 | 항-her2/항-4-1bb 이중 특이 항체 및 이의 용도 |
| WO2021170071A1 (en) * | 2020-02-28 | 2021-09-02 | Shanghai Henlius Biotech, Inc. | Anti-cd137 constructs, multispecific antibody and uses thereof |
| US12146000B2 (en) | 2020-05-19 | 2024-11-19 | Boehringer Ingelheim International Gmbh | Bispecific and tetravalent CD137 and FAP molecules for the treatment of cancer |
| WO2022158889A1 (en) * | 2021-01-25 | 2022-07-28 | Yuhan Corporation | Methods for purifying an anti-4-1bb/anti-her2 bispecific antibody |
| WO2023034564A3 (en) * | 2021-09-02 | 2023-04-06 | Memorial Sloan-Kettering Cancer Center | Anti-cd33 antibodies and uses thereof |
| WO2023061421A1 (en) * | 2021-10-12 | 2023-04-20 | Concept To Medicine Biotech Co., Ltd. | Single-domain 4-1bb antibodies |
| WO2025035107A3 (en) * | 2023-08-09 | 2025-05-08 | Curadh Mtr, Inc. | Trophoblast glycoprotein antibody compositions and methods of use |
Also Published As
| Publication number | Publication date |
|---|---|
| AU2017252233A1 (en) | 2018-11-15 |
| KR20180135454A (ko) | 2018-12-20 |
| ES2910365T3 (es) | 2022-05-12 |
| EP3445788B1 (en) | 2022-01-19 |
| EP3445788A1 (en) | 2019-02-27 |
| JP2019523630A (ja) | 2019-08-29 |
| CA3021618A1 (en) | 2017-10-26 |
| DK3445788T3 (en) | 2022-04-11 |
| RU2018139339A (ru) | 2020-05-22 |
| WO2017182672A1 (en) | 2017-10-26 |
| RU2018139339A3 (https=) | 2020-09-28 |
| IL262482A (en) | 2018-12-31 |
| US12173082B2 (en) | 2024-12-24 |
| MX2018012897A (es) | 2019-01-17 |
| CN109195994A (zh) | 2019-01-11 |
| KR102426765B1 (ko) | 2022-07-29 |
| BR112018071612A2 (pt) | 2019-02-19 |
| US20220213213A1 (en) | 2022-07-07 |
| JP2022058338A (ja) | 2022-04-12 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US12173082B2 (en) | Bispecific polypeptides against CD137 | |
| US12441812B2 (en) | Methods of treating cancer by administering tumor necrosis factor (TNF) family ligand trimer-containing antigen-binding molecules | |
| US12509526B2 (en) | Anti-CD137 antibodies and uses thereof | |
| US12202870B2 (en) | Antigen binding molecules comprising a trimeric TNF family ligand and encoding polynucleotides thereof | |
| JP7418346B2 (ja) | 4-1BBLを含むHer2標的化抗原結合分子 | |
| US20190161555A1 (en) | Bispecific Antibodies Directed Against OX40 and a Tumor-Associated Antigen | |
| JP7678005B2 (ja) | Her2を標的とするアゴニストCD28抗原結合分子 | |
| US20220073635A1 (en) | Novel polypeptides | |
| US11873348B2 (en) | Peptides | |
| TW202307008A (zh) | 靶向EpCAM之促效的CD28抗原結合分子 | |
| US20220064325A1 (en) | Novel polypeptides | |
| HK40004686B (en) | Novel bispecific polypeptides against cd137 | |
| JP2025523424A (ja) | Ceacam5およびcd47に対する二重特異性抗体ならびにceacam5およびcd3に対する二重特異性抗体の併用療法 | |
| HK40003232A (en) | Novel bispecific polypeptides against cd137 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| AS | Assignment |
Owner name: ALLIGATOR BIOSCIENCE AB, SWEDEN Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:DAHLEN, EVA;ELLMARK, PETER;FUREBRING, CHRISTINA;AND OTHERS;SIGNING DATES FROM 20181219 TO 20190108;REEL/FRAME:048072/0296 |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: FINAL REJECTION MAILED |
|
| STCB | Information on status: application discontinuation |
Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION |