US20170204196A1 - Anti-nme antibody - Google Patents

Anti-nme antibody Download PDF

Info

Publication number
US20170204196A1
US20170204196A1 US15/302,461 US201515302461A US2017204196A1 US 20170204196 A1 US20170204196 A1 US 20170204196A1 US 201515302461 A US201515302461 A US 201515302461A US 2017204196 A1 US2017204196 A1 US 2017204196A1
Authority
US
United States
Prior art keywords
nme7
cells
cancer
seq
antibody
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Abandoned
Application number
US15/302,461
Other languages
English (en)
Inventor
Cynthia Bamdad
Benoit Smagghe
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Minerva Biotechnologies Corp
Original Assignee
Minerva Biotechnologies Corp
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority claimed from PCT/US2014/050773 external-priority patent/WO2015023694A2/en
Application filed by Minerva Biotechnologies Corp filed Critical Minerva Biotechnologies Corp
Priority to US15/302,461 priority Critical patent/US20170204196A1/en
Assigned to MINERVA BIOTECHNOLOGIES CORPORATION reassignment MINERVA BIOTECHNOLOGIES CORPORATION ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: SMAGGHE, BENOIT, BAMDAD, CYNTHIA C.
Publication of US20170204196A1 publication Critical patent/US20170204196A1/en
Abandoned legal-status Critical Current

Links

Images

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/40Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against enzymes
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/0005Vertebrate antigens
    • A61K39/0011Cancer antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K48/00Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • A61P35/04Antineoplastic agents specific for metastasis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • A61P37/04Immunostimulants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • C07K14/7051T-cell receptor (TcR)-CD3 complex
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • C07K16/3076Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells against structure-related tumour-associated moieties
    • C07K16/3092Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells against structure-related tumour-associated moieties against tumour-associated mucins
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/32Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against translation products of oncogenes
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/06Animal cells or tissues; Human cells or tissues
    • C12N5/0602Vertebrate cells
    • C12N5/0693Tumour cells; Cancer cells
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12QMEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
    • C12Q1/00Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
    • C12Q1/68Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving nucleic acids
    • C12Q1/6876Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes
    • C12Q1/6883Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes for diseases caused by alterations of genetic material
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/574Immunoassay; Biospecific binding assay; Materials therefor for cancer
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/33Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622Single chain antibody (scFv)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2800/00Nucleic acids vectors
    • C12N2800/22Vectors comprising a coding region that has been codon optimised for expression in a respective host

Definitions

  • the present application relates to NME proteins, peptides derived from NME proteins, and antibodies generated from the peptides thereof or antibody or antibody fragments selected by virtue of their ability to bind to said peptides.
  • the present application also relates to treating or preventing diseases associated with the expression of NME in a patient.
  • NDPK nucleoside diphosphate protein kinase proteins
  • NM23 proteins nucleoside diphosphate protein kinase proteins
  • the present inventors previously disclosed that NM23-H1 dimers bind to and dimerize the extracellular domain of the MUC1* growth factor receptor that is over expressed on the vast majority of cancers and such binding promotes the growth of cancer cells.
  • NM23 forms tetramers and hexamers that do not bind to MUC1* and do not promote tumorigenesis.
  • NME family proteins NME 1-10) have been discovered although until now, their functions have not been elucidated.
  • NME7 is a newly discovered NME family protein, but its NDPK domain has no enzymatic activity, unlike other NME family members. NME7 is either not expressed at all in adult tissues or is expressed at extremely low levels.
  • the present application is directed to a method of treating or preventing cancer in a subject, comprising administering to the subject an antibody made against a member of the NME family
  • the NME family may be NME7 family
  • the antibody may bind to NME7.
  • the antibody may bind to NME7-AB or NME-AB-like protein.
  • the antibody may bind to NME7-X1.
  • the antibody may inhibit binding between NME7 and its cognate binding partner.
  • the cognate binding partner may be MUC1*.
  • the cognate binding partner may be PSMGFR portion of the MUC1* extracellular domain.
  • the antibody may be generated or selected for its ability to bind to a peptide selected from those listed in FIGS. 16-19 (SEQ ID NOS:88 to 145).
  • the peptide may be selected from those listed in FIG. 19 (SEQ ID NOS:141 to 145).
  • the peptide may be highly homologous to, or to which is added or subtracted up to 7, up to 6, up to 5, up to 4, up to 3, up to 2, or up to 1 amino acid residues at the N-terminus or C-terminus, of the peptides listed in FIGS. 16-19 (SEQ ID NOS:88 to 145).
  • the antibody may be selected for its ability to bind to NME7-AB or NME7-X1 but not to NME1.
  • the antibody may be polyclonal, monoclonal, bivalent, monovalent, bispecific, an antibody fragment containing the variable region, or an antibody mimic.
  • the antibody may be human or humanized
  • the antibody may be a single chain scFv.
  • the invention is directed to a method of treating or preventing cancer in a subject, comprising administering to the subject a peptide that is highly homologous or identical to regions of NME7-AB.
  • the peptide may be at least 80% homologous to one or more of the peptides listed in FIG. 16 .
  • the peptide may be at least 80% homologous to one or more of the peptides listed in FIG. 17 .
  • the peptide may be at least 80% homologous to one or more of the peptides listed in FIG. 18 .
  • the peptide may be at least 80% homologous to one or more of the peptides listed in FIG. 19 .
  • the peptide may be selected from peptides listed in FIGS.
  • the peptide may be selected from those listed in FIG. 19 (SEQ ID NOS:141 to 145). Or, the peptide may be highly homologous to, or to which is added or subtracted up to 7, up to 6, up to 5, up to 4, up to 3, up to 2, or up to 1 amino acid residues at the N-terminus or C-terminus, of the peptides listed in FIGS. 16-19 (SEQ ID NOS:88 to 145).
  • the peptide may be connected to another peptide via a spacer or linker.
  • the invention is directed to a chimeric antigen receptor (CAR), for the treatment or prevention of cancer wherein the targeting extracellular portion of the CAR comprises at least a peptide fragment of a member of the NME family
  • NME family may be NME7 family
  • the member of the NME7 family may be NME7.
  • the member of the NME7 family may be NME7-AB or NME-AB-like protein.
  • the member of the NME7 family may be also NME7-X1.
  • the targeting extracellular portion of the CAR may include a peptide of the peptides listed in FIGS. 16-19 (SEQ ID NOS:88 to 145).
  • the peptide may be selected from those listed in FIG. 19 (SEQ ID NOS:141 to 145).
  • the peptide may include a peptide, which is highly homologous to, or to which is added or subtracted up to 7, up to 6, up to 5, up to 4, up to 3, up to 2, or up to 1 amino acid residues at the N-terminus or C-terminus, of the peptides listed in FIGS. 16-19 (SEQ ID NOS:88 to 145).
  • the peptide may be connected to another peptide via a spacer or linker.
  • the invention is directed to a method of treating or preventing cancer or cancer metastasis, comprising engineering the chimeric antigen receptor according to claim 3 , into an immune system cell and administering the cell to a subject in need thereof.
  • the invention is directed to a chimeric antigen receptor (CAR), for the treatment or prevention of cancer, wherein the targeting extracellular portion of the chimeric antigen receptor comprises a portion of an antibody that binds to NME7-AB, NME-AB-like protein or NME7-X1.
  • the portion of the antibody may be a single chain scFv or may be human or humanized.
  • the invention is directed to a method of vaccinating a person against cancer or metastatic cancer comprising immunizing the person with a peptide fragment of a member of the NME family
  • the NME family may be NME7 family
  • the member of the NME7 family may be NME7 or NME7b.
  • the member of the NME7 family may be NME7-AB or NME7-AB-like protein.
  • the NME7 family may be NME7-X1.
  • the immunizing peptide may be a peptide from the peptides listed in FIGS. 16-19 (SEQ ID NOS:88 to 145).
  • the peptide may be selected from those listed in FIG. 19 (SEQ ID NOS:141 to 145).
  • the immunizing peptide may include a peptide, which is highly homologous to, or to which is added or subtracted up to 7, up to 6, up to 5, up to 4, up to 3, up to 2, or up to 1 amino acid residues at the N-terminus or C-terminus, of the peptides listed in FIGS. 16-19 (SEQ ID NOS:88 to 145).
  • the immunizing peptide may be connected to another peptide via a spacer or linker.
  • the invention is directed to a method of treating or preventing cancer in a subject, comprising administering to the subject a nucleic acid that inhibits the expression of NME7, NME7b, NME7-AB-like protein or NME7-X1.
  • the nucleic acid may be an anti-sense nucleic acid that suppresses expression of NME7, NME7-AB-like protein or NME7-X1.
  • the nucleic acid may be an inhibitory RNA, siRNA, RNAi, or shRNA that inhibits expression of NME7, NME7-AB-like protein or NME7-X1.
  • the invention is directed to a method of treating or preventing cancer in a subject, comprising administering to the subject genetically edited nucleic acids that inhibit expression of NME7, NME7b, NME7-AB-like protein or NME7-X1.
  • the genetically edited nucleic acids that inhibit expression of NME7, NME7b, NME7-AB-like protein or NME7-X1 may be inserted into cells that may be then administered to the patient.
  • the genetically edited nucleic acids that inhibit expression of NME7, NME7b, NME7-AB-like protein or NME7-X1 may be inserted into cells using a viral vector.
  • the viral vector may be a lentiviral system.
  • the invention is directed to a method of growing cancer cells comprising contacting the cells with NME7-AB, NME7b, NME7-AB-like protein or NME7-X1, 2i or 5i.
  • the method may include culturing the cells in a medium that contains NME7-AB, NME7b, NME7-AB-like protein or NME7-X1, 2i or 5i, or growing cells in an animal that expresses human NME7-AB, NME7b, NME7-AB-like protein or NME7-X1, or to which NME7-AB, NME7b, NME7-AB-like protein or NME7-X1 is administered.
  • the cancer cells may be breast, prostate, ovarian, colorectal, pancreatic, liver, melanoma or brain cancer cells. Drug candidates may be tested on the cells.
  • the efficacy of the drugs may be assessed by comparing cancer growth to a no drug control or comparing expression levels of metastatic markers or stem cell markers to a no drug control or comparing the ability of the resultant cells to form tumors in animals from low cell copy number compared to a no drug control and determining the efficacy of a candidate drug for the treatment of cancer or metastasis.
  • the cells may be obtained from a patient being assessed for treatment for cancer and drugs that would be effective for that patient are selected based on results using methods described above.
  • the cells may not be obtained from a patient being assessed for treatment for cancer but drugs that would be effective for that patient are selected based on results using the methods described above.
  • the invention is directed to a method of generating antibodies or antibody-like molecules from peptides or peptide mimics having a sequence derived from the sequence of NME.
  • the NME may be NME7.
  • the peptide may be used as an immunogen to generate antibodies or antibody-like molecules.
  • the peptide may be administered to an animal to generate anti-NME7 antibodies.
  • the peptide may be administered to a human to generate anti-NME7 antibodies.
  • the peptide may have a sequence listed in FIGS. 16 to 19 (SEQ ID NOS:88 to 145).
  • the peptide may be selected from those listed in FIG. 19 (SEQ ID NOS:141 to 145).
  • the peptide may include a peptide, which is highly homologous to, or to which is added or subtracted up to 7, up to 6, up to 5, up to 4, up to 3, up to 2, or up to 1 amino acid residues at the N-terminus or C-terminus, of the peptides listed in FIGS. 16-19 (SEQ ID NOS:88 to 145).
  • the invention is directed to a method of detecting presence of cancer or the progression of cancer, comprising the steps of:
  • the detection of the member of the NME7 family in circulation or in a tissue may be an indicator of cancer in a patient.
  • the member of the NME7 family may be NME7, NME7b, NME7-X1, or NME7-AB-like protein.
  • the invention is directed to a method comprising:
  • the member of the NME7 family may be NME7, NME7b, NME7-X1, or NME7-AB -like protein.
  • the invention is directed to a method for treating or preventing cancer comprising:
  • the target of the member of the NME7 family may be MUC1*.
  • the target of the member of the NME7 family may be PSMGFR portion of the MUC1* extracellular domain.
  • the member of the NME7 family may be NME7, NME7b, NME7-X1, or NME7-AB-like protein.
  • cancer may include breast, prostate, ovarian, colorectal, pancreatic, liver, melanoma or brain cancer.
  • FIGS. 1A-1D Photos of Western blot gels showing the expression of NME1 or NME7 in the cell lysate of: 1) BGO1V human embryonic stem cells cultured in NM23-H1 dimers over a surface coated with a MUC1* antibody surface (MN-C3 mab); 2) BGO1V human embryonic stem cells cultured according to standard protocol in bFGF over a layer of mouse feeder cells (MEFs); 3) T47D breast cancer cells cultured by standard method in RPMI media; and 4) recombinant human NM23-H1 wild type, “wt” (A, B).
  • Bottom row (C, D) shows the results of a “pull-down” or an immuno-precipitation assay in which the cell lysates were separately incubated with beads to which was added an antibody to the MUC1 cytoplasmic tail, “Ab-5”. Species captured by binding to the MUC1* peptide were separated by SDS-PAGE and blotted with antibodies against each respective NM23 protein. Same experiments were conducted with NME6 but data is not shown.
  • FIGS. 2A-2E show photos of Western blots in which cell lysates from T47D breast cancer cells, BGO1V and HES-3 human ES cells and human SC101-A1 iPS cells were probed for the presence of NME1, NME6 or NME7.
  • NME1 in all cell lines ran with an apparent molecular weight of ⁇ 17 kDa (A).
  • NME7 ⁇ 33 kDa species and the 42 kDa species (C, E) could be detected in all but the HES-3 cell line (cultured in FGF).
  • Species that reacted with an NME6-specific antibody were detected in all cell lines except the HES-3 cell line, when visualization was enhanced using Super Signal.
  • FIGS. 3A-3C show panels of photos of Western blots of human embryonic stem (ES) cells (A) and induced pluripotent stem (iPS) cells (B, C) probed for the presence of NME7.
  • Western blots show the presence of three forms of NME7 in the cell lysates.
  • B induced pluripotent stem
  • FIGS. 4A-4C are an elution profile of size exclusion chromatography purification of NME7-AB;
  • (B) is non-reducing SDS-PAGE gel from NME7-AB peak fractions;
  • (C) is the elution profile of size exclusion chromatography of the purified NME7-AB.
  • FIG. 5 shows graph of HRP signal from ELISA sandwich assay showing NME7-AB dimerizes MUC1* extra cellular domain peptide.
  • FIGS. 6A-6G show photos of MUC1*-positive cancer cells treated with nothing (Row A), Taxol (Row B) or an anti-NME7 antibody (Rows C-E); a graph showing cell count in response to treatment at 48 hours (F), and a dot-blot used to estimate antibody concentration used in the cancer cell inhibition experiment (G).
  • FIGS. 7A-7K show the 48 hour results of an experiment using an anti-NME7 antibody to inhibit cancer cell growth. Photos of the cells cultured in media alone (A), taxol (B), or anti-NME7 at the concentrations indicated (C-J); a graph of cell number obtained using a calcein AM assay is shown (K).
  • FIGS. 8A-8K show the 96 hour results of an experiment using an anti-NME7 antibody to inhibit cancer cell growth. Photos of the cells cultured in media alone (A), taxol (B), or anti-NME7 at the concentrations indicated (C-J); a graph of cell number obtained using a calcein AM assay is shown (K). The graph and the photos show anti-NME7 antibodies inhibit cancer cell growth at concentrations as low as in the nanomolar range.
  • FIG. 9 is a photo of a Western blot wherein stem cell lysates (odd numbered lanes) or cell-conditioned media (even numbered lanes) were probed for the presence of NME7.
  • iPS induced pluripotent stem cells were cultured in FGF over MEFs (lanes 1,2), NM23-H1 dimers over an anti-MUC1* antibody (C3) surface (lanes 3,4) or NME7 over an anti-MUC1* antibody (C3) surface (lanes 5-8).
  • HES-3 human embryonic stem cells were cultured in FGF over MEFs (lanes 9,10), NM23-H1 dimers over an anti-MUC1* antibody (C3) surface (lanes 11,12) or NME7 over an anti-MUC1* antibody (C3) surface (lanes 13,14).
  • Mouse embryonic fibroblast (MEFs) cells were also probed (lanes 15,16).
  • the Western blot shows that the cell lysates contain an NME7 species with molecular weight of ⁇ 42 kDa, which corresponds to the full-length protein. However, the secreted species runs with an apparent MW of ⁇ 33 kDa, which corresponds to an NME7 species that is devoid of the N-terminal leader sequence.
  • FIGS. 10A-10B show photos of Western blots of various cell lysates and corresponding conditioned media probed for the presence of NME7 using a mouse monoclonal antibody (A) or another monoclonal antibody that only recognizes the N-terminal DM10 sequence (B).
  • A mouse monoclonal antibody
  • B another monoclonal antibody that only recognizes the N-terminal DM10 sequence
  • FIG. 11 is a graph of RT-PCR measurements of gene expression for stem cell markers and cancer stem cell markers for T47D cancer cells after being cultured in traditional media or a media containing NME7, wherein cells that became non-adherent (floaters) were analyzed separate from those that remained adherent.
  • FIG. 12 is a graph of RT-PCR measurements of gene expression for stem cell marker SOX2 and cancer stem cell marker CXCR4 for T47D cancer cells.
  • Cells were cultured either in traditional media or a media containing NME1 dimers or NME7 (NME7-AB).
  • NME7-AB NME7
  • Cell types that were separately analyzed were floating cells, cells plus Rho kinase inhibitor (+Ri), which made all cells adhere, or cells that remained adherent after floaters were removed which was in the absence of rho kinase inhibitor ( ⁇ Ri).
  • FIG. 13 is a graph of RT-PCR measurements of gene expression for a variety of stem and putative cancer stem cell markers for DU145 prostate cancer cells.
  • Cells were cultured either in traditional media or a media containing NME1 dimers (“NM23”) or NME7 (NME7-AB). Rho kinase inhibitor was not used because by passage 2, cells remained adherent.
  • FIGS. 14A-14B are a graphs of RT-PCR measurement of the metastatic markers and pluripotent stem cell markers showing that the 2i inhibitors (GSK3-beta and MEK inhibitors) (A) that were previously shown to revert stem cells to a more na ⁇ ve state or bacterial NMEs (B) that have high sequence homology to human NME1 or human NME7, also transform cancer cells to a more metastatic state.
  • GSK3-beta and MEK inhibitors 2i inhibitors
  • B bacterial NMEs
  • FIG. 15 is a sequence alignment between human NME1 and human NME7-A or -B domain.
  • FIG. 16 lists immunogenic peptides from human NME7 with low sequence identity to NME1 and selected for their ability to generate therapeutic anti-NME7 antibodies for the treatment or prevention of cancers.
  • FIG. 17 lists immunogenic peptides from human NME7 that may be important for structural integrity or for binding to MUC1* selected for their ability to generate therapeutic anti-NME7 antibodies for the treatment or prevention of cancers.
  • FIG. 18 lists immunogenic peptides from human NME1 that may be important for structural integrity or for binding to MUC1* and selected for their ability to generate therapeutic anti-NME7 antibodies for the treatment or prevention of cancers.
  • FIG. 19 lists immunogenic peptides from human NME7 selected for their low sequence identity to NME1 and for their homology to bacterial NME1 proteins that have been implicated in cancers. These peptides are preferred for their ability to generate therapeutic anti-NME7 antibodies for the treatment or prevention of cancers.
  • the peptides shown in this Figure include and added Cysteine covalently bound at the C-terminal end.
  • FIG. 20 shows photographs of two female athymice nu/nu mice out of 24 that were xenografted with only 50 human breast cancer cells that had first been grown for 7 days in NME7-AB and showed greatly increased expression of CXCR4, CHD1 and stem cell markers.
  • half the mice were also injected daily with human recombinant NME7-AB.
  • 82% of the mice that were also injected daily with NME7-AB developed remote metastases as well as tumors at the site of injection.
  • FIG. 21 shows a table of the results of the experiment in which mice were xenografted with cancer cells that were transformed to a more metastatic state by pre-culture in a medium containing human NME7-AB.
  • FIG. 22A shows a graph of tumor volume measurements for four (4) groups of immune-compromised nu/nu female mice implanted with either 50, 100, 1,000 or 10,000 cells subcutaneously in the flank wherein the cells that were implanted were human MUC1-positive breast cancer cells that were cultured for seven (7) days in recombinant human NME7-AB wherein the ‘floaters’ were collected and verified to overexpress metastasis receptor CXCR4 by more than 100-fold. Half the mice in each group were injected daily with human recombinant NME7-AB. Numbers within the graph refer to the mouse tracking number. ‘M’ denotes a mouse with multiple tumors.
  • FIG. 22B shows a graph of tumor volume measurements for four (4) groups of immune-compromised nu/nu female mice implanted with either 50, 100, 1,000 or 10,000 cells subcutaneously in the flank wherein the cells that were implanted were human MUC1-positive breast cancer cells that were cultured for seven (7) days in recombinant human NME7-AB wherein the ‘floaters’ were collected and verified to overexpress metastasis receptor CXCR4 by more than 100-fold.
  • Half the mice in each group were injected daily with human recombinant NME7-AB. Of the mice that received daily injections of NME7-AB, 80% developed multiple tumors.
  • This graph shows the combined volumes of multiple tumors in the same mouse. Numbers within the graph refer to the mouse tracking number. ‘M’ denotes a mouse with multiple tumors.
  • FIG. 23 shows Western blots of primary tumors as well as the remote bumps on mice xenografted with human breast cancer cells that were transformed to a more metastatic state by pre-culture in a medium containing human NME7-AB.
  • Westerns show that the remote bumps were human breast tumors as VU4H5 antibody only stains human MUC1, not murine.
  • FIG. 24 shows Western blots of primary tumors on mice xenografted with human breast cancer cells that were transformed to a more metastatic state by pre-culture in a medium containing human NME7-AB.
  • Westerns show that the visible bumps are human breast tumors as VU4H5 antibody only stains human MUC1, not murine.
  • FIG. 25 shows Western blots of organs harvested from mice xenografted with human breast cancer cells that were transformed to a more metastatic state by pre-culture in a medium containing human NME7-AB. Westerns show that some mice that did not appear to have remote tumors, have human MUC1-positive cancer in some of their organs.
  • FIGS. 26A-26B show graphs of ELISA assays in which either NME7-AB (A) or NME1 (B) is adsorbed to the plate and anti-NME7 antibodies generated by NME7 peptides A1, A2, B1, B2 and B3 are tested for their ability to bind to NME7 but not to NME1.
  • C20 is an anti-NME1 antibody.
  • FIG. 27 shows graphs of ELISA assays in which anti-NME7 antibodies generated are tested for their ability to inhibit binding of NME7-AB to a surface immobilized MUC1* peptide but not inhibit binding of NME1.
  • FIG. 28 shows a graph of a cancer cell growth experiment in which breast cancer cells were grown in the presence or absence of NME7 antibodies or short peptides derived from NME7, which were used to generate or select the antibodies.
  • FIG. 29 shows a graph of a cancer cell growth experiment in which breast cancer cells were grown in the presence or absence of combinations of NME7 antibodies or combinations of the short peptides derived from NME7, which were used to generate or select the antibodies. Both antibodies as well as their immunizing NME7-AB peptides inhibited growth of cancer cells.
  • FIG. 30 shows a table of scientist observations when cancer cells were grown in either NME7-AB or 2i inhibitors, which both are able to transform cancer cells to a more metastatic state, and in the presence or absence of NME7 derived peptides A1, A2, B1, B2 and B3.
  • the NME7-AB peptides inhibited the transition of adherent cancer cells to the floater cells, which RT-PCR measurements show have increased expression of metastatic markers, especially CXCR4.
  • FIGS. 31A-31C show a graph of RT-PCR measurements of CXCR4 expression in T47D breast cancer cells that were grown in either NME7-AB or 2i inhibitors, each of which transform cancer cells to a more metastatic state, and the inhibitory effect of anti-NME7 antibodies on the metastatic transformation (A).
  • Peptides A1, A2 and B1 which were used in the inhibitory Combo 2 and 3 in part (A) are also inhibitory as peptides.
  • Peptide B3 is the most inhibitory and is the immunizing peptide for antibody 61 which was the most inhibitory antibody tested in part (A).
  • the scale of the Y-axis of the graph of part (B) is reduced.
  • FIG. 32 shows a table of recorded RNA levels in samples that were used for RT-PCR measurement of CXCR4 in FIG. 31 as well as the threshold cycle number for CXCR4 expression as well as for the control housekeeping gene.
  • FIG. 33 shows a graph of RT-PCR measurement of the expression of NME7-X1 in a panel of human stem cells and cancer cells.
  • FIG. 34 shows a graph of RT-PCR measurement of the expression of NME7, NME7a, NME7b and NME7-X1 in a panel of human stem cells and cancer cells.
  • NME7a is full-length NME7
  • NME7b is missing a small portion of the DM10 domain
  • NME7-X1 is missing all of the DM10 domain and a small portion of the N-terminus of the first NDPK A domain.
  • the bar labeled NME7 means that primers were used that detected both NME7a and NME7b.
  • FIGS. 35A-35C show photographs of Western blots in which various cancer cell lines are probed for expression of NME7 species using antibodies generated by immunization with NME7 derived short peptides.
  • FIGS. 36A-36B show photographs of Western blots in which various cancer cell lines are probed for expression of NME7 species using commercially available antibodies.
  • FIGS. 37A-37C show graphs of RT-PCR measurements of metastatic markers in cancer cells after being cultured in a serum-free media containing NME7-AB compared to the standard media.
  • C) MDA-MB a breast cancer cell line that expresses minimal levels of MUC1 increased expression of metastatic markers CDH1 aka E-cadherin and SOX2.
  • FIGS. 38A-38F show photographs of Western blots and cancer growth graphs.
  • A) various cancer cell lines are probed for the expression of full-length MUC1 using an anti-tandem repeat antibody VU4H5.
  • B) various cancer cell lines are probed for the expression of cleaved form MUC1* using anti-PSMGFR antibody.
  • C) various cancer cell lines are probed for the expression of NME7 species using a commercially available anti-NME7 antibody B9, showing full-length NME7 as well as a 33 kDa and 30 kDa species, consistent with a naturally occurring NME7-AB-like species as well as NME7-X1.
  • HER2 positive BT-474 breast cancer cells express little to no MUC1 or MUC1* until they acquire resistance to chemotherapy drugs and metastasize.
  • Parent cells were made resistant to Herceptin, Taxol, Doxorubicin and cyclophosphamide by culturing the cells in sub-lethal levels of the drug.
  • Part (D) shows that the expression level of HER2 has not changed but expression of MUC1* has dramatically increased.
  • E) shows a graph of the growth of the parent BT-474 cells compared to the drug resistant metastatic cells in response to treatment with Herceptin in the presence or absence of an anti-MUC1* Fab.
  • F) shows a graph of the growth of the parent BT-474 cells compared to the drug resistant metastatic cells in response to treatment with Taxol in the presence or absence of an anti-MUC1* Fab.
  • FIGS. 39A-39E show photographs of Western blots of a co-immunoprecipitation experiment.
  • T47D breast cancer cell extracts were incubated with an antibody against the MUC1 cytoplasmic tail, Ab-5, or a control antibody, IgG, and co-immunoprecipitated.
  • the gels were blotted with two different commercially available anti-NME7 antibodies B9 (A) and CF7 (B). Both gels show unique NME7 bands at ⁇ 33 kDa and ⁇ 30 kDa.
  • the gels were stripped and re-probed with an antibody against the extracellular domain of MUC1*, anti-PSMGFR (C) and (D), which shows that the NME7 species and MUC1* interact.
  • a recombinant NME7-AB and a recombinant NME7-X1 were mixed together and run on a gel, then probed with an anti-NME7 antibody, showing that the two unique NME7 species that are naturally occurring in breast cancer cells and that interact with MUC1* are an NME7-AB-like species and NME7-X1 (E).
  • FIGS. 40A-40C show photographs of Western blots of a co-immunoprecipitation experiment.
  • Human induced pluripotent stem, iPS7, or embryonic stem, HES3, cell extracts were incubated with an antibody against the MUC1 cytoplasmic tail, Ab-5, or a control antibody, IgG, and co-immunoprecipitated.
  • the gel was blotted with a commercially available anti-NME7 antibody B9 (A). Both cell types show unique NME7 bands at ⁇ 33 kDa and ⁇ 30 kDa.
  • the gel was stripped and re-probed with an antibody against the extracellular domain of MUC1*, anti-PSMGFR (B), which shows that the NME7 species and MUC1* interact.
  • a recombinant NME7-AB and a recombinant NME7-X1 were mixed together and run on a gel, then probed with an anti-NME7 antibody, showing that the two unique NME7 species that are naturally occurring in breast cancer cells and that interact with MUC1* are an NME7-AB-like species and NME7-X1 (C).
  • “about” or “substantially” generally provides a leeway from being limited to an exact number.
  • “about” or “substantially” indicates that the polypeptide is not to be limited to the recited number of amino acids. A few amino acids add to or subtracted from the N-terminus or C-terminus may be included so long as the functional activity such as its binding activity is present.
  • administration “in combination with” one or more further therapeutic agents includes simultaneous (concurrent) and consecutive administration in any order.
  • amino acid and “amino acids” refer to all naturally occurring L- ⁇ -amino acids. This definition is meant to include norleucine, ornithine, and homocysteine.
  • amino acid sequence variant refers to molecules with some differences in their amino acid sequences as compared to a reference (e.g. native sequence) polypeptide.
  • the amino acid alterations may be substitutions, insertions, deletions or any desired combinations of such changes in a native amino acid sequence.
  • Substitutional variants are those that have at least one amino acid residue in a native sequence removed and a different amino acid inserted in its place at the same position.
  • the substitutions may be single, where only one amino acid in the molecule has been substituted, or they may be multiple, where two or more amino acids have been substituted in the same molecule.
  • Substitutes for an amino acid within the sequence may be selected from other members of the class to which the amino acid belongs.
  • the nonpolar (hydrophobic) amino acids include alanine, leucine, isoleucine, valine, proline, phenylalanine, tryptophan and methionine.
  • the polar neutral amino acids include glycine, serine, threonine, cysteine, tyrosine, asparagine and glutamine
  • the positively charged (basic) amino acids include arginine, lysine and histidine.
  • the negatively charged (acidic) amino acids include aspartic acid and glutamic acid.
  • proteins or fragments or derivatives thereof which exhibit the same or similar biological activity and derivatives which are differentially modified during or after translation, e.g., by glycosylation, proteolytic cleavage, linkage to an antibody molecule or other cellular ligand, and so on.
  • Insertional variants are those with one or more amino acids inserted immediately adjacent to an amino acid at a particular position in a native amino acid sequence. Immediately adjacent to an amino acid means connected to either the ⁇ -carboxy or ⁇ -amino functional group of the amino acid.
  • Deletional variants are those with one or more amino acids in the native amino acid sequence removed. Ordinarily, deletional variants will have one or two amino acids deleted in a particular region of the molecule.
  • fragments refers to biologically active amino acid sequence variants and fragments of the polypeptide of the present invention, as well as covalent modifications, including derivatives obtained by reaction with organic derivatizing agents, post-translational modifications, derivatives with nonproteinaceous polymers, and immunoadhesins.
  • carriers include pharmaceutically acceptable carriers, excipients, or stabilizers which are nontoxic to the cell or mammal being exposed thereto at the dosages and concentrations employed.
  • pharmaceutically acceptable carrier is an aqueous pH buffered solution.
  • Examples of pharmaceutically acceptable carriers include without limitation buffers such as phosphate, citrate, and other organic acids; antioxidants including ascorbic acid; low molecular weight (less than about 10 residues) polypeptide; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, arginine or lysine; monosaccharides, disaccharides, and other carbohydrates including glucose, mannose, or dextrins; chelating agents such as EDTA; sugar alcohols such as mannitol or sorbitol; salt-forming counterions such as sodium; and/or nonionic surfactants such as TWEEN®, polyethylene glycol (PEG), and PLURONICS®.
  • buffers such as phosphate, citrate, and other organic acids
  • antioxidants including ascorbic acid
  • proteins such as
  • pharmaceutically acceptable carrier and/or diluent includes any and all solvents, dispersion media, coatings antibacterial and antifungal agents, isotonic and absorption delaying agents and the like.
  • the use of such media and agents for pharmaceutical active substances is well known in the art. Except insofar as any conventional media or agent is incompatible with the active ingredient, use thereof in the therapeutic compositions is contemplated. Supplementary active ingredients can also be incorporated into the compositions.
  • Dosage unit form refers to physically discrete units suited as unitary dosages for the mammalian subjects to be treated; each unit containing a predetermined quantity of active material calculated to produce the desired therapeutic effect in association with the required pharmaceutical carrier.
  • the specification for the dosage unit forms of the invention are dictated by and directly dependent on (a) the unique characteristics of the active material and the particular therapeutic effect to be achieved, and (b) the limitations inherent in the art of compounding such an active material for the treatment of disease in living subjects having a diseased condition in which bodily health is impaired.
  • the principal active ingredient is compounded for convenient and effective administration in effective amounts with a suitable pharmaceutically acceptable carrier in dosage unit form.
  • a unit dosage form can, for example, contain the principal active compound in amounts ranging from 0.5 ⁇ g to about 2000 mg. Expressed in proportions, the active compound is generally present in from about 0.5 ⁇ g/ml of carrier. In the case of compositions containing supplementary active ingredients, the dosages are determined by reference to the usual dose and manner of administration of the said ingredients.
  • a polynucleotide vector of this invention may be in any of several forms, including, but not limited to, RNA, DNA, RNA encapsulated in a retroviral coat, DNA encapsulated in an adenovirus coat, DNA packaged in another viral or viral-like form (such as herpes simplex, and adeno-structures, such as polyamides.
  • host cell includes an individual cell or cell culture which can be or has been a recipient of a vector of this invention.
  • Host cells include progeny of a single host cell, and the progeny may not necessarily be completely identical (in morphology or in total DNA complement) to the original parent cell due to natural, accidental, or deliberate mutation and/or change.
  • subject is a vertebrate, preferably a mammal, more preferably a human.
  • mammal for purposes of treatment refers to any animal classified as a mammal, including humans, domestic and farm animals, and zoo, sports, or pet animals, such as dogs, cats, cattle, horses, sheep, pigs, and so on.
  • the mammal is human.
  • treatment is an approach for obtaining beneficial or desired clinical results.
  • beneficial or desired clinical results include, but are not limited to, alleviation of symptoms, diminishment of extent of disease, stabilized (i.e., not worsening) state of disease, delay or slowing of disease progression, amelioration or palliation of the disease state, and remission (whether partial or total), whether detectable or undetectable.
  • Treatment can also mean prolonging survival as compared to expected survival if not receiving treatment.
  • Treatment refers to both therapeutic treatment and prophylactic or preventative measures. Those in need of treatment include those already with the disorder as well as those in which the disorder is to be prevented. “Palliating” a disease means that the extent and/or undesirable clinical manifestations of a disease state are lessened and/or the time course of the progression is slowed or lengthened, as compared to a situation without treatment.
  • A1” peptide, “A2” peptide, “B1” peptide, “B2” peptide and “B3” peptide refer to peptides that bind to human NME7-AB, but not (or significantly less) to human NME1.
  • the peptides used to generate these antibodies are common to both NME7-AB and NME7-X1, and are set forth as below.
  • A1 is NME7A peptide 1 (A domain): (SEQ ID NO: 141) MLSRKEALDFHVDHQS A2 is NME7A peptide 2 (A domain): (SEQ ID NO: 142) SGVARTDASES B1 is NME7B peptide 1 (B domain): (SEQ ID NO: 143) DAGFEISAMQMFNMDRVNVE B2 is NME7B peptide 2 (B domain): (SEQ ID NO: 144) EVYKGVVTEYHDMVTE B3 is NME7B peptide 3 (B domain): (SEQ ID NO: 145) AIFGKTKIQNAVHCTDLPEDGLLEVQYFF
  • NME7A refers to the subunit A portion of NME7.
  • NME7a refers to the full-length NME7 that is described elsewhere in this application.
  • NME7B refers to the subunit B portion of NME7.
  • NME7b refers to a species of NME7 that is partially devoid of the DM10 region, which is described elsewhere in this application.
  • antibody-like means a molecule that may be engineered such that it contains portions of antibodies but is not an antibody that would naturally occur in nature. Examples include but are not limited to CAR (chimeric antigen receptor) T cell technology and the Ylanthia® technology.
  • CAR chimeric antigen receptor
  • Ylanthia® technology uses an antibody epitope fused to a portion of a T cell so that the body's immune system is directed to attack a specific target protein or cell.
  • the Ylanthia® technology consists of an “antibody-like” library that is a collection of synthetic human fabs that are then screened for binding to peptide epitopes from target proteins. The selected Fab regions can then be engineered into a scaffold or framework so that they resemble antibodies.
  • an “effective amount of an agent to inhibit an NME family member protein” refers to the effective amount of the agent in hindering the activating interaction between the NME family member protein and its cognate receptor such as
  • NME derived fragment refers to a peptide sequence that is either a fragment of the NME or is highly homologous to the peptide sequence that is a fragment of the NME.
  • the “MUC1*” extra cellular domain is defined primarily by the PSMGFR sequence (GTINVHDVETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGA (SEQ ID NO:6)). Because the exact site of MUC1 cleavage depends on the enzyme that clips it, and that the cleavage enzyme varies depending on cell type, tissue type or the time in the evolution of the cell, the exact sequence of the MUC1* extra cellular domain may vary at the N-terminus.
  • PSMGFR is an acronym for Primary Sequence of MUC1 Growth Factor Receptor as set forth as GTINVHDVETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGA (SEQ ID NO:6).
  • N-number as in “N-10 PSMGFR”, “N-15 PSMGFR”, or “N-20 PSMGFR” refers to the number of amino acid residues that have been deleted at the N-terminal end of PSMGFR.
  • C-number as in “C-10 PSMGFR”, “C-15 PSMGFR”, or “C-20 PSMGFR” refers to the number of amino acid residues that have been deleted at the C-terminal end of PSMGFR.
  • the “extracellular domain of MUC1*” refers to the extracellular portion of a MUC1 protein that is devoid of the tandem repeat domain
  • MUC1* is a cleavage product wherein the MUC1* portion consists of a short extracellular domain devoid of tandem repeats, a transmembrane domain and a cytoplasmic tail.
  • the precise location of cleavage of MUC1 is not known perhaps because it appears that it can be cleaved by more than one enzyme.
  • the extracellular domain of MUC1* will include most of the PSMGFR sequence but may have an additional 10-20 N-terminal amino acids.
  • high homology is considered to be at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 97% identity in a designated overlapping region between any two polypeptides.
  • NME family proteins or “NME family member proteins”, numbered 1-10, are proteins grouped together because they all have at least one NDPK (nucleotide diphosphate kinase) domain. In some cases, the NDPK domain is not functional in terms of being able to catalyze the conversion of ATP to ADP.
  • NME proteins were formerly known as NM23 proteins, numbered H1 and H2. Recently, as many as ten (10) NME family members have been identified.
  • NM23 and NME are interchangeable.
  • terms NME1, NME2, NMES, NME6, NME7, NME8 and NME9 are used to refer to the native protein as well as NME variants.
  • NME7 as used in the specification can mean the native protein or a variant, such as NME7-AB that has superior commercial applicability because variations allow high yield expression of the soluble, properly folded protein in E. coli.
  • NME7-AB consists primarily of the NME7 A and B domains but is devoid of most of the DM10 domain (SEQ ID NO:39), which is at the N-terminus of the native protein.
  • NME1 as referred to herein is interchangeable with “NM23-H1”. It is also intended that the invention not be limited by the exact sequence of the NME proteins.
  • the mutant NME1-S120G also called NM23-S120G, are used interchangeably throughout the application.
  • the S120G mutants and the P96S mutant are preferred because of their preference for dimer formation, but may be referred to herein as NM23 dimers, NME1 dimers, or dimeric NME1, or dimeric NM23.
  • NME7 as referred to herein is intended to mean native NME7 having a molecular weight of about 42 kDa.
  • a “family of NME7” refers to full length NME7 as well as naturally occurring or artificially created cleaved form having a molecular weight about 30 kDa, 33 kDa, or a cleaved form having a molecular weight of about 25 kDa, a variant devoid or partially devoid of the DM10 leader sequence (SEQ ID NO:162), which is NME7 amino acids 1-91 of NME7 represented by SEQ ID NO:82 or 147, such as NME7b, NME7-X1, NME7-AB or a recombinant NME7 protein, or variants thereof whose sequence may be altered to allow for efficient expression or that increase yield, solubility or other characteristics that make the NME7 more effective or commercially more viable.
  • the “family of NME7” may also include “NME7-AB-like” protein, which is a protein in the range of 30 to 33 kDa that is expressed in cancer cells.
  • an “an agent that maintains stem cells in the na ⁇ ve state or reverts primed stem cells to the na ⁇ ve state” refers to a protein, small molecule or nucleic acid that alone or in combination maintains stem cells in the na ⁇ ve state, resembling cells of the inner cell mass of an embryo.
  • Examples include but are not limited to human NME1 dimers, bacterial, fungal, yeast, viral or parasitic NME proteins that have high sequence identity to human NME proteins, especially NME1, NME7, NME7-X1, NME7-AB, NME6, 2i (Silva J et al, 2008; Hanna et al, 2010), 5i (Theunissen T W et al, 2014), nucleic acids such as siRNA that suppress expression of MBD3, CHD4 (Rais Y1 et al, 2013), BRD4, or JMJD6 (Liu W et al 2013).
  • an “an agent that promotes pluripotency” or “reverts somatic cells to a stem-like or cancer-like state” refers to a protein, small molecule or nucleic acid that alone or in combination induces expression of or suppresses expression of certain genes such that the genetic signature shifts to one that more closely resembles stem cells or cancer cells.
  • NME1 dimers examples include but are not limited to NME1 dimers, NME7, NME7-X1, NME7-AB, 2i, 5i, nucleic acids such as siRNA that suppress expression of MBD3, CHD4, BRD4, or JMJD6, microbial NME proteins that have high sequence homology to human NME1, NME2, NME5, NME6, NME7, NME8, or NME9, preferably with the regions that house NDPK domains.
  • small molecule in reference to an agent being referred to as a “small molecule”, it may be a synthetic chemical or chemically based molecule having a molecular weight between 50 Da and 2000 Da, more preferably between 150 Da and 1000 Da, still more preferably between 200 Da and 750 Da.
  • FGF fibroblast growth factor
  • FGF-2 or bFGF refer to fibroblast growth factor (Xu RH et al, 2005; Xu C et al, 2005).
  • Rho associated kinase inhibitors may be small molecules, peptides or proteins (Rath N, et al, 2012). Rho kinase inhibitors are abbreviated here and elsewhere as ROCi or ROCKi, or Ri. The use of specific rho kinase inhibitors are meant to be exemplary and can be substituted for any other rho kinase inhibitor.
  • cancer stem cells or “tumor initiating cells” refers to cancer cells that express levels of genes that have been linked to a more metastatic state or more aggressive cancers.
  • cancer stem cells or “tumor initiating cells” can also refer to cancer cells for which far fewer cells are required to give rise to a tumor when transplanted into an animal. Cancer stem cells and tumor initiating cells are often resistant to chemotherapy drugs.
  • stem/cancer refers to a state in which cells acquire characteristics of stem cells or cancer cells, share important elements of the gene expression profile of stem cells, cancer cells or cancer stem cells.
  • Stem-like cells may be somatic cells undergoing induction to a less mature state, such as increasing expression of pluripotency genes.
  • Stem-like cells also refers to cells that have undergone some de-differentiation or are in a meta-stable state from which they can alter their terminal differentiation.
  • Cancer like cells may be cancer cells that have not yet been fully characterized but display morphology and characteristics of cancer cells, such as being able to grow anchorage-independently or being able to give rise to a tumor in an animal.
  • spacers or “linkers” of different lengths can be incorporated anywhere in the peptide. Spacer attachment is usually through an amide linkage but other functionalities are possible.
  • NME, NME7 and Protein Family of NME7 are NME, NME7 and Protein Family of NME7
  • NME7 is highly expressed in early human stem cells and also in most cancer cells ( FIGS. 1, 2, 3, 35, 36, 38, 39 and 40 and Examples 2, 3, and 4). Further, we demonstrated that like NM23-H1, NME7 binds to and dimerizes the MUC1* growth factor receptor on both stem cells and cancer cells.
  • FIG. 15 shows a sequence alignment of NME1 and NME7 A and B domains.
  • NME7 is a primitive form of NME1 (NM23-H1) that is expressed in very early embryonic stem cells. NME7 is either not expressed at all, or is expressed at extremely low levels, in adult tissues. However, the inventors discovered that NME7 is expressed at high levels in cancerous cells and tissues and at even higher levels in metastatic cancer cells and tissues. A cleaved form of NME7 may be a secreted form allowing it to bind to and activate extracellular receptors.
  • NME7-X1 molecular weight ⁇ 30 kDa
  • NME7-AB molecular weight ⁇ 33 kDa
  • NME7b spans amino acids 37-376 and is devoid of only 37 amino acids of the DM10 domain is also overexpressed in prostate cancers ( FIG. 34 ).
  • NME7-X1 we generated a human recombinant NME7-X1 and show that it is the secreted 30 kDa NME7 species in cancer cells that runs just lower than a naturally occurring ⁇ 33 kDa NME7 species that appears to be a naturally occurring “NME7-AB-like” protein that is a cleavage product or alternative isoform.
  • NME7-AB-like protein a panel of cancer cell lines and found that they express high levels of NME7 and lower molecular weight species that may be truncations similar to NME7-AB, such as NME7-AB-like protein, or alternate isoforms such as NME7-X1.
  • NME7 is a monomer with two binding sites for MUC1* extracellular domain.
  • NME7-AB a recombinant human NME7 that is devoid of the DM10 domain, which we call NME7-AB.
  • FIGS. 4A-4C show the elution profile of size exclusion chromatography purification of NME7-AB, a non-reducing SDS-PAGE gel from NME7-AB peak fractions and the elution profile of size exclusion chromatography of the purified NME7-AB.
  • a sandwich ELISA binding assay that shows that a recombinant NME7, NME7-AB simultaneously binds to two PSMGFR peptides wherein the extracellular domain of MUC1* is comprised of most or all of the PSMGFR sequence ( FIG. 5 , Example 6).
  • NME7 was also shown to be able to bind to and dimerize the PSMGFR portion of the MUC1* extracellular domain.
  • Agents that disable NME7, block its interaction with its binding partners or suppress its expression are potent anti-cancer therapeutics.
  • Such agents may be antibodies, small molecules or nucleic acids. They may act on NME7 directly, on molecules that regulate NME7 expression, or on enzymes that cleave NME7 to cancer-promoting forms.
  • NME7-AB monomer was fully able to support pluripotent human stem cell growth in the absence of any other growth factor, cytokine or serum.
  • Competitively inhibiting the interaction between NME7 and MUC1* extracellular domain comprised essentially of the PSMGFR sequence, induced differentiation of stem cells, showing that it is the interaction of NME7 and MUC1* that promotes stem cell growth and inhibits differentiation.
  • NME7-AB alone is also able to fully support human cancer cell growth.
  • NME7-AB when added to regular cancer cell growth media, stimulated cancer cell growth and in particular the growth of MUC1-positive and MUC1*-positive cancer cells. Inhibiting the interaction of NME7 with MUC1* inhibited cancer cell growth. Blocking the MUC1* growth factor receptor with an anti-MUC1* Fab potently inhibited cancer cell growth.
  • antibodies that bind to NME7 inhibit cancer cell growth.
  • FIGS. 6-8 and Example 10 One example of inhibition of cancer growth by anti-NME7 antibody is shown in FIGS. 6-8 and Example 10. In this case, the polyclonal antibody was generated from immunizing an animal with the portion of NME7 that spans amino acids 100-376. However, we found that antibodies generated from immunizing with shorter peptides from NME7-AB or from NME7-X1 also inhibit cancer growth. In particular, they inhibit the growth of MUC1 and MUC1*-positive cancers.
  • the inventors further discovered that culturing cancer cells in a minimal media containing NME7-AB induced a wide variety of cancer cells to become transformed to a more metastatic state.
  • Evidence of this induced metastatic state include a change from adherent cell growth to no-adherent cell growth, aka, “floater” cells and accompanying up-regulation of specific metastatic markers that were especially upregulated in the floating cells.
  • These metastatic markers that are upregulated after culture in NME7-AB include but are not limited to CXCR4, CHD1 aka E-cadherin, CD44, and pluripotent stem cell markers such as OCT4, SOX2, NANOG and KLF2/4.
  • NME7-AB Cancer cells cultured in NME7-AB had dramatically higher engraftment rates when xenografted into test animals, which were over 90%. In addition, very low numbers of implanted cancer cells formed tumors in the test animals, which is evidence that NME7-AB had transformed them into cancer stem cells also known as metastatic cancer cells. Because cancer cells make either an NME7 cleavage product or alternative isoform that is essentially equivalent to NME7-AB, the methods described here are not limited to using NME7-AB; other NME7 species could work as well. For example, we discovered another NME7 isoform, NME7-X1, is expressed by cancer cells.
  • NME7-AB It is identical to our recombinant NME7-AB with the exception that the X1 isoform is missing 33 amino acids from the N-terminus. NME7-X1 is expected to function like NME7-AB. “NME7-AB-like” protein has also been detected in cancer cells as being about 33 Da species.
  • NME7-AB alone is able to revert human stem cells to an earlier na ⁇ ve state.
  • culturing cancer cells in the presence of other reagents that make stem cells revert to a more na ⁇ ve state makes the cancer cells transform to a more metastatic state.
  • NME7-AB FIGS. 11 and 12
  • “2i” inhibitors FIG. 14A
  • human NME1 dimers or bacterial NME1 dimers with high sequence homology to human NME1 or human NME7 FIG. 14B are each able to transform regular cancer cells into metastatic cancer cells, which are also called cancer stem cells “CSCs” or tumor initiating cells “TICs” ( FIGS. 11-14 ).
  • 2i is the name given to two biochemical inhibitors that researchers found made human stem cells revert to a more na ⁇ ve state.
  • 2i are MEK and GSK3-beta inhibitors PD0325901 and CHIR99021, which are added to culture medium to final concentrations of about 1 mM and 3 mM, respectively.
  • NME7-AB and NME7-X1 are at a final concentration of about 4 nM when added to separate batches of minimal medium to make cancer cells transform to metastatic cells, although lower and higher concentrations also work well in the range of about 1 nM to 16 nM.
  • NME1 dimers Human or bacterial NME1 dimers are used at a final concentration of 4 nM to 32 nM, with 16 nM typically used in these experiments, wherein the human NME bears the S120G mutation. Lower concentrations may be required if using wild type. It is not intended that these exact concentrations are important. It is important that the NME1 proteins are dimers and the range of concentrations over which this happens is in the low nanomolar range although certain mutations allow higher concentrations to remain as dimers. Similarly, the concentrations of NME7 proteins can vary. NME7-AB and NME7-X1 are monomers and concentrations used to transform cancer cells to metastatic cells should allow the proteins to remain as monomers.
  • NME7 NME7-AB
  • NME7-X1 NME7-X1
  • 2i inhibitors other reagents and inhibitors have been shown by others to cause stem cells to revert to a more na ⁇ ve state.
  • These inhibitors, “i's” include JNKi, p38i, PKCi, ROCKi, BMPi, BRAFi, SRCi as well as growth factors activing and LIF (Gafni et al 2013, Chan et al 2013, Valarang et al 2014, Ware et al 2014, Theunissen et al 2014).
  • These reagents can also be used to make cancer cells progress to a more metastatic state.
  • Cells that have been induced to transform to a more metastatic state using any single factor or combination of the inhibitors or growth factors, that make stem cells revert to a more na ⁇ ve state can then be used as discovery tools to identify or test drugs to treat or prevent cancer metastasis.
  • Various molecular markers have been proposed as being indicators of metastatic cancer cells.
  • Different cancer types may have different molecules that are up-regulated.
  • the receptor CXCR4 is up-regulated in metastatic breast cancers while E-cadherin, also known as CHD1, is up-regulated more in metastatic prostate cancers.
  • typical markers of pluripotency such as OCT4, SOX2, NANOG, and KLF4 are up-regulated as cancers become metastatic.
  • the starting cancer cells and the later metastatic cancer cells are assayed by PCR to measure expression levels of these genes.
  • these cancer cells cultured in agents such as NME7-AB that cause them to be transformed to a more metastatic state, as evidenced by increased expression of metastatic markers and pluripotent stem cell markers, function as metastatic cancer cells.
  • a functional test of whether or not a population of cancer cells is metastatic is to implant very low numbers, e.g. 200, of the cells in immuno-compromised mice and see if they develop into a tumor. Typically 5-6 million cancer cells are required to form a tumor in an immuno-compromised mouse. We showed that as few as 50 of the NME-induced metastatic cancer cells formed tumors in mice. In addition, mice that were injected throughout the test period with human NME7-AB, NME1, or NME7-X1 developed remote metastases.
  • T47D human breast cancer cells were cultured in standard RPMI media for 14 days with media changes every 48 hours and passed by trypsinization when approximately 75% confluent.
  • the cells were then plated into 6-well plates and cultured in minimal stem cell media (see Example 1) that was supplemented with 4 nM NME7-AB.
  • Media was changed every 48 hours.
  • some cells become detached from the surface and float.
  • Media is carefully changed so as to retain the “floaters” as these are the cells that have the highest metastatic potential as evidence by RT-PCR measurement of metastatic markers.
  • the floaters are harvested and counted. Samples are retained for RT-PCR measurement.
  • the key marker measured is CXCR4, which is up-regulated by 40-200-times after being briefly cultured in NME7-AB.
  • the freshly harvested floater metastatic cells were xenografted into the flank of female nu/nu athymic mice that have been implanted with 90-day slow release estrogen pellets.
  • Floater cells were xenografted with 10,000, 1,000, 100 or 50 cells each.
  • Half of the mice in each group of 6 were also injected daily with 32 nM NME7-AB near the original implantation site.
  • the parent T47D cells that were cultured in RPMI media without NME7-AB were also implanted into mice at 6 million, 10,000 or 100 as controls. Mice implanted with the NME7-induced floater cells developed tumors even when as few as 50 cells were implanted.
  • mice that were implanted with the floater cells and that received daily injections of NME7-AB also developed remote tumors or remote metastases in various organs ( FIG. 20-25 ).
  • 11 out of the 12 mice, or 92%, that were injected with human NME7-AB after implantation of the NME7-AB cultured cancer cells developed tumors at the injection site. Only 7 out of the 12 mice, or 58%, that were not injected with human NME7-AB after implantation developed tumors.
  • 9 out of the 11 mice, or 82%, that exhibited tumors and were injected with human NME7-AB developed multiple tumors remote from the injection site. None of the mice that were not injected with NME7-AB developed multiple, visible tumors.
  • mice injected with NME7-AB were indeed human breast tumors. Similar analysis of their organs showed that in addition to remote bumps, mice had randomly metastasized to the liver and lung with human breast cancer characteristic of the human breast cancer cells that were implanted. As expected, only the mice implanted with 6 million cells grew tumors.
  • NME7-AB human recombinant NME7-AB is comparable in size and sequence to NME7-X1 and to a 30-33 kDa NME7 cleavage product.
  • NME7-AB promotes cancerous growth and causes cancer cells to accelerate to the highly metastatic cancer stem cell (CSC) state also called tumor initiating cells (TIC). Therefore, we conclude that NME7-X1 and an NME7 cleavage product that removes the DM10 domain also promote cancerous growth and causes cancer cells to accelerate to the highly metastatic cancer stem cell (CSC) state also called tumor initiating cells (TIC).
  • CSC highly metastatic cancer stem cell
  • TIC tumor initiating cells
  • NME7-AB was added to cancer cells in a serum-free media and in the absence of any other growth factors or cytokines.
  • T47D breast cancer cells were cultured in either standard RPMI media or in a Minimal Stem Cell Media (Example 1) to which was added recombinant NME7-AB to a final concentration of 16 nM. After 10 days cells were collected and analyzed by RT-PCR for expression of molecular markers of CSCs which were elevated by 10-200-times ( FIGS. 11, 12 ). This is a specific, detailed example of how we transformed one cancer cell type to a more metastatic state.
  • Metastasis marker CXCR4 is particularly elevated in metastatic breast cancer cells, while CHD1 is particularly elevated in metastatic prostate cancer.
  • pluripotent stem cell markers such as OCT4, SOX2, NANOG, KLF2/4 and TBX3 are also up-regulated when cancer cells transform to more metastatic cells.
  • DU145 prostate cancer cells were cultured similarly and those cells cultured in NME7-AB also showed dramatic increases in expression of CSC markers ( FIG. 13 ).
  • CHD1 aka E-cadherin
  • CXCR4 were up-regulated compared to the control cancer cells, which were not grown in NME7-AB, along with other pluripotent stem cell markers.
  • Ovarian cancer cells, pancreatic cancer cells and melanoma cells were also cultured in NME7-AB and were transformed to a more metastatic state after as few as 3 days in culture.
  • 37A-C shows that ovarian cancer cell lines SK-OV3, OV-90 and breast cancer cell line MDA-MB all transitioned from adherent to non-adherent floater cells and increased expression of metastatic markers after 72 or 144 hours in culture with NME7-AB.
  • NME7-AB transforms a wide range of cancer cells to a more metastatic state.
  • cancer cells express a naturally occurring species that is approximately the same molecular weight as recombinant NME7-AB 33 kDa ( FIGS. 33-36 and FIG. 38 ) and is also devoid of the DM10 domain ( FIG. 10 ) like NME7-AB and also express an alternative isoform NME7-X1 30 kDa which is the same sequence as NME7-AB except is missing 33 amino acids from the N-terminus.
  • a co-immunoprecipitation experiment was performed on T47D breast cancer cells, wherein the cell extracts were incubated with an antibody against the MUC1 cytoplasmic tail, Ab-5, or a control antibody, IgG, and co-immunoprecipitated.
  • the immunoprecipitated species were separated by gel electrophoresis.
  • the gels were blotted with two different commercially available anti-NME7 antibodies. Both gels show unique NME7 bands at ⁇ 33 kDa and ⁇ 30 kDa ( FIG. 39 A,B).
  • the gels were stripped and re-probed with an antibody against the extracellular domain of MUC1*, anti-PSMGFR ( FIG.
  • FIGS. 40A-C show photographs of Western blots of a co-immunoprecipitation experiment.
  • Human induced pluripotent stem, iPS7, or embryonic stem, HES3, cell extracts were incubated with an antibody against the MUC1 cytoplasmic tail, Ab-5, or a control antibody, IgG, and co-immunoprecipitated.
  • the gel was blotted with a commercially available anti-NME7 antibody B9 (A). Both cell types show unique NME7 bands at ⁇ 33 kDa and ⁇ 30 kDa.
  • the gel was stripped and re-probed with an antibody against the extracellular domain of MUC1*, anti-PSMGFR (B), which shows that the NME7 species and MUC1* interact.
  • NME7-AB and a recombinant NME7-X1 that we made were mixed together and run on a gel, then probed with an anti-NME7 antibody, showing that the two unique NME7 species that are naturally occurring in breast cancer cells and that interact with MUC1* are an NME7-AB-like species and NME7-X1 (C).
  • NME7-AB is a recombinant protein, we do not know if the naturally occurring species may contain an extra 1-15 additional amino acids or devoid of 1-15 additional amino acids than the recombinant NME7-AB, yet run with the same apparent molecular weight.
  • NME7-AB-like we mean an NME7 species that runs with an apparent molecular weight of approximately 33 kDa that is able to function the way the recombinant NME7-AB does, in that it is able to stimulate cancer cell growth, induce transition of cancer cells to a more metastatic state and is able to fully support pluripotent growth of human stem cells.
  • cancer cell lines and cancer cell populations that express NME7 and lower molecular weight NME7 species contain some cancer cells that are CSCs or metastatic cancer cells. These cancers can be made more metastatic or increase the population of cells that are metastatic by culturing the cells in NME7-AB, NME7-X1 or lower molecular weight NME7 species.
  • FIG. 35 shows a Western blot of a panel of cancer cells all expressing NME7 as well as lower molecular weight species NME7-AB-like at 33 kDa and NME7-X1 at 30 kDa.
  • FIG. 35 shows a Western blot of a panel of cancer cells all expressing NME7 as well as lower molecular weight species NME7-AB-like at 33 kDa and NME7-X1 at 30 kDa.
  • FIG. 38 shows that cancer cell lines T47D breast cancer, PC3 and DU145 prostate cancer, BT-474 breast cancer, CHL-1 and A2058 both melanoma cell lines and CAPAN-2 and PANC-1 both pancreatic cell lines all express MUC1, MUC1* and NME7-AB-like species and NME7-X1.
  • BT0474 cells appear not to express MUC1 or MUC1* however, we previously showed (Fessler et al 2009) that when these HER2 positive breast cancer cells become resistant to chemotherapy drugs, i.e. metastatic, they do so by increasing expression of MUC1* ( FIG. 38 D).
  • These cancer types and other cancer types that express NME7 and lower molecular weight NME7 species such as 33 kDa, 30 kDa can be made more metastatic or increase the population of cells that are metastatic by culturing the cells in NME7-AB, NME7-X1 or lower molecular weight NME7 species.
  • NME7 and lower molecular weight NME7 species such as 33 kDa or 30 kDa
  • Anti-NME7 antibodies or antibodies that bind to NME7-AB or NME7-X1 are administered to a patient for the treatment or prevention of cancers including breast, prostate, ovarian, pancreatic and liver cancers.
  • anti-NME7 antibodies will be effective against any MUC1*-positive cancers, which include but are not limited to breast, lung, liver, pancreatic, gastric colorectal, prostate, brain, melanoma, kidney and others.
  • Anti-NME7, anti-NME7-AB or anti-NME7-X1 antibodies are administered to patients for the treatment or prevention of cancers that are NME7-AB, NME7-AB-like, or NME7-X1 positive or a MUC1* positive.
  • NME7-AB, NME7-X1 as well as 2i and other reagents that revert stem cells to a more na ⁇ ve state also induce cancer cells to transform to a more metastatic state.
  • cancer cells After treatment with any one or combination of these reagents, cancer cells have a higher engraftment rate and require up to 100,000-times less cells to cause a tumor to form in a test animal. Therefore, methods described in this disclosure can be used to enable xenografting of a patient's primary tumor cells into a test animal.
  • a method of identifying effective therapeutics for a particular patient or a particular type of cancer comprises the steps of: 1) cancer cells are obtained from a cell line, a patient or a patient to whom the therapeutic being tested will be administered; 2) cancer cells are cultured in NME7-AB, NME7-X1, human NME1, bacterial NME1 that has high homology to human NME1 or NME7, 2i, or other reagents shown to revert stem cells to a more na ⁇ ve state; 3) resultant cancer cells are implanted into a test animal to which human NME7-AB, NME7-X, human NME1, bacterial NME1 that has high homology to human NME1 or NME7, 2i, or other reagents shown to revert stem cells to a more na ⁇ ve state may also be administered or animal is transgenic for
  • Anti-NME7 antibodies are potent anti-cancer agents.
  • NME7 is a growth factor that promotes the growth of cancer cells and also promotes their progression to a more metastatic state or a more aggressive state.
  • NME7 and a truncated form of NME7 that is ⁇ 33 kDa or 30 kDa have been shown to fully support cancer growth even in serum-free media devoid of any other growth factors or cytokines.
  • pull-down assays, ELISAs and nanoparticle binding experiments we have shown that the growth factor receptor MUC1* is a binding partner of NME7 and NME7-AB. Promotion of this interaction by eliminating all other growth factors or cytokines increased expression of cancer stem cell markers.
  • anti-NME7 or anti-NME7-AB antibodies are potent anti-cancer agents that can be administered to a patient for the treatment or prevention of cancers. More than 75% of all cancers are MUC1* positive.
  • MUC1* is the transmembrane cleavage product of MUC1 wherein most of the extracellular domain has been shed, leaving a portion of the extracellular domain that contains most of the PSMGFR sequence and may contain 9-20 additional amino acids N-terminal to the boundary of the of the PSMGFR sequence.
  • One aspect of the invention is a method of treating or preventing cancer in a subject, comprising administering to the subject an effective amount of an anti-NME7 antibody.
  • the anti-NME7 antibody is able to bind to NME7-AB.
  • the anti-NME7 antibody is able to bind to NME7-X1.
  • the anti-NME7 antibody that is administered to a patient inhibits or prevents its binding to its target in the promotion of cancers.
  • the target is the extracellular domain of a cleaved MUC1. More specifically, the NME7 target that promotes cancer is the PSMGFR region of the MUC1* extracellular domain.
  • an effective therapeutic agent is one that disrupts or prevents the interaction between an NME7 species and MUC1* extracellular domain, consisting primarily of the PSMGFR portion of MUC1* or the PSMGFR peptide.
  • Agents for the treatment or prevention of cancers are those agents that directly or indirectly inhibit the expression or function of NME7, an NME7-AB-like cleavage product or alternative isoform, including NME7-X1.
  • an effective anti-cancer therapeutic agent is one that binds to the NME7 species or disables its tumorigenic activity.
  • an effective therapeutic agent for the treatment or prevention of cancers is an agent that binds to or disables NME7, an NME7-AB-like cleavage product or alternative isoform, or NME7-X1.
  • the therapeutic agents that binds to the NME7 species is an antibody.
  • the antibody may be polyclonal, monoclonal, bispecific, bivalent, monovalent, single chain, scFv, or an antibody mimic that may be animal in origin, human-animal chimera, humanized or human.
  • the antibody can be generated by inoculation or immunization with an NME7 species or fragment thereof or selected, for example from a library or a pool of antibodies, for their ability to bind to an NME7 species, including NME7, an NME7-AB-like cleavage product or alternative isoform, including NME7-X1.
  • Anti-NME7 antibodies can be generated outside of the patient such as in a host animal or in a patient.
  • Antibodies can be generated by immunization of NME7 or NME7 fragments or selected from a library or pool of antibodies that may be natural, synthetic, whole or antibody fragments based on their ability to bind to desired NME7 species such as NME7-AB or NME7-X1.
  • the antibody is generated from immunization with, or selected for its ability to bind to, a peptide selected from those listed in FIGS. 16-19 .
  • the antibody is generated from peptides whose sequences are not identical to those of human NME1 or the antibodies are selected for their ability to bind to NME7 species and their inability to bind to human NME1.
  • NME7 or NME7-X1 derived peptides that give rise to antibodies that inhibit cancer growth and inhibit transition to metastasis or peptides that are themselves inhibitory is as follows: 1) protein sequences of human NME1, human NME7, human NME7-X1 and several bacterial or fungal NME proteins that have high sequence homology to either human NME1 or human NME7 are aligned; 2) regions of high sequence homology among all the NMEs are identified; 3) peptide sequences that are unique to NME7 or NME7-X1 but are flanking the regions of high sequence homology are identified. The peptides are then synthesized and used to generate antibodies in a human or host animal. The resultant antibodies are tested for their ability to inhibit cancer growth or inhibit the transition to metastatic cancer cells.
  • Those antibodies that inhibit cancer growth or transition to a more metastatic state are selected for use as anti-cancer therapeutics and may be administered to a patient for the treatment or prevention of cancers.
  • Selected antibodies may be further optimized for example by engineering or making human chimera antibodies or fully human antibodies.
  • NME7 peptides from regions of NME7 suspected to be critical to its cancerous function. We then generated antibodies using these peptides and then tested both the resultant antibodies as well as the immunizing peptides for their ability to: a) inhibit cancerous growth; and b) inhibit the induced transition from cancer cells to metastatic cancer cells.
  • NME7 peptides were selected as immunizing agents for antibody production and as inhibitory agents themselves ( FIG.
  • Peptides A1 (SEQ ID NO:141), A2 (SEQ ID NO:142), B1 (SEQ ID NO:143), B2 (SEQ ID NO:144) and B3 (SEQ ID NO:145), wherein A refers to the domain from which the peptide is derived, i.e. the NDPK A domain and the B denotes that the peptide is derived from the NDPK B domain ( FIG. 15 ).
  • A refers to the domain from which the peptide is derived, i.e. the NDPK A domain
  • the B denotes that the peptide is derived from the NDPK B domain ( FIG. 15 ).
  • Each peptide was used as an immunogen and injected into 2 rabbits each for production of polyclonal antibodies.
  • the antibodies that were harvested from the blood of the immunized rabbits were purified over a column derivatized with the immunizing peptide.
  • the purified antibodies were then tested for their ability to bind to human NME7. All of the resultant antibodies bound to human NME7 but not human NME1 as desired ( FIG. 26A-B , Example 12). These results show that by choosing peptides whose sequence is found in NME7 but not exactly identical in NME1, antibodies are generated that specifically bind to NME7 but not NME1. Because NME1 has healthy function, it is in most cases desirable to generate antibodies that do not interfere with NME1. The antibodies were also tested for their ability to inhibit the binding of NME7 to a MUC1* extracellular domain peptide. The ELISA experiment shown in FIG. 27 shows that the antibodies inhibited the binding of NME7-AB to a MUC1* extracellular domain peptide much more than they inhibited binding of NME1.
  • Antibodies generated from peptides A1, A2, B1, B2 and B3 were shown to inhibit cancer growth and inhibited the transition to a more metastatic state. Monoclonal antibodies generated by immunization with the same or similar peptides and subsequent testing of the monoclonals will identify antibodies that, after humanizing or other engineering known to those skilled in the art, would be administered to a patient for the treatment or prevention of cancers.
  • the antibodies as well as the immunizing peptides inhibited cancer cells growth (see FIG. 28 for one example).
  • the antibodies as well as the immunizing peptides robustly inhibited cancer cell growth ( FIG. 29 ).
  • the corresponding human NME7 amino acid numbers of immunizing peptides A1, A2, B1, B2 and B3 are 127-142, 181-191, 263-282, 287-301, 343-371, respectively, from human full-length NME7 having SEQ ID NO:82 or 147.
  • residue numbers of NME7 are discussed, they refer to the residue numbers of NME7 as set forth in SEQ ID NO:82 or 147.
  • the antibody used in the cancer growth inhibition experiments shown in FIG. 6-8 and one of the antibodies shown in FIG. 28 was generated by immunizing with NME7 peptide corresponding to amino acids 100-376 of NME7 (SEQ ID NO:82 or 147).
  • NME7 peptide corresponding to amino acids 100-376 of NME7 SEQ ID NO:82 or 147.
  • To generate higher affinity and specific anti-NME7 antibodies the following steps are followed: immunize animal with a peptide containing human NME7 amino acids 100-376, then: 1) de-select those antibodies that bind to human NME1; 2) select those antibodies that inhibit NME7-AB, 2i, or other NME induced transition of cancer cells to a more metastatic state; 3) select those antibodies that inhibit the growth of cancer cells; 4) select those antibodies that inhibit the growth of MUC1* positive cancer cells; 5) select those antibodies that inhibit binding of NME7-AB or NME7-X1 to MUC1* extracellular domain, essentially inhibit binding to the PSMG
  • Anti-NME7 Antibodies Inhibit the Transition of Cancer Cells to Metastatic Cancer Cells.
  • Anti-NME7 antibodies inhibit transition of cancer cells to metastatic cancer cells also called cancer stem cells (CSCs) or tumor initiating cells (TICs). Recall that we have demonstrated that culturing a wide variety of cancer cells in the presence of NME7-AB causes them to transition from regular cancer cells to the metastatic CSCs or TICs. Thus, antibodies that bind to NME7, NME7-AB or NME7-X1 will inhibit the progression of cancer cells to a more metastatic state.
  • CSCs cancer stem cells
  • TICs tumor initiating cells
  • NME7-AB human NME1 dimers, bacterial NME1 dimers or MEK and GSK3-beta inhibitors, called “2i”
  • 2i GSK3-beta inhibitors
  • RT-PCR measurement of specific metastatic markers such as CXCR4 for breast cancers, CHD1 for prostate cancer, and other pluripotent stem cell markers such as OCT4, SOX2, NANOG, KLF4 and others were dramatically over-expressed in cancer cells that were cultured in NME7-AB and most over-expressed in the cells that became non-adherent, called “floaters” here and in figures.
  • NME7-AB specific antibodies generated by immunization with NME7-derived peptides A1, A2, B1, B2 and B3, as well as the immunizing peptides themselves, were added into the media along with either NME7-AB or 2i to determine if they inhibited the transformation of regular cancer cells to metastatic cancer stem cells.
  • Antibodies and peptides were separately added along with the agent that causes metastatic transformation; in this case NME7-AB or the 2i inhibitors PD0325901 and CHIR99021.
  • NME7-AB and 2i were separately used to induce the cancer cells to be transformed to a more aggressive metastatic state. 2i was used so that it could not be argued that the antibodies that were added to the media simply sopped up all of the NME7-AB so that the causative agent effectively was not there (Example 14).
  • therapeutic agents for the treatment or prevention of cancers are peptides derived from the NME7 sequence, which are administered to a patient for the treatment or prevention of cancers.
  • the NME7-derived peptides are administered to a patient so that the peptides, which should be shorter than the entire NME7 and unable to confer the oncogenic activity of NME7, bind to the targets of NME7 and competitively inhibit the interaction of intact NME7 with its targets, wherein such interactions promote cancer.
  • NME7-AB Since NME7-AB is fully able to confer oncogenic activity, the sequence of NME7-AB is preferred as the source for the shorter peptide(s), wherein it must be confirmed that the peptides themselves are not able to promote cancerous growth or other tumorigenic or oncogenic activity.
  • one or more peptides having the sequence of a portion of NME7-AB and being preferably about 12-56 amino acids in length are administered to a patient.
  • the peptides may be peptide mimics, such as peptides with unnatural backbone or D-form amino acids for L.
  • the anti-cancer therapeutic agent is a peptide or peptide mimic wherein the peptide has a sequence highly homologous to at least a portion of NME7, NME7-AB, or NME7-X1 or its target the MUC1* extracellular domain, comprising the PSMGFR peptide, also called “FLR” in some cases herein.
  • FIGS. 16-19 provide a listing of preferred amino acid sequences that are predicted to inhibit NME7 binding to its cognate target.
  • the peptides that are chosen for administration to a patient suffering from cancer or at risk of developing cancer are chosen because they bind to an NME7 binding partner and they do not themselves confer tumorigenic activity.
  • the NME7 binding partner is the extracellular domain of MUC1*.
  • the NME7 binding partner is the PSMGFR peptide.
  • conferring tumorigenic activity or oncogenic activity it is meant that the peptides themselves cannot support or promote the growth of cancers.
  • Another way of testing whether or not a peptide or peptides derived from NME7 can promote tumorigenesis is to test whether or not the peptides can support pluripotent growth of human stem cells. NME proteins and peptides that support pluripotent human stem cell growth also support cancer growth. In yet another method, peptides are de-selected if they can cause somatic cells to revert to a less mature state.
  • NME7-AB Fragments of NME7-AB inhibit cancer cell growth and the transition of cancer cells to a more metastatic state.
  • the peptides are chosen from the list shown in FIG. 16 . In one aspect of the invention the peptides are chosen from the list shown in FIG. 17 . In one aspect of the invention the peptides are chosen from the list shown in FIG. 18 . In yet another aspect of the invention the peptides are chosen from the list shown in FIG. 19 .
  • Anti-NME7 antibodies for use in the treatment or prevention of cancers can be generated by standard methods known to those skilled in the art wherein those methods are used to generate antibodies or antibody-like molecules that recognize NME7, NME7-AB or a shorter form of NME7-AB wherein an additional 10-25 amino acids form the N-terminus are not present.
  • small molecules are anti-cancer agents that are selected for their ability to inhibit the tumorigenic effects of NME7, NME7-AB or NME7-X1.
  • a high throughput screen identifies small molecules that will treat cancer.
  • small molecules are separately added to wells in which cancer cells are cultured in a medium containing NME7-AB. If the small molecule diminishes the amount of cells that become floaters and/or reduces the expression of metastatic markers such as CXCR4, CHD1 or pluripotent stem cell markers, then that small molecule is an anti-cancer drug candidate.
  • Another method of identifying small molecules that are anti-cancer agents is to select those small molecules that bind to NME7, NME7-AB or NME7-X1 or suppresses expression of the NME7 species. Yet another high throughput screen is to select for small molecules that inhibit the binding of NME7-AB to the PSMGFR peptide of the MUC1* extracellular domain and those small molecules will be anti-cancer agents.
  • NME7-AB and NME7-X1 differ only in that NME7-X1 is missing some of the N-terminal sequence that NME7-AB has.
  • NME7-AB-like species there is a naturally occurring NME7 species that is nearly identical to NME7-AB, which we call NME-AB-like species.
  • Antibodies that bind to NME7-X1 may also bind to the naturally occurring species that mimics NME7-AB, unless there are conformational differences that an antibody can differentiate. Therefore, if it is desired to inhibit NME7-X1 but not NME7-AB-like species, or vice versa, siRNA, anti-sense nucleic acids, or genetic editing techniques can be used to inhibit expression of one but not the other.
  • the anti-cancer therapeutic agent is a nucleic acid that directly or indirectly suppresses specific expression of NME7, NME7-X1 or NME7-AB-like species.
  • nucleic acids can be siRNA, RNAi, anti-sense nucleic acids and the like that directly suppress the NME7 species.
  • the nucleic acid can indirectly suppress the NME7 species for example by altering the expression of a molecule that regulates it.
  • the super enhancer BRD4 suppresses expression of NME7. Therefore, an effective therapeutic for the treatment or prevention of cancer is an agent that increases expression of BRD4.
  • An effective therapeutic may be an agent that increases expression of BRD4′s co-factor, JMJD6.
  • NME7-AB or NME7-X1 Peptides derived from NME7-AB or NME7-X1, or the entire protein, are used to generate anti-NME7 or anti-NME7-X1 antibodies in animals that we have demonstrated inhibit cancer growth and inhibit transition of cancer cells to metastatic cancer cells.
  • NME7 derived peptides can be administered to a human such that they generate antibodies that treat or prevent cancer or inhibit transition of cancer cells to metastatic cancer cells.
  • NME7 peptides or proteins are administered to a person as a type of vaccine to stimulate the production of anti-NME7, anti-NME7-AB or anti-NME7-X1 antibodies in the recipient. The results shown in FIGS.
  • immunizing a person with a collection of peptides derived from NME7, especially in the NME7-X1 or NME7-AB sequences may be a more effective vaccine than immunizing with a single peptide.
  • Said peptides or proteins may further be conjugated to a carrier protein or other adjuvant, known to those skilled in the art to aid in the stimulation of an immune response.
  • NME7 peptides that lie outside of the DM10 domain are preferred to generate antibodies for the treatment or prevention of cancer.
  • Peptides that can be administered to a patient for the prevention of cancer or metastasis contain sequences of the peptides listed in FIGS. 16-19 .
  • A1, A2, B1, B2 and B3 are examples of peptides that generate antibodies that bind to NME7-AB and NME7-X1 and are administered to a patient for the treatment or prevention of cancer.
  • the invention is not limited to peptides of the exact sequence as is naturally occurring in NME7 or NME7-X1. As is known to those skilled in the art, substitution of several amino acids of a peptide sequence can still give rise to antibodies that specifically recognize the natural protein sequence.
  • the invention be limited to the peptides demonstrated herein to inhibit cancer growth or inhibit the transition of regular cancer cells to metastatic cancer cells.
  • the methods used here to identify peptides A1, A2, B1, B2 and B3 can also be used to identify other peptide sequences that could be equally or more effective than the peptides demonstrated here.
  • Chimeric Antigen Receptor Molecules Comprising Portions of Human NME7-AB or NME7-X1 or Comprising an Antibody Fragment that Binds to NME7-AB or NME7-X1 are Anti-Cancer Therapeutics and are Administered to a Patient for the Treatment or Prevention of Cancers.
  • the recognition units or variable regions of anti-NME7 antibodies are fused to molecules of T cells using the technology known as CAR (chimeric antigen receptor) technology or CAR T technology.
  • CAR chimeric antigen receptor
  • the salient feature of antibodies or fragments thereof that can be used therapeutically to treat or prevent cancers is the identification of antibody-like variable regions that recognize NME7 and prevent its interaction with targets that promote cancers.
  • the target is the PSMGFR region of MUC1*.
  • Antibodies, antibody fragments or single chain antibodies can be engineered into chimeric molecules, including chimeric antigen receptors, also known as CARs, which molecules are then transfected or transduced into an immune system cell, such as a T cell, and administered to a patient.
  • CARs chimeric antigen receptors
  • the humanized antibodies or antibody fragments, typically an scFv comprises much of the extracellular domain of a CAR.
  • the antibody fragment is biochemically fused to immune system signaling molecules, such as CD8 as the transmembrane domain and cytoplasmic signaling motifs such as T cell receptor signaling molecules also called activation domains, or co-stimulatory domains including but not limited to CD3-zeta, CD28, 41bb, OX40.
  • CARs can be transfected into T cells or other cells, preferably immune system cells and administered to a patient.
  • the extracellular portion contains an anti-NME7, anti-NME7-AB or anti-NME7-X1 antibody, antibody fragment or single chain, scFv antibody fragment.
  • the antibody or antibody fragment is human or humanized
  • Effective anti-NME7 or anti-NME7-X1 antibodies or fragments will have the ability to bind to native NME7, NME7-AB or NME7-X1.
  • the parent antibody, from which the extracellular domain of the CAR is engineered is generated by immunizing an animal with an NME7, NME7-AB or NME7-X1 derived peptide.
  • the immunizing peptide is comprised of NME7 amino acids 1-376.
  • the immunizing peptide is comprised of NME7 amino acids 92-376.
  • the immunizing peptide is comprised of NME7 amino acids 125-376.
  • the immunizing peptide is made up of sequences listed in FIGS. 16-18 .
  • the immunizing peptide is made up of sequences listed in FIG. 19 .
  • the parent antibody or the antibody fragment is selected from a library or pool of antibodies, which may be natural, synthetic or fragments of either, wherein they are selected for their ability to bind to NME7, NME7-AB or NME7-X1, peptides listed in FIGS. 16-18 , or peptides listed in FIG. 19 .
  • the targeting portion of a CAR need not be an antibody or antibody fragment.
  • a CAR wherein the extracellular domain contains an NME7 fragment.
  • NME7-derived peptide(s) are engineered into a different sort of CAR wherein the targeting portion of the extracellular domain is a protein fragment or peptide rather than an antibody or antibody fragment.
  • the peptide CARs are transfected or transduced into an immune system cell, typically a T cell.
  • the NME7 fragments or NME7 derived peptides are selected for their ability to bind to their cognate binding partners but should not be able to function as intact NME7, NME7-AB or NME7-X1 and confer tumorigenic activity.
  • NME7 fragments or NME7 derived peptides are biochemically fused to immune system signaling molecules, such as CD8 as the transmembrane domain and cytoplasmic signaling motifs such as T cell receptor signaling molecules also called activation domains, or co-stimulatory domains including but not limited to CD3-zeta, CD28, 41bb, OX40.
  • the NME7 fragment is most or all of the NME7 NDPK B domain.
  • the NME7 fragment is an NME7 peptide that contains one or more of the peptide sequences listed in FIGS. 16-19 .
  • CAR chimeric antigen receptor
  • a collection of CARs each bearing a different NME7-AB derived peptide can collectively be transfected or transduced into an immune system cell and administered to a patient for the treatment or prevention of cancers.
  • FIGS. 28 and 29 support the validity of this approach.
  • CARs that contain an NME7 fragment in its extracellular domain are transfected or transduced into an immune system cell, typically a T cell, and administered to a patient for the treatment or prevention of cancers.
  • the cancer is a MUC1*-positive cancer.
  • the cancer is a metastatic cancer.
  • NME7 nucleophilicity factor-associated cleavage products
  • Some forms of NME7 are sequestered within the cell and therefore are not secreted from the cell whereupon they can act as growth factors to promote cancers.
  • Full-length NME7 is 42 kDa.
  • a ⁇ 33 kDa NME7 species that is devoid of the DM10 domain and appears to be essentially identical to the recombinant NME7-AB that we generated, is secreted from cancer cells and stem cells.
  • This ⁇ 33 kDa NME7 species and another ⁇ 25 kDa NME7 species may be cleavage products that would be eliminated by an agent that inhibited cleavage of NME7.
  • NME7-AB-like species which we call NME7-AB-like species, or NME7-X1 in a patient sample is diagnostic of the presence of cancer or its progression to a more aggressive or metastatic state.
  • the inventors have discovered that both early stage, na ⁇ ve stem cells and cancer cells, especially MUC1*-positive cancer cells, express high levels of a ⁇ 33 kDa NME7 that is devoid of the DM10 domain and NME7-X1.
  • NME7-X1 was recently listed in a protein database as being a theoretical alternative isoform of NME7, however, it had never been detected in tissues or cells.
  • the expression levels of human NME7, NME7a, NME7b and NME7-X1 were measured by PCR in a panel of cells that included fibroblast cells, human embryonic stem cells, human iPS cells, T47D human breast cancer cells, DU145 human prostate cancer cells, PC3 human prostate cancer cells, HEK295 human fetal liver cells, and other human stem cell lines.
  • NME7 is expressed at higher levels in cancer cells than in stem cells.
  • NME7-X1 is expressed 10-fold higher in prostate cancer cells and 3-fold higher in breast cancer cells, than it is in fibroblast cells or stem cells.
  • NME7-X1 is expressed ⁇ 5-fold higher in HEK293 fetal liver cells than it is in fibroblast cells or stem cells and therefore predicts that NME7-X1 is elevated in liver cancers.
  • NME7b is expressed 17-25-times higher in prostate cancer cells than in stem cells.
  • Detection of elevated levels of NME7 species in a patient sample will be indicators that the patient has a cancer or is at risk of developing a cancer.
  • Levels of NME7 species levels can be measured or assessed by PCR, hybridization schemes, cycling probe technologies, FISH, immunocytochemistry, IHC, Western blot, immunoprecipitation, sandwich assays, ELISA assays and the like.
  • the patient sample may be a fluid sample, a blood sample, milk, urine, cells, liquid biopsy, biopsy and the like.
  • elevated levels of NME7 species are indicators of increased metastatic potential.
  • Elevated levels of NME7-X1 are indicators of prostate cancer. Antibodies of the invention are used to detect and distinguish NME7 species and are used as a diagnostic tool.
  • an effective way to diagnose cancer or to diagnose a more aggressive or metastatic form, or a shift to a more aggressive form is to measure levels of NME7 in a sample from a patient, from a collection of cells or tissues or from cultured cells, compared to NME7 levels in a healthy sample or compared to levels of NME7 known to exist in healthy adult cells or tissues.
  • Increased levels of NME7 indicate the presence of cancer, the presence of a metastatic cancer or the onset of metastasis.
  • Increased levels of NME7 is also indicative of a MUC1*-positive cancer.
  • the sample assayed for the presence of NME7 may be a collection of cells that may be cultured cell lines or cells from a patient, a bodily fluid, a blood sample, a tissue specimen, or a biopsy specimen. Therefore, a diagnostic assay that will detect the presence of cancer or the progression of cancer, comprises the steps of: 1) obtaining a sample from a patient having cancer or at risk of developing a cancer; 2) subjecting that sample to an assay capable of detecting or measuring levels of NME7, or levels of nucleic acids encoding NME7; 3) comparing levels of the measured NME7 protein or NME7-encoding nucleic acids in the test sample to levels in control patients or control cells; 4) determining that the levels of NME7 or nucleic acids encoding NME7 are elevated compared to the controls; and 5) concluding that the donor of the test sample has cancer or has had a progression of cancer if the control to which the test was compared came from a donor previously diagnosed with a cancer.
  • control sample to which the test sample is compared can be non-cancerous cells, cultured cells, a sample from a healthy donor, a non-cancerous sample from the donor, or a sample from the donor of the test sample wherein the control sample was taken from the donor at a previous point in time.
  • the source of such samples may be any specimen taken from the patient being tested for the presence or progression of cancer, including bodily fluids, cerebrospinal fluid, bone marrow samples, blood, tissues, cells, biopsy tissues or cells, cultured cells derived from a patient's cells and the like.
  • the source of the sample to which the test sample is compared can be bodily fluids, cerebrospinal fluid, bone marrow samples, blood, tissues, cells, biopsy tissues or cells, or cultured cells that may be derived from a healthy donor or the test patient wherein the samples were taken at a previous point in time.
  • the measured levels to which the test sample is compared may be from previously recorded data and compiled into lists for comparison to test samples.
  • NME7 protein or nucleic acids encoding NME7 are then treated with therapeutic agents that suppress expression of NME7, inhibit cleavage of NME7 or inhibit NME7 binding to its targets, wherein such interaction promotes cancers.
  • NME7 binds to and dimerizes the extracellular domain of MUC1*. Therefore, patients diagnosed with elevated levels of NME7 will benefit from treatment with therapeutic agents that inhibit NME7 and/or therapeutic agents that inhibit the dimerization of a cleaved form of MUC1, whose extracellular domain is comprised of some or all of the PSMGFR sequence.
  • assessing suitability of cancer treatments and administration of an effective amount of a therapeutic for the treatment or prevention of cancers would consists of the steps of: 1) obtaining a sample from a patient suspected of having a cancer or at risk of developing a cancer or at risk of developing a metastatic cancer; 2) measuring an amount of NME7 or a cleavage product thereof or an NME7 encoding nucleic acid wherein the measured levels are significantly above those measured in a control sample; 3) determining that the patient has a cancer or has developed a more aggressive or a metastatic cancer; 4) administering to the patient an effective amount of a therapeutic agent that suppresses expression of NME7, inhibits cleavage of NME7 or inhibits NME7 binding to its targets and/or administering to the patient an effective amount of a therapeutic agent that suppresses expression of MUC1, inhibits cleavage of MUC1 to MUC1* or inhibits MUC1* binding to its targets.
  • the therapeutic agent that inhibits NME7 binding to its targets inhibits its interaction with MUC1*. In a more preferred embodiments, it inhibits its interaction with the extracellular domain of MUC1* comprised essentially of the PSMGFR sequence. In a preferred embodiment, the therapeutic agent that inhibits MUC1* binding to its targets, inhibits the interaction between MUC1* and NME7. In a more preferred embodiment, the therapeutic agent that inhibits the interaction between MUC1* and NME7 inhibits the binding of MUC1* to the portion of NME7 that is comprised essentially of the sequence of NME7-AB.
  • Polypeptide or antibody therapeutics may suffer from short circulating half-life, and proteolytic degradation and low solubility.
  • methods such as manipulation of the amino acid sequence may be made to decrease or increase immunogenicity and decrease proteolytic cleavage; fusion or conjugation of the peptides to immunoglobulins and serum proteins, such as albumin may be made; incorporation into drug delivery vehicles for the biopharmaceuticals such as the inventive peptides and antibodies for protection and slow release may also be made; and conjugating to natural or synthetic polymers are also contemplated.
  • pegylation or acylation such as N-acylation, S-acylation and so forth are also contemplated.
  • an expression vector comprising a nucleic acid molecule of the invention as described herein, wherein the nucleic acid molecule is operatively linked to an expression control sequence.
  • a host-vector system for the production of a polypeptide which comprises the expression vector of the invention which has been introduced into a host cell suitable for expression of the polypeptide.
  • the suitable host cell may be a bacterial cell such as E. coli, a yeast cell, such as Pichia pastoris, an insect cell, such as Spodoptera frugiperda, or a mammalian cell, such as a COS, HEK or CHO cell.
  • the present invention also provides for methods of producing the polypeptides of the invention by growing cells of the host-vector system described herein, under conditions permitting production of the polypeptide and recovering the polypeptide so produced.
  • the polypeptides useful for practicing the present invention may be prepared by expression in a prokaryotic or eukaryotic expression system.
  • the recombinant gene may be expressed and the polypeptide purified utilizing any number of methods.
  • the gene may be subcloned into a bacterial expression vector, such as for example, but not by way of limitation, pZErO.
  • the polypeptides may be purified by any technique which allows for the subsequent formation of a stable, biologically active protein.
  • the factors may be recovered from cells either as soluble proteins or as inclusion bodies, from which they may be extracted quantitatively by 8M guanidinium hydrochloride and dialysis.
  • any number of purification methods may be used, including but not limited to conventional ion exchange chromatography, affinity chromatography, different sugar chromatography, hydrophobic interaction chromatography, reverse phase chromatography or gel filtration.
  • polypeptide When used herein, polypeptide includes functionally equivalent molecules in which amino acid residues are substituted for residues within the sequence resulting in a silent or conservative change.
  • one or more amino acid residues within the sequence can be substituted by another amino acid of a similar polarity, which acts as a functional equivalent, resulting in a silent or conservative alteration.
  • Substitutes for an amino acid within the sequence may be selected from other members of the class to which the amino acid belongs.
  • the nonpolar (hydrophobic) amino acids include alanine, leucine, isoleucine, valine, proline, phenylalanine, tryptophan and methionine.
  • the polar neutral amino acids include glycine, serine, threonine, cysteine, tyrosine, asparagine and glutamine
  • the positively charged (basic) amino acids include arginine, lysine and histidine.
  • the negatively charged (acidic) amino acids include aspartic acid and glutamic acid.
  • the potential glycosylation amino acids include serine, threonine, and asparagine.
  • proteins or fragments or derivatives thereof which exhibit the same or similar biological activity and derivatives which are differentially modified during or after translation, e.g., by glycosylation, proteolytic cleavage, linkage to an antibody molecule or other cellular ligand, etc.
  • any of the methods known to one skilled in the art for the insertion of DNA fragments into a vector may be used to construct expression vectors encoding the polypeptides of the invention using appropriate transcriptional/translational control signals and protein coding sequences. These methods may include in vitro recombinant DNA and synthetic techniques and in vivo recombinations (genetic recombination). Expression of nucleic acid sequence encoding the polypeptides of the invention may be regulated by a second nucleic acid sequence so that the polypeptide is expressed in a host transformed with the recombinant DNA molecule. For example, expression of the polypeptides described herein may be controlled by any promoter/enhancer element known in the art.
  • Promoters which may be used to control expression of the polypeptide include, but are not limited to the long terminal repeat as described in Squinto et al., (1991, Cell 65:1-20); the SV40 early promoter region (Bernoist and Chambon, 1981, Nature 290:304-310), the CMV promoter, the M-MuLV 5′ terminal repeat the promoter contained in the 3′long terminal repeat of Rous sarcoma virus (Yamamoto, et al., 1980, Cell 22:787-797), the herpes thymidine kinase promoter (Wagner et al., 1981, Proc. Natl. Acad. Sci. U.S.A.
  • prokaryotic expression vectors such as the ⁇ -lactamase promoter (Villa-Kamaroff, et al., 1978, Proc. Natl. Acad. Sci. U.S.A. 75:3727-3731), or the tac promoter (DeBoer, et al., 1983, Proc. Natl. Acad. Sci. U.S.A.
  • mouse mammary tumor virus control region which is active in testicular, breast, lymphoid and mast cells (Leder et al., 1986, Cell 45:485-495), Sendai virus, lenti virus, albumin gene control region which is active in liver (Pinkert et al., 1987, Genes and Devel. 1:268-276), alpha-fetoprotein gene control region which is active in liver (Krumlauf et al., 1985, Mol. Cell. Biol. 5:1639-1648; Hammer et al., 1987, Science 235:53-58); alpha 1-antitrypsin gene control region which is active in the liver (Kelsey et al., 1987, Genes and Devel.
  • beta-globin gene control region which is active in myeloid cells (Mogram et al., 1985, Nature 315:338-340; Kollias et al., 1986, Cell 46:89-94); myelin basic protein gene control region which is active in oligodendrocyte cells in the brain (Readhead et al., 1987, Cell 48:703-712); myosin light chain-2 gene control region which is active in skeletal muscle (Shani, 1985, Nature 314:283-286), and gonadotropic releasing hormone gene control region which is active in the hypothalamus (Mason et al., 1986, Science 234:1372-1378).
  • expression vectors capable of being replicated in a bacterial or eukaryotic host comprising nucleic acids encoding a polypeptide as described herein, are used to transfect the host and thereby direct expression of such nucleic acid to produce polypeptides which may then be recovered in biologically active form.
  • a biologically active form includes a form capable of binding to the relevant receptor and causing a differentiated function and/or influencing the phenotype of the cell expressing the receptor.
  • Expression vectors containing the nucleic acid inserts can be identified by without limitation, at least three general approaches: (a) DNA-DNA hybridization, (b) presence or absence of “marker” gene functions, and (c) expression of inserted sequences.
  • the presence of foreign nucleic acids inserted in an expression vector can be detected by DNA-DNA hybridization using probes comprising sequences that are homologous to an inserted nucleic acid sequences.
  • the recombinant vector/host system can be identified and selected based upon the presence or absence of certain “marker” gene functions (e.g., thymidine kinase activity, resistance to antibiotics, transformation phenotype, occlusion body formation in baculovirus, etc.) caused by the insertion of foreign nucleic acid sequences in the vector. For example, if an efl nucleic acid sequence is inserted within the marker gene sequence of the vector, recombinants containing the insert can be identified by the absence of the marker gene function.
  • recombinant expression vectors can be identified by assaying the foreign nucleic acid product expressed by the recombinant constructs.
  • Such assays can be based, for example, on the physical or functional properties of the nucleic acid product of interest, for example, by binding of a ligand to a receptor or portion thereof which may be tagged with, for example, a detectable antibody or portion thereof or binding to antibodies produced against the protein of interest or a portion thereof.
  • polypeptide in particular modified of the present invention, may be expressed in the host cells transiently, constitutively or permanently.
  • compositions for use according to the invention include the polypeptides described above in a pharmacologically acceptable liquid, solid or semi-solid carrier, linked to a carrier or targeting molecule (e.g., antibody, hormone, growth factor, etc.) and/or incorporated into liposomes, microcapsules, and controlled release preparation prior to administration in vivo.
  • a carrier or targeting molecule e.g., antibody, hormone, growth factor, etc.
  • the pharmaceutical composition may comprise a polypeptide in an aqueous solution, such as sterile water, saline, phosphate buffer or dextrose solution.
  • the active agents may be comprised in a solid (e.g. wax) or semi-solid (e.g. gelatinous) formulation that may be implanted into a patient in need of such treatment.
  • the administration route may be any mode of administration known in the art, including but not limited to intravenously, intrathecally, subcutaneously, intrauterinely, by injection into involved tissue, intraarterially, intranasally, orally, or via an implanted device.
  • Administration may result in the distribution of the active agent of the invention throughout the body or in a localized area.
  • intravenous or intrathecal administration of agent may be desirable.
  • an implant containing active agent may be placed in or near the lesioned area.
  • Suitable implants include, but are not limited to, gelfoam, wax, spray, or microparticle-based implants.
  • compositions comprising the polypeptides described herein, in a pharmacologically acceptable vehicle.
  • the compositions may be administered systemically or locally. Any appropriate mode of administration known in the art may be used, incuding, but not limited to, intravenous, intrathecal, intraarterial, intranasal, oral, subcutaneous, intraperitoneal, or by local injection or surgical implant. Sustained release formulations are also provided for.
  • Gene therapy refers to therapy performed by the administration to a subject of an expressed or expressible nucleic acid.
  • the nucleic acids produce their encoded protein that mediates a therapeutic effect.
  • Delivery of the nucleic acids into a patient may be either direct, in which case the patient is directly exposed to the nucleic acid or nucleic acid-carrying vectors, or indirect, in which case, cells are first transformed with the nucleic acids in vitro, then transplanted into the patient. These two approaches are known, respectively, as in vivo or ex vivo gene therapy.
  • the nucleic acid sequences are directly administered in vivo, where it is expressed to produce the encoded product.
  • This can be accomplished by any of numerous methods known in the art, e.g., by constructing them as part of an appropriate nucleic acid expression vector and administering it so that they become intracellular, e.g., by infection using defective or attenuated retrovirals or other viral vectors, or by direct injection of naked DNA, or coating with lipids or cell-surface receptors or transfecting agents, encapsulation in liposomes, microparticles, or microcapsules, or by administering them in linkage to a peptide which is known to enter the nucleus, by administering it in linkage to a ligand subject to receptor-mediated endocytosis (see, e.g., Wu and Wu, J.
  • nucleic acid-ligand complexes can be formed in which the ligand comprises a fusogenic viral peptide to disrupt endosomes, allowing the nucleic acid to avoid lysosomal degradation.
  • the nucleic acid can be targeted in vivo for cell specific uptake and expression, by targeting a specific receptor.
  • the nucleic acid can be introduced intracellularly and incorporated within host cell DNA for expression, by homologous recombination (Koller and Smithies, Proc. Natl. Acad. Sci. USA 86:8932-8935 (1989); Zijlstra et al., Nature 342:435-438 (1989)).
  • viral vectors that contain nucleic acid sequences encoding the polypeptide are used.
  • the nucleic acid sequences encoding the polypeptide to be used in gene therapy are cloned into one or more vectors, which facilitates delivery of the gene into a patient.
  • Lentiviral vectors such as retroviral vectors, and other vectors such as adenoviral vectors and adeno-associated viruses are examples of viral vectors that may be used.
  • Retroviral vectors contain the components necessary for the correct packaging of the viral genome and integration into the host cell DNA.
  • Adenoviruses are especially attractive vehicles for delivering genes to respiratory epithelia because they naturally infect respiratory epithelia where they cause a mild disease.
  • Other targets for adenovirus-based delivery systems are liver, the central nervous system, endothelial cells, and muscle.
  • Adenoviruses have the advantage of being capable of infecting non-dividing cells.
  • adeno-associated virus AAV has also been proposed for use in gene therapy.
  • Another approach to gene therapy involves transferring a gene to cells in tissue culture by such methods as electroporation, lipofection, calcium phosphate mediated transfection, or viral infection.
  • the method of transfer includes the transfer of a selectable marker to the cells. The cells are then placed under selection to isolate those cells that have taken up and are expressing the transferred gene. Those cells are then delivered to a patient.
  • the nucleic acid is introduced into a cell prior to administration in vivo of the resulting recombinant cell.
  • introduction can be carried out by any method known in the art, including but not limited to transfection, electroporation, microinjection, infection with a viral or bacteriophage vector containing the nucleic acid sequences, cell fusion, chromosome-mediated gene transfer, microcell-mediated gene transfer, spheroplast fusion and so on.
  • Numerous techniques are known in the art for the introduction of foreign genes into cells and may be used in accordance with the present invention, provided that the necessary developmental and physiological functions of the recipient cells are not disrupted.
  • the technique should provide for the stable transfer of the nucleic acid to the cell, so that the nucleic acid is expressible by the cell and preferably heritable and expressible by its cell progeny.
  • Cells into which a nucleic acid can be introduced for purposes of gene therapy encompass any desired, available cell type, and include but are not limited to epithelial cells, endothelial cells, keratinocytes, fibroblasts, muscle cells, hepatocytes; blood cells such as T-lymphocytes, B-lymphocytes, monocytes, macrophages, neutrophils, eosinophils, megakaryocytes, granulocytes; various stem or progenitor cells, in particular hematopoietic stem or progenitor cells, e.g., as obtained from bone marrow, umbilical cord blood, peripheral blood, fetal liver, and so on.
  • the cell used for gene therapy is autologous to the patient.
  • nucleic acid sequences encoding the polypeptide are introduced into the cells such that they are expressible by the cells or their progeny, and the recombinant cells are then administered in vivo for therapeutic effect.
  • stem or progenitor cells are used. Any stem and/or progenitor cells which can be isolated and maintained in vitro can potentially be used in accordance with this embodiment of the present invention.
  • the nucleic acid to be introduced for purposes of gene therapy comprises an inducible promoter operably linked to the coding region, such that expression of the nucleic acid is controllable by controlling the presence or absence of the appropriate inducer of transcription.
  • the formulation of therapeutic compounds is generally known in the art and reference can conveniently be made to Remington's Pharmaceutical Sciences, 17th ed., Mack Publishing Co., Easton, Pa., USA. For example, from about 0.05 ng to about 20 mg per kilogram of body weight per day may be administered. Dosage regime may be adjusted to provide the optimum therapeutic response. For example, several divided doses may be administered daily or the dose may be proportionally reduced as indicated by the exigencies of the therapeutic situation.
  • the active compound may be administered in a convenient manner such as by the oral, intravenous (where water soluble), intramuscular, subcutaneous, intra nasal, intra ocular, intradermal or suppository routes or implanting (eg using slow release molecules by the intraperitoneal route or by using cells e.g.
  • the peptide may be required to be coated in a material to protect it from the action of enzymes, acids and other natural conditions which may inactivate said ingredients.
  • the low lipophilicity of the peptides will allow them to be destroyed in the gastrointestinal tract by enzymes capable of cleaving peptide bonds and in the stomach by acid hydrolysis.
  • they will be coated by, or administered with, a material to prevent its inactivation.
  • peptides may be administered in an adjuvant, co-administered with enzyme inhibitors or in liposomes.
  • Adjuvants contemplated herein include resorcinols, non-ionic surfactants such as polyoxyethylene oleyl ether and n-hexadecyl polyethylene ether.
  • Enzyme inhibitors include pancreatic trypsin inhibitor, diisopropylfluorophosphate (DEP) and trasylol.
  • Liposomes include water-in-oil-in-water CGF emulsions as well as conventional liposomes.
  • the active compounds may also be administered parenterally or intraperitoneally.
  • Dispersions can also be prepared in glycerol liquid polyethylene glycols, and mixtures thereof and in oils. Under ordinary conditions of storage and use, these preparations contain a preservative to prevent the growth of microorganisms.
  • the pharmaceutical forms suitable for injectable use include sterile aqueous solutions (where water soluble) or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersion.
  • the form must be sterile and must be fluid to the extent that easy syringability exists. It must be stable under the conditions of manufacture and storage and must be preserved against the contaminating action of microorganisms such as bacteria and fungi.
  • the carrier can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (for example, glycerol, propylene glycol and liquid polyethylene glycol, and the like), suitable mixtures thereof, and vegetable oils.
  • the proper fluidity can be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of superfactants.
  • the prevention of the action of microorganisms can be brought about by various antibacterial and antifungal agents, for example, chlorobutanol, phenol, sorbic acid, theomersal and the like. In many cases, it will be preferable to include isotonic agents, for example, sugars or sodium chloride.
  • Prolonged absorption of the injectable compositions can be brought about by the use in the composition of agents delaying absorption, for example, aluminium monostearate and gelatin.
  • Sterile injectable solutions are prepared by incorporating the active compounds in the required amount in the appropriate solvent with various other ingredients enumerated above, as required, followed by filtered sterilization.
  • dispersions are prepared by incorporating the various sterile active ingredient into a sterile vehicle which contains the basic dispersion medium and the required other ingredients from those enumerated above.
  • the preferred methods of preparation are vacuum drying and the freeze-drying technique which yield a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.
  • the active compound may be orally administered, for example, with an inert diluent or with an assimilable edible carrier, or it may be enclosed in hard or soft shell gelatin capsule, or it may be compressed into tablets, or it may be incorporated directly with the food of the diet.
  • the active compound may be incorporated with excipients and used in the form of ingestible tablets, buccal tablets, troches, capsules, elixirs, suspensions, syrups, wafers, and the like.
  • Such compositions and preparations should contain at least 1% by weight of active compound.
  • compositions and preparations may, of course, be varied and may conveniently be between about 5 to about 80% of the weight of the unit.
  • the amount of active compound in such therapeutically useful compositions is such that a suitable dosage will be obtained.
  • Preferred compositions or preparations according to the present invention are prepared so that an oral dosage unit form contains between about 0.1 ⁇ g and 2000 mg of active compound.
  • the tablets, pills, capsules and the like may also contain the following: A binder such as gum tragacanth, acacia, corn starch or gelatin; excipients such as dicalcium phosphate; a disintegrating agent such as corn starch, potato starch, alginic acid and the like; a lubricant such as magnesium stearate; and a sweetening agent such as sucrose, lactose or saccharin may be added or a flavoring agent such as peppermint, oil of wintergreen, or cherry flavoring.
  • a binder such as gum tragacanth, acacia, corn starch or gelatin
  • excipients such as dicalcium phosphate
  • a disintegrating agent such as corn starch, potato starch, alginic acid and the like
  • a lubricant such as magnesium stearate
  • a sweetening agent such as sucrose, lactose or saccharin may be added or a flavoring agent such as peppermint, oil of winter
  • tablets, pills, or capsules may be coated with shellac, sugar or both.
  • a syrup or elixir may contain the active compound, sucrose as a sweetening agent, methyl and propylparabens as preservatives, a dye and flavoring such as cherry or orange flavor.
  • any material used in preparing any dosage unit form should be pharmaceutically pure and substantially non-toxic in the amounts employed.
  • the active compound may be incorporated into sustained-release preparations and formulations.
  • a compound of the invention e.g., encapsulation in liposomes, microparticles, microcapsules, recombinant cells capable of expressing the compound, receptor-mediated endocytosis, construction of a nucleic acid as part of a retroviral or other vector, etc.
  • Methods of introduction include but are not limited to intradermal, intramuscular, intraperitoneal, intravenous, subcutaneous, intranasal, intra ocular, epidural, and oral routes.
  • the compounds or compositions may be administered by any convenient route, for example by infusion or bolus injection, by absorption through epithelial or mucocutaneous linings (e.g., oral mucosa, rectal and intestinal mucosa, etc.) and may be administered together with other biologically active agents. Administration can be systemic or local.
  • Pulmonary administration can also be employed, e.g., by use of an inhaler or nebulizer, and formulation with an aerosolizing agent.
  • a protein including an antibody or a peptide of the invention
  • care must be taken to use materials to which the protein does not absorb.
  • the compound or composition can be delivered in a vesicle, in particular a liposome.
  • the compound or composition can be delivered in a controlled release system.
  • a pump may be used.
  • polymeric materials can be used.
  • a controlled release system can be placed in proximity of the therapeutic target, thus requiring only a fraction of the systemic dose.
  • nucleotide symbols other than a, g, c, t they follow the convention set forth in WIPO Standard ST.25, Appendix 2, Table 1, wherein k represents t or g; n represents a, c, t or g; m represents a or c; r represents a or g; s represents c or g; w represents a or t and y represents c or t.
  • MTPGTQSPFFLLLLLTVLT (SEQ ID NO: 2) MTPGTQSPFFLLLLLTVLT (SEQ ID NO: 3) MTPGTQSPFFLLLLLTVLT VVTA (SEQ ID NO: 4) MTPGTQSPFFLLLTVLT VVTG
  • SEQ ID NOS:2, 3 and 4 describe N-terminal MUC-1 signaling sequence for directing MUC1 receptor and truncated isoforms to cell membrane surface. Up to 3 amino acid residues may be absent at C-terminal end as indicated by variants in SEQ ID NOS:2, 3 and 4.
  • GTINVHDVETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGAGVPGW GIALLVLVCVLVALAIVYLIALAVCQCRRKNYGQLDIFPARDTYHPMSEYPTYHTHG RYVPPSSTDRSPYEKVSAGNGGSSLSYTNPAVAAASANL (SEQ ID NO:5) describes a truncated MUC1 receptor isoform having nat-PSMGFR at its N-terminus and including the transmembrane and cytoplasmic sequences of a full-length MUC1 receptor.
  • GTINVHDVETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGA (SEQ ID NO:6) describes the extracellular domain of Native Primary Sequence of the MUC1 Growth Factor Receptor (nat-PSMGFR—an example of “PSMGFR”):
  • TINVHDVETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGA (SEQ ID NO:7) describes the extracellular domain of Native Primary Sequence of the MUC1 Growth Factor Receptor (nat-PSMGFR—An example of “PSMGFR”), having a single amino acid deletion at the N-terminus of SEQ ID NO:6).
  • GTINVHDVETQFNQYKTEAASPYNLTISDVSVSDVPFPFSAQSGA (SEQ ID NO: 8) describes the extracellular domain of “SPY” functional variant of the native Primary Sequence of the MUC1 Growth Factor Receptor having enhanced stability (var-PSMGFR—An example of “PSMGFR”).
  • TIN VHDVETQFNQYKTEAASPYNLTISDVSVSDVPFPFSAQSGA (SEQ ID NO:9) describes the extracellular domain of “SPY” functional variant of the native Primary Sequence of the MUC1 Growth Factor Receptor having enhanced stability (var-PSMGFR—An example of “PSMGFR”), having a single amino acid deletion at the C-terminus of SEQ ID NO:8).
  • CQCRRKNYGQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVS AGNGGSSLSYTNPAVAAASANL (SEQ ID NO:11) describes MUC1 cytoplasmic domain amino acid sequence.
  • NM23-H1 describes amino acid sequence (NM23-H1: GENBANK ACCESSION AF487339).
  • MM Minimal Serum-Free Base
  • FIG. 1B the same cell lysates are separated by SDS-PAGE and then probed with an anti-NME7 specific antibody (nm23-H7 B9 from Santa Cruz Biotechnology, Inc).
  • an anti-NME7 specific antibody (nm23-H7 B9 from Santa Cruz Biotechnology, Inc).
  • the results show that NME7 is strongly expressed in human ES cells cultured in NME1 dimers over an anti-MUC1* antibody surface (Lane 1), weakly expressed in the same ES cells that were cultured in bFGF over MEFs (Lane 2), and strongly expressed in breast cancer cells (Lane 3).
  • Lane 4 in which NME1 was added is blank indicating that the NME7 antibody does not cross react with NME1.
  • NME7 is expressed to a greater degree in stem cells cultured in NME1 dimers, which we have shown express markers indicating that they are in a more na ⁇ ve state than cells cultured in bFGF, means that NME7 is expressed at a higher level in na ⁇ ve cells, compared to its expression in primed cells.
  • NME7 also functions as a growth factor with MUC1* as its target receptor
  • pull-down assays a synthetic MUC1* extra cellular domain peptide (His-tagged PSMGFR sequence) was immobilized on NTA-Ni magnetic beads. These beads were incubated with the cell lysates of BGO1v human embryonic stem cells that had been cultured in NME1 dimers over a surface coated with anti-MUC1* antibodies (Lane 1), or cultured in bFGF over MEFs (Lane 2) or T47D human breast cancer cell lysates (Lane 3). Beads were rinsed and captured proteins were released by addition of imidazole.
  • NME7 binds to the MUC1* extra cellular domain peptide. This means that in stem cells and cancer cells, NME7 via its portions of its two NDPK domains, activates pluripotency pathways by dimerizing the MUC1* extra cellular domain.
  • a MUC1 Pull Down Assay Shows that NME1, NME6 and NME7 Bind to a MUC1 Species Protein
  • a pull down assay using an antibody to the MUC1* cytoplasmic tail (Ab-5) was performed on a panel of cells. Results are shown in FIGS. 2A-2F .
  • the proteins pulled down by the MUC1 antibody were separated by SDS-PAGE then probed with antibodies specific for NME1, NME6 and NME7, using Western blot technique.
  • MUC1*-positive breast cancer cell line T47D cells ATCC
  • human embryonic stem cell line BGO1v LifeTechnologies
  • human ES cells HES cells
  • HES cells HES cells
  • SC101A-1 System Biosciences Inc.
  • T47D cancer cells were grown according to ATCC protocol in RPMI-1640 (ATCC) plus 10% FBS (VWR).
  • MM minimal stem cell media
  • NM23-RS recombinant NME1 S120G dimers
  • Stem cells were grown on plasticware coated with 12.5 ug/mL anti-MUC1* C3 mab. Cells were lysed with 200 uL RIPA buffer for 10 min on ice. After removal of cell debris by centrifugation, the supernatant was used in a co-immunoprecipitation assay. MUC1* was pulled down using the Ab-5 antibody (anti-MUC-1 Ab-5, Thermo Scientific), which recognizes the MUC1 cytoplasmic tail, coupled to Dynabeads protein G (Life Technologies).
  • Ab-5 antibody anti-MUC-1 Ab-5, Thermo Scientific
  • the beads were washed twice with RIPA buffer and resuspended in reducing buffer. A sample of the supernatant was subjected to a reducing SDS-PAGE followed by transfer of the protein to a PVDF membrane. In FIG. 2 , the membrane was then probed with: A) an anti-NM23-H1 (NME1) Antibody (C-20, Santa Cruz Biotechnology); B) anti-NME6 (Abnova); or C) anti-NM23-H7 Antibody (B-9, Santa Cruz Biotechnology); D) the staining of NME6 was enhanced using Supersignal (Pierce); and E) the staining of NME7 was enhanced using Supersignal.
  • NME1 anti-NM23-H1
  • B anti-NME6
  • B-9 Santa Cruz Biotechnology
  • the proteins were detected by chemiluminescence.
  • the photos show that native NME1, NME6 and NME7 are present in MUC1*-positive breast cancer cells, in human ES cells and in human iPS cells and that they bind to MUC1*. Note that the number of cells present in the HES-3 pellet was less than the number present in the other samples.
  • Results are shown in FIG. 3 .
  • Human ES cells (BGO1v and HES-3) were cultured in NME-based media wherein cells were plated over a layer of anti-MUC1* antibody.
  • NME7 species cells were harvested and lysed with RIPA buffer (Pierce), supplemented with protease inhibitor (Pierce).
  • Cell lysates (20 uL) were separated by electrophoresis on a 12% SDS-PAGE reducing gel and transferred to a PVDF membrane (GE Healthcare). The blot was blocked with PBS-T containing 3% milk and then incubated with primary antibody (anti NM23-H7 clone B-9, Santa Cruz Biotechnology) at 4° C. overnight.
  • FIG. 3A shows that the lysates from human stem cells contain three NME7 species: full-length at 42 kDa and two lower molecular weight NME7 species at ⁇ 33 kDa and-30 kDa.
  • FIGS. 3B and C shows the difference between NME7 species that are secreted (B), and those that are retained within the cell (C).
  • FIG. 3B shows that only the 30-33 kDa NME7 species are secreted from the cells.
  • FIG. 3A shows that the lysates from human stem cells contain three NME7 species: full-length at 42 kDa and two lower molecular weight NME7 species at ⁇ 33 kDa and-30 kDa.
  • FIGS. 3B and C shows the difference between NME7 species that are secreted (B), and those that are retained within the cell (C).
  • FIG. 3B shows that only the 30-33 kDa NME7 species are secreted from the cells.
  • 3C shows that the lysates of those same cells have both the full-length form and a lower molecular weight species that may be a cleavage product or alternate isoform of both.
  • iPS Conditioned media (20 uL) was separated by electrophoresis on either a 12% SDS-PAGE reducing gel and transferred to a PVDF membrane (GE Healthcare). The blot was blocked with PBS-T containing 3% milk and then incubated with primary antibody (anti NM23-H7 clone B-9, Santa Cruz Biotechnology) at 4° C. overnight.
  • HRP horseradish peroxidase
  • constructs were made to make a recombinant NME7 that could be expressed efficiently and in soluble form.
  • the first approach was to make a construct that would encode the native NME7 (a) or an alternative splice variant NME7 (b), which has an N-terminal deletion.
  • the constructs carried a histidine tag or a strep tag to aid in purification.
  • a novel construct was made in which the DM10 sequence was deleted and the NME7 comprised essentially the NDPK A and B domains having a calculated molecular weight of 33 kDa.
  • NME7-AB expressed very well in E. coli and existed as the soluble protein.
  • NME7-AB was first purified over an NTA-Ni column and then further purified by size exclusion chromatography (FPLC) over a Sephadex 200 column ( FIG. 4A ). Fractions were collected and tested by SDS-PAGE to identify fractions with the highest and purest expression of NME7-AB ( FIG. 4B ).
  • FIG. 4C shows the FPLC trace for the combined fractions that were the most pure.
  • the purified NME7-AB protein was then tested and shown to fully support the growth of human stem cells and further reverts them to the most na ⁇ ve, pre-X-inactivation state.
  • the purified NME7-AB was also shown to accelerate the growth of cancer cells.
  • PSMGFR-Cys The PSMGFR peptide bearing a C-terminal Cysteine (PSMGFR-Cys) was covalently coupled to BSA using Imject Maleimide activated BSA kit (Thermo Fisher). PSMGFR-Cys coupled BSA was diluted to 10 ug/mL in 0.1M carbonate/bicarbonate buffer pH 9.6 and 50 uL was added to each well of a 96 well plate. After overnight incubation at 4° C., the plate was washed twice with PBS-T and a 3% BSA solution was added to block remaining binding site on the well.
  • ELISA MUC1* dimerization The protocol for NME7 binding was used, and NME7 was used at 11.6 ug/mL.
  • NME7-AB For testing recombinant NME7-AB for ability to maintain pluripotency and inhibit differentiation, a soluble variant of NME7, NME7-AB, was generated and purified.
  • Human stem cells iPS cat #SC101a-1, System Biosciences
  • SC101a-1 Human stem cells
  • These source stem cells were then plated into 6-well cell culture plates (VitaTM, Thermo Fisher) that had been coated with 12.5 ug/well of a monoclonal anti-MUC1* antibody, MN-C3. Cells were plated at a density of 300,000 cells per well.
  • the base media was Minimal Stem Cell Media consisting of: 400 ml DME/F12/GlutaMAX I (Invitrogen #10565-018), 100 ml Knockout Serum Replacement (KO-SR, Invitrogen #10828-028), 5 ml 100 ⁇ MEM Non-essential Amino Acid Solution (Invitrogen #11140-050) and 0.9 ml (0.1 mM) (3-mercaptoethanol (55 mM stock, Invitrogen #21985-023).
  • the base media can be any media. In a preferred embodiment, the base media is free of other growth factors and cytokines.
  • the NME7 species of ⁇ 30-33 kDa may be an alternative splice isoform or a post translational modification such as cleavage, which may enable secretion from the cell.
  • Cancer cells are normally cultured in a serum-containing media such as RPMI. We discovered that culturing cancer cells in the presence of reagents that make stem cells revert to a more na ⁇ ve state, makes the cancer cells transform to a more metastatic state.
  • RPMI serum-containing media
  • NME7-AB, human NME1 dimers, bacterial NME1 dimers, NME7-X1 and “2i” inhibitors were each able to transform regular cancer cells into metastatic cancer cells, which are also called cancer stem cells “CSCs” or tumor initiating cells “TICs”.
  • CSCs cancer stem cells
  • TICs tumor initiating cells
  • 2i is the name given to two biochemical inhibitors that researchers found made human stem cells revert to a more na ⁇ ve state. 2i are MEK and GSK3-beta inhibitors PD0325901 and CHIR99021, which are added to culture medium to final concentrations of about 1 mM and 3 mM, respectively.
  • NME7-AB and NME7-X1 are at a final concentration of about 4 nM when added to separate batches of minimal medium to make cancer cells transform to metastatic cells, although lower and higher concentrations also work well in the range of about 1 nM to 16 nM.
  • Human or bacterial NME1 dimers are used at a final concentration of 4 nM to 32 nM, with 16 nM typically used in these experiments, wherein the human NME bears the S120G mutation. Lower concentrations may be required if using wild type. It is not intended that these exact concentrations are important. It is important that the NME1 proteins are dimers and the range of concentrations over which this happens is in the low nanomolar range although certain mutations allow higher concentrations to remain as dimers.
  • NME7-AB and NME7-X1 are monomers and concentrations used to transform cancer cells to metastatic cells should allow the proteins to remain as monomers.
  • Various molecular markers have been proposed as being indicators of metastatic cancer cells. Different cancer types may have different molecules that are up-regulated. For example, the receptor CXCR4 is up-regulated in metastatic breast cancers while E-cadherin, also known as CHD1, is up-regulated more in metastatic prostate cancers.
  • typical markers of pluripotency such as OCT4, SOX2, NANOG, and KLF4 are up-regulated as cancers become metastatic.
  • the starting cancer cells and the later metastatic cancer cells can be assayed by PCR to measure expression levels of these genes.
  • FIG. 11 shows a graph of RT-PCR measurements of T47D breast cancer cells that were cultured in a media that contained NME7-AB.
  • a rho I kinase inhibitor, ROCi, ROCKi or Ri was added to prevent the transformed cells from floating off the plate.
  • Expression levels of various metastatic markers as well as pluripotent stem cell markers were measured for the parent cells and for the NME7-AB cultured cells.
  • the results show that the floater cells express higher amounts of metastatic and pluripotency markers compared to the cells that received ROCi. We reasoned it was because those measurements were the average of cells that did not transform and those that did but the ROCi made them remain adherent. This can clearly be seen in FIG. 12 wherein “ ⁇ Ri” means adherent cells that did not receive ROCi and so were not mixed with the highly metastatic cells that float.
  • Prostate cancer cells also transitioned to a more metastatic state when cultured in media containing NM23, aka NME1, or NME7-AB.
  • media containing NM23 aka NME1, or NME7-AB.
  • culture in NME7-AB, human NME1 dimers, or bacterial NMEs that have high sequence homology to human induces transition to a more metastatic state.
  • FIG. 14A shows a graph of RT-PCR measurements of expression levels of metastatic and pluripotency markers for breast cancer cells that are cultured in media containing either 2i inhibitors, NME7-AB or both. As can be seen, 2i inhibitors are also able to induce the transition of cancer cells to a more metastatic state.
  • FIG. 14B shows a graph of RT-PCR measurements of expression levels of metastatic and pluripotency markers for breast cancer cells that were cultured in media containing an NME1 from bacteria HSP593, whose sequence is highly homologous to human NME1 and NME7-AB, showing that bacterial NMEs with high sequence homology can mimic the effect of human NME1 and NME7-AB in that they induce transition to a more metastatic state.
  • Ovarian cancer cell lines SK-OV3, OV-90, pancreatic cancer cell lines CAPAN-2 and PANC-1, breast cancer cell line MDA-MB all displayed the morphological transition of going from adherent to non-adherent when cultured in NME7-AB and or 2i inhibitors.
  • FIG. 37 shows graphs of RT-PCR measurement of metastatic or pluripotency markers for various cancer cell lines cultured for 72 or 144 hours in NME7-AB.
  • FIG. 37A shows that SK-OV3 cells increase expression of metastatic markers CHD1, SOX2 and NME7-X1 when cultured in NME7-AB.
  • FIG. 37B shows that OV-90 cells increase expression of metastatic markers CXCR4 and NME7-X1 after culture in NME7-AB.
  • a functional test of whether or not a population of cancer cells is metastatic is to implant very low numbers, e.g. 200, of the cells in immuno-compromised mice and see if they develop into a tumor. Typically 5-6 million cancer cells are required to form a tumor in an immuno-compromised mouse. We showed that as few as 50 of the NME-induced metastatic cancer cells formed tumors in mice. In addition, mice that were injected throughout the test period with human NME7-AB, NME1, or NME7-X1 developed remote metastases.
  • T47D human breast cancer cells were cultured in standard RPMI media for 14 days with media changes every 48 hours and passed by trypsinization when approximately 75% confluent. The cells were then plated into 6-well plates and cultured in minimal stem cell media (see Example 1) that was supplemented with 4 nM NME7-AB. Media was changed every 48 hours. By about Day 4, some cells become detached from the surface and float. Media is carefully changed so as to retain the “floaters” as these are the cells that have the highest metastatic potential as evidenced by RT-PCR measurement of metastatic markers. On Day 7 or 8, the floaters are harvested and counted. Samples are retained for RT-PCR measurement. The key marker measured is CXCR4 which is up-regulated by 40-200 times after being briefly cultured in NME7-AB.
  • the freshly harvested floater metastatic cells are xenografted into the flank of female nu/nu athymic mice that have been implanted with 90-day slow release estrogen pellets.
  • Floater cells were xenografted as 10,000, 1,000, 100 or 50 cells each.
  • Half of the mice in each group of 6 were also injected daily with 32 nM NME7-AB near the original implantation site.
  • the parent T47D cells that were cultured in RPMI media without NME7-AB were also implanted into mice as 6 million, 10,000 or 100 as controls. Mice implanted with the NME7-induced floater cells developed tumors even when as few as 50 cells were implanted.
  • mice that were implanted with the floater cells and that received daily injections of NME7-AB also developed remote tumors or remote metastases in various organs ( FIG. 20-25 ).
  • 11 out of the 12 mice, or 92%, that were injected with human NME7-AB after implantation of the NME7-AB cultured cancer cells developed tumors at the injection site. Only 7 out of the 12 mice, or 58%, that were not injected with human NME7-AB after implantation developed tumors.
  • 9 out of the 11 mice, or 82%, that got tumors and were injected with human NME7-AB developed multiple tumors remote from the injection site. None of the mice that were not injected with NME7-AB developed multiple, visible tumors.
  • mice injected with NME7-AB were indeed human breast tumors. Similar analysis of their organs showed that in addition to remote bumps, mice had randomly metastasized to the liver and lung with human breast cancer characteristic of the human breast cancer cells that were implanted. As expected, only the mice implanted with 6 million cells grew tumors.
  • mice were either 24 or 52 mice, including all proper controls.
  • T47D breast cancer cells and DU145 prostate cancer cells were cultured according to recommended protocols by ATCC. Cells were grown to ⁇ 30% confluency. An anti-NME7 polyclonal rabbit antibody was raised against a fragment of NME7 that encompasses nearly the entire protein: amino acids 100 to 376. This polyclonal antibody was added to the cancer cells at concentrations between 2.7 to 375 ng/mL. Taxol was used as the positive control. Cells were photographed and counted at 48 hours ( FIGS. 6 and 7 ) and after 96 hours ( FIG. 8 ). The photos and cell counts show that the antibody potently inhibited the growth of breast and prostate cancer cells. However, because there was no attempt to select immunizing peptides that were unique to NME7, this antibody could be exerting cytotoxic effects by binding to and inhibiting both NME7-AB -like species and NME1.
  • NME7 peptides were selected as immunizing agents for antibody production.
  • NME7 peptides A1, A2, B1, B2 and B3 ( FIG. 19 ) were chosen using a process of sequence alignment among human NME1, human NME7 and several bacterial NMEs that were homologous to human NME1 or human NME7. Five regions that had high sequence homology among all were identified. However, to prevent selecting peptides that would give rise to antibodies that would inhibit human NME1 as well as human NME7, we chose NME7 sequences that were adjacent to the homologous regions wherein those peptides had sequences that were different from human NME1.
  • FIG. 27 shows that the peptides inhibited the binding of NME7 and NME1 to the immobilized peptide. This showed that those regions from which the peptides were derived were the regions that interacted with MUC1* and would give rise to antibodies that would bind to those regions of NME7 and inhibit its binding to MUC1* receptor.
  • FIG. 30 shows a table of scientist observations when cancer cells are grown in either NME7-AB or 2i inhibitors, and shows that the free peptides inhibited the morphological change from adherent cells to floaters, which for breast cancer cells is directly correlated to increased expression of metastatic markers, especially CXCR4.
  • RT-PCR measurements confirm that the NME7-AB peptides inhibited the increase in expression of metastasis marker CXCR4.
  • FIG. 31 shows a graph of RT-PCR measurements of CXCR4 expression in T47D breast cancer cells that were grown in either NME7-AB or 2i inhibitors, each of which transform cancer cells to a more metastatic state, and the inhibitory effect of NME7-derived peptides, A1, A2, B1, B2 and B3, on the metastatic transformation.
  • FIG. 32 shows a table of recorded RNA levels in samples that were used for RT-PCR measurement of CXCR4 in FIG. 31 as well as the threshold cycle number for CXCR4 expression as well as for the control housekeeping gene.
  • Anti-NME7 Antibodies Specifically Bind to Human NME7 but Not to Human NME1
  • a standard ELISA assay was performed to determine whether or not the NME7 antibodies we generated by immunization with NME7-AB peptides A1, A2, B1, B2, and B3 would bind specifically to NME7-AB, but not to human NME1 as it has healthy functions and it may be detrimental to a human to block it with an antibody.
  • the ELISA of FIG. 26 shows that all of the NME7 antibodies we generated from peptides A1, A2, B1, B2, and B3 bind to human NME7-AB (A) but not to human NME1 (B).
  • the peptides used to generate these antibodies are common to both NME7-AB and NME7-X1. This assays show that the antibodies generated from peptides A1, A2, B1, B2, and B3 specifically bind to NME7-AB and by extension will bind to NME7-X1.
  • NME7A peptide 1 (A domain): (SEQ ID NO: 141) MLSRKEALDFHVDHQS NME7A peptide 2 (A domain): (SEQ ID NO: 142) SGVARTDASES NME7B peptide 1 (B domain): (SEQ ID NO: 143) DAGFEISAMQMFNMDRVNVE NME7B peptide 2 (B domain): (SEQ ID NO: 144) EVYKGVVTEYHDMVTE NME7B peptide 3 (B domain): (SEQ ID NO: 145) AIFGKTKIQNAVHCTDLPEDGLLEVQYFF
  • the graph of FIG. 28 shows that the antibodies generated, as well as the free peptides, potently inhibited the growth of the cancer cells. Note the comparison to inhibition using Taxol, which is a chemotherapy agent that kills healthy and cancer cells alike. Also, for comparison, a polyclonal antibody generated using a large stretch of NME7 from amino acid 100 to 376 is shown. Although this antibody is a potent inhibitor of cancer growth it could have non-specific effects since it can bind to NME1 as well as to NME7.
  • Anti-NME7 Antibodies Inhibit the Transition of Cancer Cells to Metastatic Cancer Cells
  • NME7-AB human NME1 dimers, bacterial NME1 dimers or MEK and GSK3-beta inhibitors, called “2i”
  • 2i GSK3-beta inhibitors
  • floaters were collected separately from those that were adherent and were shown to: a) express much higher levels of metastatic genes; and b) when xenografted into mice, the floater cells were able to generate tumors when implanted at very low numbers.
  • RT-PCR measurement of specific metastatic markers such as CXCR4 in breast cancers, CHD1 in prostate cancer, and other pluripotent stem cell markers such as OCT4, SOX2, NANOG, KLF4, c-Myc and others were dramatically over-expressed in cancer cells that were cultured in NME7-AB and most over-expressed in the cells that became non-adherent, called “floaters” here and in figures.
  • NME7-specific antibodies generated by immunization with NME7-derived peptides A1, A2, B1, B2 and B3, as well as the peptides themselves, inhibit the transition from cancer cell to metastatic cancer cells.
  • the antibodies generated by immunization with A1, A2, B1, B2 and B3 were tested for their ability to inhibit the metastatic transition induced by culture of T47D breast cancer cells in NME7-AB or in 2i inhibitors.
  • the most striking observation was that the antibodies and the peptides dramatically reduced the number of floater cells, which was the first indication that the antibodies and peptides had inhibited the transformation to metastatic cancer cells.
  • cells to which the antibody generated from immunization with the B3 peptide barely generated any floater cells.
  • FIG. 30 shows the recorded observations of the percentage of floater cells visible for each antibody relative to the control wells that did not receive any antibody treatment.
  • mRNA was extracted from both the floater cells and the adherent cells.
  • RT-PCR was used to measure expression levels of metastatic markers, including CXCR4.
  • Treatment with the anti-NME7 antibodies greatly reduced the amount of metastatic markers, such as CXCR4, indicating the antibodies inhibited the transition to metastatic cancer. (See FIG. 31 ).
  • the antibody generated by immunization with peptide B3, aka antibody #61 essentially completely inhibited the transition to a more metastatic state.
  • FIG. 31B shows that breast cancer cells that were treated with the NME7-AB peptides, A1, A2, B1, B2 and B3, alone were able to potently inhibit the transition to a more metastatic state induced by culturing the cells in a media containing the 2i inhibitors. Peptide B3 was especially effective as was antibody #61 that it generated.
  • FIG. 31C shows the same graph but with the Y-axis expanded to show the peptide inhibition of metastatic markers. The amount of mRNA, which indicates cell viability and growth, was measured. Cells that were treated with antibody had much less mRNA, indicating that in addition to inhibiting the transition to a more metastatic state, the anti-NME7-AB antibodies inhibited the growth of the cancer cells.
  • FIG. 32 shows a table of the amounts of RNA recovered for the inhibition experiment shown in FIG. 31A .
  • H278 is a rabbit polyclonal raised against NME7 amino acids 100-376, which includes amino acid sequences that are not unique to NME7.
  • FIG. 36B shows that this antibody also stains NME1, which is 17 kDa as well as full-length NME7 and other bands that do not appear to be specific to NME7-AB.
  • NME7 antibodies generated by immunization with NME7-AB peptides A1, A2, B1, B2 or B3 identify new NME7 species including the full-length 42 kDa protein, a ⁇ 33 kDa NME7 species that may be a cleavage product or alternative isoform, a ⁇ 30 kDa NME7 species that may be a cleavage product or alternative isoform, wherein the ⁇ 30 kDa species appears to be NME7-X1.
  • 35A-C shows that antibodies generated by peptides A1, B1 and B3 identify the secreted forms of NME7, NME7-AB and NME7-X1 in a wide range of cancer cell lines, including T47D breast cancer cells, PC3 and DU145 prostate cancer cells, HEK293 fetal liver cells, and leukemia cells IM-9, K562, and MV411.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • Immunology (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Genetics & Genomics (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Engineering & Computer Science (AREA)
  • Animal Behavior & Ethology (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Cell Biology (AREA)
  • Oncology (AREA)
  • Microbiology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Epidemiology (AREA)
  • Zoology (AREA)
  • Biomedical Technology (AREA)
  • Biotechnology (AREA)
  • Mycology (AREA)
  • Wood Science & Technology (AREA)
  • Analytical Chemistry (AREA)
  • Pathology (AREA)
  • Urology & Nephrology (AREA)
  • General Engineering & Computer Science (AREA)
  • Hematology (AREA)
  • Physics & Mathematics (AREA)
  • General Physics & Mathematics (AREA)
  • Toxicology (AREA)
  • Hospice & Palliative Care (AREA)
  • Food Science & Technology (AREA)
US15/302,461 2014-04-07 2015-04-07 Anti-nme antibody Abandoned US20170204196A1 (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
US15/302,461 US20170204196A1 (en) 2014-04-07 2015-04-07 Anti-nme antibody

Applications Claiming Priority (7)

Application Number Priority Date Filing Date Title
US201461976390P 2014-04-07 2014-04-07
PCT/US2014/050773 WO2015023694A2 (en) 2013-08-12 2014-08-12 Method for enhancing tumor growth
USPCT/US2014/061821 2014-10-22
US201562114526P 2015-02-10 2015-02-10
US201562127746P 2015-03-03 2015-03-03
PCT/US2015/024764 WO2015157322A2 (en) 2014-04-07 2015-04-07 Anti-nme antibody
US15/302,461 US20170204196A1 (en) 2014-04-07 2015-04-07 Anti-nme antibody

Related Parent Applications (3)

Application Number Title Priority Date Filing Date
PCT/US2014/050773 Continuation-In-Part WO2015023694A2 (en) 2013-02-20 2014-08-12 Method for enhancing tumor growth
USPCT/US2014/061821 Continuation-In-Part 2014-04-07 2014-10-22
PCT/US2015/024764 A-371-Of-International WO2015157322A2 (en) 2014-04-07 2015-04-07 Anti-nme antibody

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US16/111,862 Division US20190031778A1 (en) 2014-04-07 2018-08-24 Anti-nme antibody
US16/111,894 Division US11702483B2 (en) 2014-04-07 2018-08-24 Method of treating an NME7 expressing cancer with a peptide

Publications (1)

Publication Number Publication Date
US20170204196A1 true US20170204196A1 (en) 2017-07-20

Family

ID=54288530

Family Applications (4)

Application Number Title Priority Date Filing Date
US15/302,461 Abandoned US20170204196A1 (en) 2014-04-07 2015-04-07 Anti-nme antibody
US16/111,894 Active 2035-08-14 US11702483B2 (en) 2014-04-07 2018-08-24 Method of treating an NME7 expressing cancer with a peptide
US16/111,862 Abandoned US20190031778A1 (en) 2014-04-07 2018-08-24 Anti-nme antibody
US17/719,302 Active US12479928B2 (en) 2014-04-07 2022-04-12 Anti-cancer peptide

Family Applications After (3)

Application Number Title Priority Date Filing Date
US16/111,894 Active 2035-08-14 US11702483B2 (en) 2014-04-07 2018-08-24 Method of treating an NME7 expressing cancer with a peptide
US16/111,862 Abandoned US20190031778A1 (en) 2014-04-07 2018-08-24 Anti-nme antibody
US17/719,302 Active US12479928B2 (en) 2014-04-07 2022-04-12 Anti-cancer peptide

Country Status (11)

Country Link
US (4) US20170204196A1 (cg-RX-API-DMAC7.html)
EP (2) EP4050103A1 (cg-RX-API-DMAC7.html)
JP (5) JP6401292B2 (cg-RX-API-DMAC7.html)
KR (2) KR102294483B1 (cg-RX-API-DMAC7.html)
CN (1) CN106414726A (cg-RX-API-DMAC7.html)
AU (1) AU2015243948B2 (cg-RX-API-DMAC7.html)
CA (1) CA2945162A1 (cg-RX-API-DMAC7.html)
IL (2) IL248220A0 (cg-RX-API-DMAC7.html)
SG (2) SG11201608389RA (cg-RX-API-DMAC7.html)
TW (1) TWI746420B (cg-RX-API-DMAC7.html)
WO (1) WO2015157322A2 (cg-RX-API-DMAC7.html)

Cited By (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11702483B2 (en) 2014-04-07 2023-07-18 Minerva Biotechnologies Corporation Method of treating an NME7 expressing cancer with a peptide
US12037413B2 (en) 2019-02-04 2024-07-16 Minerva Biotechnologies Corporation Anti-NME antibody and method of treating cancer or cancer metastasis
US12049514B2 (en) 2020-06-08 2024-07-30 Minerva Biotechnologies Corporation Anti-NME antibody and method of treating cancer or cancer metastasis
US12115192B2 (en) 2023-02-02 2024-10-15 Minerva Biotechnologies Corporation Chimeric antigen receptor compositions and methods for treating MUC1* diseases
US12415868B1 (en) 2020-06-26 2025-09-16 Minerva Biotechnologies Corporation Anti-NME antibody and method of treating cancer or cancer metastasis
US12491259B2 (en) 2022-04-12 2025-12-09 Minerva Biotechnologies Corporation Anti-variable MUC1* antibodies and uses thereof

Families Citing this family (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
AU2016219350A1 (en) 2015-02-10 2017-08-24 Minerva Biotechnologies Corporation Humanized anti-MUC1* antibodies
CN110267665A (zh) * 2016-10-11 2019-09-20 米纳瓦生物技术公司 人源化抗muc1*抗体和切割酶的用途
EP3600451B1 (en) 2017-03-29 2025-12-24 Minerva Biotechnologies Corporation Agents for differentiating stem cells and treating cancer
WO2025049494A1 (en) 2023-08-29 2025-03-06 Minerva Biotechnologies Corporation Bacterial nme7 orthologs and uses thereof

Family Cites Families (35)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
US5631271A (en) 1986-11-29 1997-05-20 Serfontein; Willem J. Methods and preparations for the treatment and prophylaxis of metabolic disturbances
US5874285A (en) * 1996-09-13 1999-02-23 Incyte Pharmaceuticals, Inc. Polynucleotide encoding a novel human nm23-like protein
US6818749B1 (en) 1998-10-31 2004-11-16 The United States Of America As Represented By The Department Of Health And Human Services Variants of humanized anti carcinoma monoclonal antibody cc49
EP1265582A2 (en) 1999-09-29 2002-12-18 Human Genome Sciences, Inc. Colon and colon cancer associated polynucleotides and polypeptides
AUPR011700A0 (en) 2000-09-14 2000-10-05 Austin Research Institute, The Composition comprising immunogenic virus sized particles (VSP)
US20050163784A1 (en) 2002-06-17 2005-07-28 Valentijn Linda J. Novel cancer therapies
US7202346B2 (en) * 2002-07-03 2007-04-10 Immunogen Inc. Antibodies to non-shed Muc1 and Muc16, and uses thereof
WO2004050860A2 (en) * 2002-12-04 2004-06-17 Diadexus, Inc. Compositions, splice variants and methods relating to colon specific genes and proteins
EP1899486A4 (en) 2005-06-08 2009-07-22 Millennium Pharm Inc METHOD FOR IDENTIFYING, ASSESSING AND TREATING PATIENTS IN CANCER THERAPY
WO2007072221A2 (en) 2005-11-10 2007-06-28 Aurelium Biopharma Inc. Surface marker-directed cancer therapeutics
CN101918844A (zh) 2007-06-18 2010-12-15 米迪缪尼有限公司 表达epha2和erbb2的细胞的协同治疗
DK2334703T3 (en) 2008-09-17 2015-10-05 Innate Pharma Configurations and methods for detection of tlr3
EP4083072A1 (en) 2008-10-06 2022-11-02 Minerva Biotechnologies Corporation Muc1* antibodies
WO2010042760A2 (en) 2008-10-08 2010-04-15 The Administrators Of The Tulane Educational Fund Compositions, methods, and kits for enhancing the immunogenicity of pathogenic antigens
MX2011013385A (es) * 2009-06-11 2012-05-29 Minerva Biotechnologies Corp Metodos para cultivar celulas madre y celulas progenitoras.
PH12013501201A1 (en) * 2010-12-09 2013-07-29 Univ Pennsylvania Use of chimeric antigen receptor-modified t cells to treat cancer
AU2012326137B2 (en) * 2011-10-17 2018-11-29 Minerva Biotechnologies Corporation Media for stem cell proliferation and induction
EP2818480B1 (en) 2012-02-24 2020-08-26 Alteogen Inc. Modified antibody in which motif comprising cysteine residue is bound, modified antibody-drug conjugate comprising the modified antibody, and production method for same
WO2013151663A1 (en) * 2012-04-02 2013-10-10 modeRNA Therapeutics Modified polynucleotides for the production of membrane proteins
WO2014018679A2 (en) * 2012-07-24 2014-01-30 Minerva Biotechnologies Corporation Nme variant species expression and suppression
CN104717980A (zh) * 2012-08-14 2015-06-17 米纳瓦生物技术公司 干细胞增强疗法
US9770011B2 (en) 2012-09-29 2017-09-26 The Trustees Of The University Of Pennsylvania Veterinary composition and methods for non-surgical neutering and castration
US20160326263A1 (en) 2013-02-20 2016-11-10 Minerva Biotechnologies Corporation NME Inhibitors and Methods of Using NME Inhibitors
IL240695B2 (en) * 2013-02-20 2024-03-01 Minerva Biotechnologies Corp Nme inhibitors and methods of using nme inhibitors
EP4050103A1 (en) 2014-04-07 2022-08-31 Minerva Biotechnologies Corporation Anti-nme antibody
AU2016219350A1 (en) 2015-02-10 2017-08-24 Minerva Biotechnologies Corporation Humanized anti-MUC1* antibodies
CN105384825B (zh) 2015-08-11 2018-06-01 南京传奇生物科技有限公司 一种基于单域抗体的双特异性嵌合抗原受体及其应用
US11136399B2 (en) 2016-07-14 2021-10-05 Institute Of Biophysics, Chinese Academy Of Sciences Type I interferon receptor antibody and use thereof
EP3515949A4 (en) 2016-09-20 2020-10-28 Wuxi Biologics Ireland Limited. NEW ANTI-PCSK9 ANTIBODIES
CN110267665A (zh) 2016-10-11 2019-09-20 米纳瓦生物技术公司 人源化抗muc1*抗体和切割酶的用途
US20200390870A1 (en) 2017-11-27 2020-12-17 Minerva Biotechnologies Corporation Humanized anti-muc1* antibodies and direct use of cleavage enzyme
WO2020163325A1 (en) 2019-02-04 2020-08-13 Minerva Biotechnologies Corporation Anti-nme antibody and method of treating cancer or cancer metastasis
EP4161970A4 (en) 2020-06-08 2024-07-10 Minerva Biotechnologies Corporation ANTI-NME ANTIBODIES AND METHODS FOR TREATING CANCER OR CANCER METASTASES
IL299332A (en) 2020-06-26 2023-02-01 Minerva Biotechnologies Corp Anti-nme antibody and method of treating cancer or cancer metastasis

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
Desvignes et al. Nme protein family evolutionary history, a vertebrate perspective. BMC Evolutionary Biology 9:256, 23 October 2009. *

Cited By (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11702483B2 (en) 2014-04-07 2023-07-18 Minerva Biotechnologies Corporation Method of treating an NME7 expressing cancer with a peptide
US12479928B2 (en) 2014-04-07 2025-11-25 Minerva Biotechnologies Corporation Anti-cancer peptide
US12037413B2 (en) 2019-02-04 2024-07-16 Minerva Biotechnologies Corporation Anti-NME antibody and method of treating cancer or cancer metastasis
US12049514B2 (en) 2020-06-08 2024-07-30 Minerva Biotechnologies Corporation Anti-NME antibody and method of treating cancer or cancer metastasis
US12415868B1 (en) 2020-06-26 2025-09-16 Minerva Biotechnologies Corporation Anti-NME antibody and method of treating cancer or cancer metastasis
US12491259B2 (en) 2022-04-12 2025-12-09 Minerva Biotechnologies Corporation Anti-variable MUC1* antibodies and uses thereof
US12115192B2 (en) 2023-02-02 2024-10-15 Minerva Biotechnologies Corporation Chimeric antigen receptor compositions and methods for treating MUC1* diseases

Also Published As

Publication number Publication date
JP6401292B2 (ja) 2018-10-10
JP6646118B2 (ja) 2020-02-14
WO2015157322A3 (en) 2015-12-23
SG10201808867PA (en) 2018-11-29
JP7042854B2 (ja) 2022-03-28
US20190031779A1 (en) 2019-01-31
US20250011469A9 (en) 2025-01-09
WO2015157322A2 (en) 2015-10-15
US20220289865A1 (en) 2022-09-15
EP3129476B1 (en) 2022-01-05
TW201542595A (zh) 2015-11-16
IL291164A (en) 2022-05-01
JP2024084747A (ja) 2024-06-25
AU2015243948B2 (en) 2020-10-15
CA2945162A1 (en) 2015-10-15
KR102294483B1 (ko) 2021-08-27
IL248220A0 (en) 2016-11-30
KR20210107166A (ko) 2021-08-31
US12479928B2 (en) 2025-11-25
AU2015243948A1 (en) 2016-10-27
EP4050103A1 (en) 2022-08-31
SG11201608389RA (en) 2016-11-29
JP2017512825A (ja) 2017-05-25
CN106414726A (zh) 2017-02-15
JP2020073562A (ja) 2020-05-14
EP3129476A2 (en) 2017-02-15
KR20160142372A (ko) 2016-12-12
US11702483B2 (en) 2023-07-18
TWI746420B (zh) 2021-11-21
JP2018203765A (ja) 2018-12-27
JP2022095648A (ja) 2022-06-28
US20190031778A1 (en) 2019-01-31
EP3129476A4 (en) 2017-11-08

Similar Documents

Publication Publication Date Title
US12479928B2 (en) Anti-cancer peptide
US12037413B2 (en) Anti-NME antibody and method of treating cancer or cancer metastasis
US12415868B1 (en) Anti-NME antibody and method of treating cancer or cancer metastasis
US12049514B2 (en) Anti-NME antibody and method of treating cancer or cancer metastasis

Legal Events

Date Code Title Description
AS Assignment

Owner name: MINERVA BIOTECHNOLOGIES CORPORATION, MASSACHUSETTS

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:BAMDAD, CYNTHIA C.;SMAGGHE, BENOIT;SIGNING DATES FROM 20161010 TO 20161018;REEL/FRAME:040059/0643

STCB Information on status: application discontinuation

Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION